Basic Information | |
---|---|
Family ID | F015375 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 255 |
Average Sequence Length | 44 residues |
Representative Sequence | MQIGKPLRTIVVEPLELPVEQPTREPEPEPIQSPESEPEQVPAKQ |
Number of Associated Samples | 170 |
Number of Associated Scaffolds | 255 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 81.42 % |
% of genes near scaffold ends (potentially truncated) | 29.80 % |
% of genes from short scaffolds (< 2000 bps) | 74.12 % |
Associated GOLD sequencing projects | 159 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.19 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (77.255 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland (13.333 % of family members) |
Environment Ontology (ENVO) | Unclassified (44.314 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.451 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.19 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 255 Family Scaffolds |
---|---|---|
PF00239 | Resolvase | 18.04 |
PF13384 | HTH_23 | 2.35 |
PF00226 | DnaJ | 1.96 |
PF00326 | Peptidase_S9 | 1.57 |
PF08867 | FRG | 1.18 |
PF07676 | PD40 | 1.18 |
PF13091 | PLDc_2 | 0.78 |
PF00486 | Trans_reg_C | 0.78 |
PF13431 | TPR_17 | 0.78 |
PF00004 | AAA | 0.78 |
PF09851 | SHOCT | 0.78 |
PF11074 | DUF2779 | 0.78 |
PF00782 | DSPc | 0.78 |
PF00072 | Response_reg | 0.39 |
PF00294 | PfkB | 0.39 |
PF00891 | Methyltransf_2 | 0.39 |
PF00149 | Metallophos | 0.39 |
PF13392 | HNH_3 | 0.39 |
PF13166 | AAA_13 | 0.39 |
PF00107 | ADH_zinc_N | 0.39 |
PF02586 | SRAP | 0.39 |
PF01909 | NTP_transf_2 | 0.39 |
PF07110 | EthD | 0.39 |
PF01850 | PIN | 0.39 |
PF08279 | HTH_11 | 0.39 |
PF00762 | Ferrochelatase | 0.39 |
PF03861 | ANTAR | 0.39 |
PF02622 | DUF179 | 0.39 |
PF01272 | GreA_GreB | 0.39 |
PF02517 | Rce1-like | 0.39 |
PF13358 | DDE_3 | 0.39 |
PF00437 | T2SSE | 0.39 |
PF10431 | ClpB_D2-small | 0.39 |
PF05960 | DUF885 | 0.39 |
PF12867 | DinB_2 | 0.39 |
PF07366 | SnoaL | 0.39 |
PF01425 | Amidase | 0.39 |
PF02558 | ApbA | 0.39 |
PF00515 | TPR_1 | 0.39 |
PF00300 | His_Phos_1 | 0.39 |
COG ID | Name | Functional Category | % Frequency in 255 Family Scaffolds |
---|---|---|---|
COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 18.04 |
COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 18.04 |
COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.39 |
COG0276 | Protoheme ferro-lyase (ferrochelatase) | Coenzyme transport and metabolism [H] | 0.39 |
COG0782 | Transcription elongation factor, GreA/GreB family | Transcription [K] | 0.39 |
COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 0.39 |
COG1678 | Putative transcriptional regulator, AlgH/UPF0301 family | Transcription [K] | 0.39 |
COG2135 | ssDNA abasic site-binding protein YedK/HMCES, SRAP family | Replication, recombination and repair [L] | 0.39 |
COG3707 | Two-component response regulator, AmiR/NasT family, consists of REC and RNA-binding antiterminator (ANTAR) domains | Transcription [K] | 0.39 |
COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 0.39 |
COG4805 | Uncharacterized conserved protein, DUF885 family | Function unknown [S] | 0.39 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 77.25 % |
Unclassified | root | N/A | 22.75 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000364|INPhiseqgaiiFebDRAFT_101754055 | Not Available | 1070 | Open in IMG/M |
3300000567|JGI12270J11330_10021371 | All Organisms → cellular organisms → Bacteria | 3991 | Open in IMG/M |
3300000567|JGI12270J11330_10089160 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1406 | Open in IMG/M |
3300000567|JGI12270J11330_10291357 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 510 | Open in IMG/M |
3300000579|AP72_2010_repI_A01DRAFT_1009900 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1553 | Open in IMG/M |
3300004091|Ga0062387_101311431 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
3300004092|Ga0062389_101207326 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 942 | Open in IMG/M |
3300004629|Ga0008092_10094379 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
3300004633|Ga0066395_10950128 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
3300005330|Ga0070690_101741200 | Not Available | 507 | Open in IMG/M |
3300005332|Ga0066388_100714633 | All Organisms → cellular organisms → Bacteria | 1607 | Open in IMG/M |
3300005332|Ga0066388_103627173 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
3300005332|Ga0066388_104057112 | Not Available | 747 | Open in IMG/M |
3300005332|Ga0066388_106058357 | Not Available | 611 | Open in IMG/M |
3300005435|Ga0070714_101674697 | Not Available | 621 | Open in IMG/M |
3300005471|Ga0070698_100179444 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2056 | Open in IMG/M |
3300005533|Ga0070734_10000364 | All Organisms → cellular organisms → Bacteria | 102319 | Open in IMG/M |
3300005546|Ga0070696_101928203 | Not Available | 512 | Open in IMG/M |
3300005764|Ga0066903_100034893 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5791 | Open in IMG/M |
3300005764|Ga0066903_100329238 | All Organisms → cellular organisms → Bacteria | 2448 | Open in IMG/M |
3300005764|Ga0066903_100531977 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2007 | Open in IMG/M |
3300005938|Ga0066795_10050447 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 1226 | Open in IMG/M |
3300006055|Ga0097691_1014518 | All Organisms → cellular organisms → Bacteria | 3676 | Open in IMG/M |
3300006059|Ga0075017_100483873 | All Organisms → cellular organisms → Bacteria | 937 | Open in IMG/M |
3300006059|Ga0075017_101264929 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
3300006102|Ga0075015_100090384 | All Organisms → cellular organisms → Bacteria | 1522 | Open in IMG/M |
3300006102|Ga0075015_100367004 | Not Available | 806 | Open in IMG/M |
3300006162|Ga0075030_101126208 | Not Available | 617 | Open in IMG/M |
3300006162|Ga0075030_101290597 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
3300006174|Ga0075014_100891882 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 532 | Open in IMG/M |
3300006795|Ga0075520_1048722 | All Organisms → cellular organisms → Bacteria | 2040 | Open in IMG/M |
3300006795|Ga0075520_1167257 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 949 | Open in IMG/M |
3300006795|Ga0075520_1267541 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
3300006854|Ga0075425_101105989 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 902 | Open in IMG/M |
3300009089|Ga0099828_11130895 | Not Available | 695 | Open in IMG/M |
3300009518|Ga0116128_1005404 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 4839 | Open in IMG/M |
3300009519|Ga0116108_1002862 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 8209 | Open in IMG/M |
3300009519|Ga0116108_1141685 | Not Available | 715 | Open in IMG/M |
3300009520|Ga0116214_1397989 | Not Available | 537 | Open in IMG/M |
3300009521|Ga0116222_1257323 | Not Available | 753 | Open in IMG/M |
3300009522|Ga0116218_1022926 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2782 | Open in IMG/M |
3300009522|Ga0116218_1224483 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 846 | Open in IMG/M |
3300009524|Ga0116225_1177369 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 966 | Open in IMG/M |
3300009525|Ga0116220_10250455 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 773 | Open in IMG/M |
3300009525|Ga0116220_10323131 | Not Available | 682 | Open in IMG/M |
3300009547|Ga0116136_1161876 | Not Available | 565 | Open in IMG/M |
3300009548|Ga0116107_1005316 | All Organisms → cellular organisms → Bacteria | 5972 | Open in IMG/M |
3300009616|Ga0116111_1039984 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1425 | Open in IMG/M |
3300009617|Ga0116123_1053532 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1142 | Open in IMG/M |
3300009629|Ga0116119_1036595 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1301 | Open in IMG/M |
3300009630|Ga0116114_1021071 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1967 | Open in IMG/M |
3300009632|Ga0116102_1032405 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1734 | Open in IMG/M |
3300009632|Ga0116102_1141009 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 668 | Open in IMG/M |
3300009640|Ga0116126_1277622 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 519 | Open in IMG/M |
3300009643|Ga0116110_1147522 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 778 | Open in IMG/M |
3300009645|Ga0116106_1010308 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3470 | Open in IMG/M |
3300009645|Ga0116106_1044084 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1501 | Open in IMG/M |
3300009698|Ga0116216_10206272 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1205 | Open in IMG/M |
3300009700|Ga0116217_10879870 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 550 | Open in IMG/M |
3300009762|Ga0116130_1165433 | Not Available | 698 | Open in IMG/M |
3300009762|Ga0116130_1238586 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 578 | Open in IMG/M |
3300009764|Ga0116134_1010562 | All Organisms → cellular organisms → Bacteria | 3991 | Open in IMG/M |
3300009839|Ga0116223_10035084 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3375 | Open in IMG/M |
3300010043|Ga0126380_10092727 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1787 | Open in IMG/M |
3300010046|Ga0126384_10083865 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2304 | Open in IMG/M |
3300010046|Ga0126384_10684328 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 907 | Open in IMG/M |
3300010048|Ga0126373_10248103 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1750 | Open in IMG/M |
3300010339|Ga0074046_10010550 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 6897 | Open in IMG/M |
3300010339|Ga0074046_10874464 | Not Available | 524 | Open in IMG/M |
3300010343|Ga0074044_10031438 | All Organisms → cellular organisms → Bacteria | 3735 | Open in IMG/M |
3300010343|Ga0074044_10272792 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1115 | Open in IMG/M |
3300010343|Ga0074044_10622225 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 705 | Open in IMG/M |
3300010379|Ga0136449_100378094 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2528 | Open in IMG/M |
3300010379|Ga0136449_100460491 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2227 | Open in IMG/M |
3300010379|Ga0136449_101302091 | Not Available | 1133 | Open in IMG/M |
3300010379|Ga0136449_102500836 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 740 | Open in IMG/M |
3300010379|Ga0136449_102929476 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 669 | Open in IMG/M |
3300010379|Ga0136449_104559285 | Not Available | 508 | Open in IMG/M |
3300010398|Ga0126383_10051737 | All Organisms → cellular organisms → Bacteria | 3425 | Open in IMG/M |
3300010398|Ga0126383_11626036 | Not Available | 735 | Open in IMG/M |
3300011270|Ga0137391_10466140 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1073 | Open in IMG/M |
3300012096|Ga0137389_11573461 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 553 | Open in IMG/M |
3300012202|Ga0137363_11418755 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 584 | Open in IMG/M |
3300012362|Ga0137361_10851971 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 828 | Open in IMG/M |
3300012582|Ga0137358_10008030 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6484 | Open in IMG/M |
3300012685|Ga0137397_10838940 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 682 | Open in IMG/M |
3300012925|Ga0137419_11716076 | Not Available | 536 | Open in IMG/M |
3300012948|Ga0126375_11516432 | Not Available | 574 | Open in IMG/M |
3300014156|Ga0181518_10016121 | All Organisms → cellular organisms → Bacteria | 5365 | Open in IMG/M |
3300014156|Ga0181518_10173770 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1137 | Open in IMG/M |
3300014156|Ga0181518_10582149 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 523 | Open in IMG/M |
3300014159|Ga0181530_10013293 | All Organisms → cellular organisms → Bacteria | 6876 | Open in IMG/M |
3300014159|Ga0181530_10449127 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 649 | Open in IMG/M |
3300014162|Ga0181538_10167158 | All Organisms → cellular organisms → Bacteria | 1252 | Open in IMG/M |
3300014162|Ga0181538_10640976 | Not Available | 553 | Open in IMG/M |
3300014164|Ga0181532_10008052 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 8520 | Open in IMG/M |
3300014489|Ga0182018_10029983 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3467 | Open in IMG/M |
3300014489|Ga0182018_10136493 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1410 | Open in IMG/M |
3300014489|Ga0182018_10338203 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 813 | Open in IMG/M |
3300014491|Ga0182014_10045974 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3077 | Open in IMG/M |
3300014491|Ga0182014_10073912 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2176 | Open in IMG/M |
3300014494|Ga0182017_10634308 | Not Available | 650 | Open in IMG/M |
3300014495|Ga0182015_10906412 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 552 | Open in IMG/M |
3300014496|Ga0182011_10529008 | Not Available | 756 | Open in IMG/M |
3300014498|Ga0182019_10206851 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1272 | Open in IMG/M |
3300014501|Ga0182024_10148431 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3300 | Open in IMG/M |
3300014501|Ga0182024_10215369 | All Organisms → cellular organisms → Bacteria | 2609 | Open in IMG/M |
3300014501|Ga0182024_10593969 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter modestus | 1388 | Open in IMG/M |
3300014501|Ga0182024_11633825 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 729 | Open in IMG/M |
3300014501|Ga0182024_11905353 | Not Available | 661 | Open in IMG/M |
3300014501|Ga0182024_12759361 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
3300014638|Ga0181536_10007681 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 10549 | Open in IMG/M |
3300014638|Ga0181536_10266952 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 810 | Open in IMG/M |
3300015245|Ga0137409_11136116 | Not Available | 621 | Open in IMG/M |
3300016294|Ga0182041_11028788 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 745 | Open in IMG/M |
3300016371|Ga0182034_10677132 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 875 | Open in IMG/M |
3300016750|Ga0181505_10849613 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1725 | Open in IMG/M |
3300017823|Ga0187818_10147156 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1025 | Open in IMG/M |
3300017823|Ga0187818_10266687 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 750 | Open in IMG/M |
3300017823|Ga0187818_10357664 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 645 | Open in IMG/M |
3300017823|Ga0187818_10502993 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 544 | Open in IMG/M |
3300017823|Ga0187818_10503537 | Not Available | 544 | Open in IMG/M |
3300017925|Ga0187856_1002113 | All Organisms → cellular organisms → Bacteria | 14960 | Open in IMG/M |
3300017925|Ga0187856_1005198 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 8430 | Open in IMG/M |
3300017928|Ga0187806_1316080 | Not Available | 553 | Open in IMG/M |
3300017929|Ga0187849_1048210 | All Organisms → cellular organisms → Bacteria | 2011 | Open in IMG/M |
3300017929|Ga0187849_1082544 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1399 | Open in IMG/M |
3300017929|Ga0187849_1146239 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 957 | Open in IMG/M |
3300017933|Ga0187801_10160970 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 878 | Open in IMG/M |
3300017933|Ga0187801_10341107 | Not Available | 615 | Open in IMG/M |
3300017934|Ga0187803_10141213 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 947 | Open in IMG/M |
3300017938|Ga0187854_10247588 | Not Available | 774 | Open in IMG/M |
3300017939|Ga0187775_10160705 | Not Available | 807 | Open in IMG/M |
3300017941|Ga0187850_10538048 | Not Available | 504 | Open in IMG/M |
3300017943|Ga0187819_10426436 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 761 | Open in IMG/M |
3300017943|Ga0187819_10617242 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 614 | Open in IMG/M |
3300017946|Ga0187879_10137778 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1385 | Open in IMG/M |
3300017946|Ga0187879_10411432 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 749 | Open in IMG/M |
3300017948|Ga0187847_10348473 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 811 | Open in IMG/M |
3300017955|Ga0187817_10107418 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1760 | Open in IMG/M |
3300017955|Ga0187817_10387637 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 891 | Open in IMG/M |
3300017955|Ga0187817_10506105 | Not Available | 771 | Open in IMG/M |
3300017959|Ga0187779_10038507 | All Organisms → cellular organisms → Bacteria | 2769 | Open in IMG/M |
3300017959|Ga0187779_11065574 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 563 | Open in IMG/M |
3300017961|Ga0187778_10025420 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3617 | Open in IMG/M |
3300017972|Ga0187781_10119488 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1837 | Open in IMG/M |
3300017972|Ga0187781_10324841 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1093 | Open in IMG/M |
3300017972|Ga0187781_11282534 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 540 | Open in IMG/M |
3300017975|Ga0187782_10135920 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1824 | Open in IMG/M |
3300017975|Ga0187782_10667032 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 801 | Open in IMG/M |
3300017995|Ga0187816_10207000 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 853 | Open in IMG/M |
3300017995|Ga0187816_10336404 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 666 | Open in IMG/M |
3300017995|Ga0187816_10434785 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 586 | Open in IMG/M |
3300017998|Ga0187870_1003785 | All Organisms → cellular organisms → Bacteria | 11342 | Open in IMG/M |
3300017998|Ga0187870_1309935 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 529 | Open in IMG/M |
3300018001|Ga0187815_10003382 | All Organisms → cellular organisms → Bacteria | 7374 | Open in IMG/M |
3300018001|Ga0187815_10141495 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1017 | Open in IMG/M |
3300018002|Ga0187868_1113725 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1027 | Open in IMG/M |
3300018003|Ga0187876_1031635 | All Organisms → cellular organisms → Bacteria | 2351 | Open in IMG/M |
3300018003|Ga0187876_1069956 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1380 | Open in IMG/M |
3300018003|Ga0187876_1093335 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1130 | Open in IMG/M |
3300018004|Ga0187865_1091080 | Not Available | 1132 | Open in IMG/M |
3300018006|Ga0187804_10002323 | All Organisms → cellular organisms → Bacteria | 5702 | Open in IMG/M |
3300018006|Ga0187804_10010176 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3207 | Open in IMG/M |
3300018006|Ga0187804_10182006 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 894 | Open in IMG/M |
3300018006|Ga0187804_10541842 | Not Available | 525 | Open in IMG/M |
3300018012|Ga0187810_10021786 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2312 | Open in IMG/M |
3300018012|Ga0187810_10277259 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 691 | Open in IMG/M |
3300018014|Ga0187860_1376190 | Not Available | 536 | Open in IMG/M |
3300018016|Ga0187880_1002834 | All Organisms → cellular organisms → Bacteria | 13396 | Open in IMG/M |
3300018016|Ga0187880_1011616 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5712 | Open in IMG/M |
3300018019|Ga0187874_10016665 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3967 | Open in IMG/M |
3300018020|Ga0187861_10049879 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2192 | Open in IMG/M |
3300018020|Ga0187861_10193185 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 914 | Open in IMG/M |
3300018020|Ga0187861_10296465 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 694 | Open in IMG/M |
3300018022|Ga0187864_10366939 | Not Available | 627 | Open in IMG/M |
3300018033|Ga0187867_10109783 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1603 | Open in IMG/M |
3300018037|Ga0187883_10431708 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 676 | Open in IMG/M |
3300018037|Ga0187883_10441183 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 668 | Open in IMG/M |
3300018040|Ga0187862_10028008 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4294 | Open in IMG/M |
3300018042|Ga0187871_10110836 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1574 | Open in IMG/M |
3300018043|Ga0187887_10173318 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1288 | Open in IMG/M |
3300018043|Ga0187887_10355009 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 865 | Open in IMG/M |
3300018057|Ga0187858_10536118 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 712 | Open in IMG/M |
3300018060|Ga0187765_10745459 | Not Available | 648 | Open in IMG/M |
3300018085|Ga0187772_10603023 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 781 | Open in IMG/M |
3300018085|Ga0187772_10659545 | Not Available | 748 | Open in IMG/M |
3300018090|Ga0187770_10121127 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1972 | Open in IMG/M |
3300018090|Ga0187770_11209757 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 611 | Open in IMG/M |
3300019786|Ga0182025_1216851 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1706 | Open in IMG/M |
3300019888|Ga0193751_1016498 | All Organisms → cellular organisms → Bacteria | 3737 | Open in IMG/M |
3300020579|Ga0210407_10409590 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1061 | Open in IMG/M |
3300020583|Ga0210401_11604314 | Not Available | 508 | Open in IMG/M |
3300021180|Ga0210396_11681615 | Not Available | 516 | Open in IMG/M |
3300021406|Ga0210386_10273171 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1445 | Open in IMG/M |
3300021420|Ga0210394_10355047 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1288 | Open in IMG/M |
3300021559|Ga0210409_10087891 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2873 | Open in IMG/M |
3300021560|Ga0126371_10109131 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2771 | Open in IMG/M |
3300021560|Ga0126371_10671840 | Not Available | 1184 | Open in IMG/M |
3300021560|Ga0126371_13066063 | Not Available | 565 | Open in IMG/M |
3300021861|Ga0213853_11038834 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 554 | Open in IMG/M |
3300022518|Ga0224548_1041392 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 510 | Open in IMG/M |
3300022881|Ga0224545_1002588 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3262 | Open in IMG/M |
3300023090|Ga0224558_1006120 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 8507 | Open in IMG/M |
3300025446|Ga0208038_1077769 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 581 | Open in IMG/M |
3300025498|Ga0208819_1052939 | All Organisms → cellular organisms → Bacteria | 935 | Open in IMG/M |
3300025498|Ga0208819_1073488 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 753 | Open in IMG/M |
3300025500|Ga0208686_1009097 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2844 | Open in IMG/M |
3300025650|Ga0209385_1196693 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 561 | Open in IMG/M |
3300025922|Ga0207646_10104321 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2543 | Open in IMG/M |
3300026273|Ga0209881_1112837 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 677 | Open in IMG/M |
3300026555|Ga0179593_1038362 | Not Available | 2905 | Open in IMG/M |
3300027063|Ga0207762_1041354 | Not Available | 686 | Open in IMG/M |
3300027394|Ga0209904_1000682 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3057 | Open in IMG/M |
3300027570|Ga0208043_1065629 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1030 | Open in IMG/M |
3300027703|Ga0207862_1252326 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 517 | Open in IMG/M |
3300027727|Ga0209328_10232538 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 552 | Open in IMG/M |
3300027783|Ga0209448_10200540 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 662 | Open in IMG/M |
3300027812|Ga0209656_10393811 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 622 | Open in IMG/M |
3300027824|Ga0209040_10072449 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2013 | Open in IMG/M |
3300027825|Ga0209039_10365777 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 557 | Open in IMG/M |
3300027826|Ga0209060_10000311 | All Organisms → cellular organisms → Bacteria | 102364 | Open in IMG/M |
3300027854|Ga0209517_10047453 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3290 | Open in IMG/M |
3300027854|Ga0209517_10516579 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 648 | Open in IMG/M |
3300027874|Ga0209465_10639838 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 525 | Open in IMG/M |
3300027911|Ga0209698_10511941 | All Organisms → cellular organisms → Bacteria | 929 | Open in IMG/M |
3300028536|Ga0137415_10254159 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1566 | Open in IMG/M |
3300028800|Ga0265338_10697207 | Not Available | 701 | Open in IMG/M |
3300029817|Ga0247275_1001751 | All Organisms → cellular organisms → Bacteria | 16205 | Open in IMG/M |
3300029889|Ga0246001_1059169 | Not Available | 795 | Open in IMG/M |
3300030706|Ga0310039_10154958 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 924 | Open in IMG/M |
3300030707|Ga0310038_10177971 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1032 | Open in IMG/M |
3300031258|Ga0302318_10340214 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 751 | Open in IMG/M |
3300031258|Ga0302318_10612184 | Not Available | 550 | Open in IMG/M |
3300031261|Ga0302140_10877236 | Not Available | 631 | Open in IMG/M |
3300031708|Ga0310686_100253612 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1498 | Open in IMG/M |
3300031754|Ga0307475_11315896 | Not Available | 559 | Open in IMG/M |
3300031823|Ga0307478_10055725 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2945 | Open in IMG/M |
3300031890|Ga0306925_11393954 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 692 | Open in IMG/M |
3300031912|Ga0306921_11330675 | Not Available | 793 | Open in IMG/M |
3300032035|Ga0310911_10873395 | Not Available | 519 | Open in IMG/M |
3300032160|Ga0311301_10071587 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 7302 | Open in IMG/M |
3300032160|Ga0311301_10966528 | Not Available | 1133 | Open in IMG/M |
3300032160|Ga0311301_12331359 | Not Available | 607 | Open in IMG/M |
3300032180|Ga0307471_102673842 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 633 | Open in IMG/M |
3300032180|Ga0307471_102884460 | Not Available | 610 | Open in IMG/M |
3300032261|Ga0306920_100310662 | All Organisms → cellular organisms → Bacteria | 2347 | Open in IMG/M |
3300032261|Ga0306920_100636054 | Not Available | 1577 | Open in IMG/M |
3300032770|Ga0335085_10210057 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2376 | Open in IMG/M |
3300032782|Ga0335082_10278981 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1548 | Open in IMG/M |
3300032892|Ga0335081_10500038 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1530 | Open in IMG/M |
3300034125|Ga0370484_0136502 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 654 | Open in IMG/M |
3300034163|Ga0370515_0080953 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1410 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 13.33% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 10.59% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 9.80% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 9.02% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 5.88% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.31% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.31% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 3.92% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.92% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.14% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.75% |
Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 2.75% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.35% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.35% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.96% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.96% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.57% |
Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 1.57% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.18% |
Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 1.18% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.18% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.18% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.18% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.78% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.78% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.78% |
Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.78% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.78% |
Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.39% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.39% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.39% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.39% |
Thawing Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost | 0.39% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.39% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.39% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.39% |
Peat | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat | 0.39% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.39% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.39% |
Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.39% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
3300000579 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A01 | Environmental | Open in IMG/M |
3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004629 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome P72I A01 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005938 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191 | Environmental | Open in IMG/M |
3300006055 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 deep-072012 | Environmental | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
3300006795 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-B | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009518 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 | Environmental | Open in IMG/M |
3300009519 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 | Environmental | Open in IMG/M |
3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
3300009547 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40 | Environmental | Open in IMG/M |
3300009548 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_100 | Environmental | Open in IMG/M |
3300009616 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100 | Environmental | Open in IMG/M |
3300009617 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_100 | Environmental | Open in IMG/M |
3300009629 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_100 | Environmental | Open in IMG/M |
3300009630 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40 | Environmental | Open in IMG/M |
3300009632 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 | Environmental | Open in IMG/M |
3300009640 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40 | Environmental | Open in IMG/M |
3300009643 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 | Environmental | Open in IMG/M |
3300009645 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 | Environmental | Open in IMG/M |
3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
3300009762 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40 | Environmental | Open in IMG/M |
3300009764 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40 | Environmental | Open in IMG/M |
3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300014156 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaG | Environmental | Open in IMG/M |
3300014159 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaG | Environmental | Open in IMG/M |
3300014162 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG | Environmental | Open in IMG/M |
3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
3300014491 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaG | Environmental | Open in IMG/M |
3300014494 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E3D metaG | Environmental | Open in IMG/M |
3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
3300014496 | Permafrost microbial communities from Stordalen Mire, Sweden - 711E1D metaG | Environmental | Open in IMG/M |
3300014498 | Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG | Environmental | Open in IMG/M |
3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300014638 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaG | Environmental | Open in IMG/M |
3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300016750 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
3300017925 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40 | Environmental | Open in IMG/M |
3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
3300017929 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100 | Environmental | Open in IMG/M |
3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
3300017938 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150 | Environmental | Open in IMG/M |
3300017939 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG | Environmental | Open in IMG/M |
3300017941 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_150 | Environmental | Open in IMG/M |
3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
3300017998 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_150 | Environmental | Open in IMG/M |
3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
3300018002 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_40 | Environmental | Open in IMG/M |
3300018003 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_40 | Environmental | Open in IMG/M |
3300018004 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_100 | Environmental | Open in IMG/M |
3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
3300018014 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_40 | Environmental | Open in IMG/M |
3300018016 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40 | Environmental | Open in IMG/M |
3300018019 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150 | Environmental | Open in IMG/M |
3300018020 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_100 | Environmental | Open in IMG/M |
3300018022 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40 | Environmental | Open in IMG/M |
3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022518 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P2 20-24 | Environmental | Open in IMG/M |
3300022881 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P1 20-24 | Environmental | Open in IMG/M |
3300023090 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 20-24 | Environmental | Open in IMG/M |
3300025446 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_100 (SPAdes) | Environmental | Open in IMG/M |
3300025498 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150 (SPAdes) | Environmental | Open in IMG/M |
3300025500 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 (SPAdes) | Environmental | Open in IMG/M |
3300025650 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-B (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026273 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 3 DNA2013-193 (SPAdes) | Environmental | Open in IMG/M |
3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300027063 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 37 (SPAdes) | Environmental | Open in IMG/M |
3300027394 | Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 712P3D | Environmental | Open in IMG/M |
3300027570 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG (SPAdes) | Environmental | Open in IMG/M |
3300027703 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes) | Environmental | Open in IMG/M |
3300027727 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
3300029817 | Soil microbial communities from Marcell Experimental Forest, Minnesota, USA - Bog25 | Environmental | Open in IMG/M |
3300029889 | Peat microbial communities from Marcell Experimental Forest bog in Minnesota, USA - MG_T3F_30cm | Environmental | Open in IMG/M |
3300030706 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2) | Environmental | Open in IMG/M |
3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
3300031258 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_1 | Environmental | Open in IMG/M |
3300031261 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_1 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300034125 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_tus_01_15 | Environmental | Open in IMG/M |
3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
INPhiseqgaiiFebDRAFT_1017540555 | 3300000364 | Soil | MQIGEPLRTVIVEPLEVPVKQPAREPEPVVAPQPGPEQVPVAQ* |
JGI12270J11330_100213712 | 3300000567 | Peatlands Soil | MMQIGKPLRTIVVEPLELPVEQPTREPEPEPVQSPESEPEQVPAKQ* |
JGI12270J11330_100891605 | 3300000567 | Peatlands Soil | MQIGKPLRTIVVEPLDLPVEQPTREPEPEPMHSPESEPEQVPAKQ* |
JGI12270J11330_102913571 | 3300000567 | Peatlands Soil | MQIGKPLRTIVVEPLELPVEQPTREPEPEPVQSPESEPEQVPAKQ* |
AP72_2010_repI_A01DRAFT_10099002 | 3300000579 | Forest Soil | MQIGEPLRTIVVEPLELPVNTPAVEPELEPEPAKRESEPELVPASV* |
Ga0062387_1013114312 | 3300004091 | Bog Forest Soil | MQIGEPLRTIVVEPLELPVKEPTRESEPQPIQSPEPEPEQVPAAP* |
Ga0062389_1012073263 | 3300004092 | Bog Forest Soil | MQIGKPLRTIVVEPLELPVQEPKAEPEHEPIQSPESEPQKVPVAS* |
Ga0008092_100943792 | 3300004629 | Tropical Rainforest Soil | MQIGERVRTIIVEPLELPMEQPTREPELVPVPDNEPEQMPAAQ* |
Ga0066395_109501282 | 3300004633 | Tropical Forest Soil | MQIGEPLRTIVVEPLELPLNKPVVEPELEPEPLKPESDPERVP |
Ga0070690_1017412001 | 3300005330 | Switchgrass Rhizosphere | MQIGEPLRTVMVEPLQVPVKQPAREPEPVVAPEPGPEHVPVAQ* |
Ga0066388_1007146332 | 3300005332 | Tropical Forest Soil | MEECAMQIGEPLRTIVVEPLELPVNKPAVEPELEPEPAKPESEPERVPASV* |
Ga0066388_1036271732 | 3300005332 | Tropical Forest Soil | MQIGEPLRTVIVEPLELPVKQPTGEPEPVIAPQPEPEQEPVAQ* |
Ga0066388_1040571122 | 3300005332 | Tropical Forest Soil | MQIGEPLRTIIVEPLEAPVKQPTSEPELAVVPDTESEPTPATQ* |
Ga0066388_1060583572 | 3300005332 | Tropical Forest Soil | MQIGEPLRTIIVEPLELPVEQPTPEPELVTVPDTEPEETPAAQ* |
Ga0070714_1016746972 | 3300005435 | Agricultural Soil | MQIGKPLRTIVVEPLEAPVDKPEPLPANPIARPEAEPEQEPATK* |
Ga0070698_1001794446 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MQIGKPLRTIVVEPLELPVKQSTDKPEPIRPPEREPEPAE |
Ga0070734_1000036416 | 3300005533 | Surface Soil | MEIGEPKRTIVVEPLHLPISQPAPEPEPVVVPEKEPEQVPALP* |
Ga0070696_1019282032 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MQIGEPLRTIIVEPLHLPVKQPTGEPESEPIQSPESEPERMPVAL |
Ga0066903_1000348934 | 3300005764 | Tropical Forest Soil | MQIGEPLRTIVVEPLELPVNKPAVEPELEPEPAKPESEPERVPASV* |
Ga0066903_1003292382 | 3300005764 | Tropical Forest Soil | MQIGEPLRTVVVEPLELPLNKPVVEPELEPEPLKPESDPERVPASV* |
Ga0066903_1005319773 | 3300005764 | Tropical Forest Soil | MQIGEPVRTIVVEPLELPVNEPAVEPEVEPEPRKPTHDPERVPARV* |
Ga0066795_100504475 | 3300005938 | Soil | MQIGEPLRTIVVEPLEIPVNKPSAEPEPVVEQPEPVPEQVPVAQ* |
Ga0097691_10145184 | 3300006055 | Arctic Peat Soil | MQIGEPLRTIVVEPLELPVNQPTDKPEPVPASAQPEPEQVPVAQ* |
Ga0075017_1004838732 | 3300006059 | Watersheds | IVVEPLELPVTRPIVEPEVVPLVEPEPEQVPVAQ* |
Ga0075017_1012649292 | 3300006059 | Watersheds | MQIGKPLRTVIVEPLELPVSEPTAESEPQPQAPEAEPEQVPATP* |
Ga0075015_1000903843 | 3300006102 | Watersheds | RTIVVEPLELPVTRPIVEPEVVPLVEPEPEQVPVAQ* |
Ga0075015_1003670041 | 3300006102 | Watersheds | MQIGKPLRTIVVEPLETPVQQPRAEPEPSHEAEPQ |
Ga0075030_1011262082 | 3300006162 | Watersheds | MQIGKPLRTVIVEPLELPVEKSTSEPEPVPVTEPE |
Ga0075030_1012905971 | 3300006162 | Watersheds | MQIGEPLRTIVVEPLELPVEQPTGEPEPEPIQSPEPEPQQ |
Ga0075014_1008918821 | 3300006174 | Watersheds | RTIVVEPLEVPVEQPTREPQPEPIQSPESEPEQVPVTP* |
Ga0075520_10487222 | 3300006795 | Arctic Peat Soil | VQIGKSVKTILVEPLELPVAEPESQPEPEPIQSPESEPEQVPVKP* |
Ga0075520_11672572 | 3300006795 | Arctic Peat Soil | MQIGEPLRTIVVEPLELPVQQPAAEPETFPASAQPVPEQEPVAQ* |
Ga0075520_12675412 | 3300006795 | Arctic Peat Soil | MQIGEPLRTIVVEPLEVPVQQPAAEPETFPASAQPVPEQEPVAQ* |
Ga0075425_1011059892 | 3300006854 | Populus Rhizosphere | MLIGEPLRTFVVEPLELPMKQPTGEPEPVPMPELEPDQVPVTQ* |
Ga0099828_111308952 | 3300009089 | Vadose Zone Soil | MQIGEPLRIIVVEPLELPVQQLPEEPELVPVQEPEPEQVPVAQ* |
Ga0116128_10054046 | 3300009518 | Peatland | MMQIGKPLRTIVVEPLELPVEQPTREPEPEPIQSPESEPEQVPAEP* |
Ga0116108_10028628 | 3300009519 | Peatland | MQVGEPLRTIVVEPLEFPVKQPTGEPEPEPIQSPESEPEQVPAAP* |
Ga0116108_11416852 | 3300009519 | Peatland | MQIGKPLRTIVVEPLELPVEQPTREAEPEPIQSPAPEPEQVPAKQ* |
Ga0116214_13979892 | 3300009520 | Peatlands Soil | MQIGKPLRTIVVEPLELPVEQPKGEPEPEPIQSPESEPEQVPVKQ* |
Ga0116222_12573233 | 3300009521 | Peatlands Soil | MMQIGKPLRTIVVEALELPVEQLTREPEPEPIQSPEPEPQQV |
Ga0116218_10229262 | 3300009522 | Peatlands Soil | MMQIGKPLRTIVVEPLELPVEQPTREPEPIQSPESEPEQVPTKP* |
Ga0116218_12244831 | 3300009522 | Peatlands Soil | MMQIGKPLRTIVVEPLELPVEQPTREPEPKRIQSPEPKPDPQQVPAKQ* |
Ga0116225_11773691 | 3300009524 | Peatlands Soil | MQIGKPLRTIVVEPLELPVEQPTSEPEPEPIQSPESEPEQVPA* |
Ga0116220_102504551 | 3300009525 | Peatlands Soil | TIVVEPLELPVDQPKGEPEPGLIQSPESEPEQVPAKQ* |
Ga0116220_103231313 | 3300009525 | Peatlands Soil | MMQIGEPLRTIVVEPLEPPVNEPTREPEPEPIQSP |
Ga0116136_11618762 | 3300009547 | Peatland | MQIGKPLRTIVVEPLERPVEQPAREPEPEPMQSPESEPEQVPAKQ* |
Ga0116107_10053165 | 3300009548 | Peatland | MQIGEALRTVVVEPLELPVKQSTHEPEPVPVPELEPETEQVLVAR* |
Ga0116111_10399843 | 3300009616 | Peatland | MMQIGKPLRTIVVEPLELPVEQPTREPEPEPIQSPEPEPEQLHRCGLCAA* |
Ga0116123_10535321 | 3300009617 | Peatland | MMQIGKPLRTIVVEPLELPVEQPTREPEPEPIQSPESEPEQVPAKQ* |
Ga0116119_10365953 | 3300009629 | Peatland | MQIGKPLRTIVVEPLDLPVEQPTREPEPEPIQSPEQEPQQVPVTQ* |
Ga0116114_10210713 | 3300009630 | Peatland | MQIGKPLRTIVVEPLELPVEQPTREPEPEPMHSPESEPKQVPAKQ* |
Ga0116102_10324055 | 3300009632 | Peatland | MMQIGKPLRTIVVEPLELSVEQPTREPEPEPIQSPESEPEQVPAEP* |
Ga0116102_11410091 | 3300009632 | Peatland | NWGQMMQIGKPLRTIVVEPLELPVEQPTREPEPEPIQSPESEPEQVPAEP* |
Ga0116126_12776221 | 3300009640 | Peatland | MMHIGKPLRTIVVEPLELPVSEPTREPEPEPIQSPEP |
Ga0116110_11475221 | 3300009643 | Peatland | MMQIGKPLRTIVVEPLELPGEQPKREPEPEPIQSPESEPEQVPATR* |
Ga0116106_10103081 | 3300009645 | Peatland | GEPLRTIVVEPLELPVQQPTDEPEPVPVPEPEQVPVAQ* |
Ga0116106_10440843 | 3300009645 | Peatland | TIVVEPLELPVEQPTREPEPEPIQSPESEPEQVPAEP* |
Ga0116106_12598972 | 3300009645 | Peatland | AAGRVEGSKHMQIGKPLRTIVVEPLELPVEQPTREPEPEPMHSPESEPKQVPAKQ* |
Ga0116216_102062723 | 3300009698 | Peatlands Soil | MQIGKPLRTIVVEPLELPVEQPKGEPEPGLIQSPESEPEQVPAKQ* |
Ga0116217_108798701 | 3300009700 | Peatlands Soil | MQIGKPLRTIVVEPLELPVEQPEREPGPKPIQSPESEPEQVPAKQ* |
Ga0116130_11654332 | 3300009762 | Peatland | MMQIGEPLRTVIVEPLEVPVKEPTRGLEPEPIQSPEPEPEQVPAAP* |
Ga0116130_12385862 | 3300009762 | Peatland | MMQIGKPLRTIIVEPLEFPVEQPTREPEPEPVQQPESELEQVPVTP* |
Ga0116134_10105622 | 3300009764 | Peatland | MQIGEPLRTVIVEPLELPVSEPTREPEPEPIQTPDSEPELVPAKP* |
Ga0116223_100350847 | 3300009839 | Peatlands Soil | MMQIGKPLRTIVVEPLELPVEQPEREPGPKPIQSPESEPEQVPAKQ* |
Ga0126380_100927272 | 3300010043 | Tropical Forest Soil | MQIGDPLRTIVVEPLELPLNKPAVEPELEPEPLKPESDPERVPASV* |
Ga0126384_100838652 | 3300010046 | Tropical Forest Soil | MQIGEPLRTVIVEPLELPVNQPTSDPAPVVAPESEPEQVPVAQ* |
Ga0126384_106843281 | 3300010046 | Tropical Forest Soil | MQIGEPLRTIVVEPLELPLNKPVVEPELEPEPLKPESDPERVPASV* |
Ga0126373_102481032 | 3300010048 | Tropical Forest Soil | MQIGEPLRTIVVEPLELPLNKPVVEPELEPEPLKPESDPERVPANV* |
Ga0074046_100105504 | 3300010339 | Bog Forest Soil | MQIGEPLRTVVVEPLELPVKHSTDEPEPVPVPEPEPELETAQVPVAR* |
Ga0074046_108744642 | 3300010339 | Bog Forest Soil | MMQIGKPLPTIVVEPLELPVEQPTREPESEPIQSPGPEPEQVPANQ* |
Ga0074044_100314387 | 3300010343 | Bog Forest Soil | MQIGKPLRTIVVEPLELPVEHPTREPEPEPIQSPESEPQQVPAKQ* |
Ga0074044_102727922 | 3300010343 | Bog Forest Soil | MQIGKPLRTIVVEPLEDPVEQPTREPKPEPVQSPESEPEQVLVTP* |
Ga0074044_106222252 | 3300010343 | Bog Forest Soil | MQIGKPLRTIVVEPLELPVEQPTREPEPEPMHSPESEPEQVPAKQ* |
Ga0136449_1003780946 | 3300010379 | Peatlands Soil | MQIGKPLRTIIVEPLELPVERPTREPESEPMHSQESEPEQVPAKQ* |
Ga0136449_1004604915 | 3300010379 | Peatlands Soil | MQIGKPLRTIVVEPLELPVEQPTSEPEPEPIQSPESEPEQVPVTP* |
Ga0136449_1013020911 | 3300010379 | Peatlands Soil | MMQIGKPLRTIVVEPLELPVSEPTREPEPEPMQSPESEPEQVPAKQ* |
Ga0136449_1025008362 | 3300010379 | Peatlands Soil | MQIGRPLRVIVVEPLELPVDQPTREPEPEPIQSPESEPEQVPAKQ* |
Ga0136449_1029294762 | 3300010379 | Peatlands Soil | MQIGKPLRTIVVEPLELPVDQPSREPEPEPIQSPESEPEQVPAAP* |
Ga0136449_1045592852 | 3300010379 | Peatlands Soil | MMQIGKPLRTIVVEPLELPVEQPTREPEPKRIQSPEPKPEPQQVPAKQ* |
Ga0126383_100517371 | 3300010398 | Tropical Forest Soil | LRTVIVEPLELPVNQPTSDPAPVVAPESEPEQVPVAQ* |
Ga0126383_116260361 | 3300010398 | Tropical Forest Soil | MQIGEPLRTIIVEPLEVPAKQAMREPEPAVVPEAEPEQVPADH* |
Ga0137391_104661403 | 3300011270 | Vadose Zone Soil | MQIGQPQRTIVVEPLEIPVNKPSSEPEPVVELPEPEPERVPVTP* |
Ga0137389_115734611 | 3300012096 | Vadose Zone Soil | EIMQIGEPLRTIIIEPLELPVKQPTGEPEPEPIQSPESEPQEVPVPS* |
Ga0137363_114187552 | 3300012202 | Vadose Zone Soil | LRTIIVEPLELPVQPPADKPEHAPIQLPEPEPERVPVAQ* |
Ga0137361_108519711 | 3300012362 | Vadose Zone Soil | MKVGEMLRTIVVEPLELPVKQPTGEPEPEPIQSPE |
Ga0137358_100080308 | 3300012582 | Vadose Zone Soil | MQIGEPLRTIVVEPLELPVKPPVDEPEPETIQSPTREPEWMEVAQ* |
Ga0137397_108389402 | 3300012685 | Vadose Zone Soil | MLIGEPLRTFVVEPLELPVNLPTSESEPESIQSPEPESERVPVAL* |
Ga0137419_117160761 | 3300012925 | Vadose Zone Soil | MQIGEPLRTIVVEPLELPVKPPVDEPEPETIQSPTREPEWM |
Ga0126375_115164322 | 3300012948 | Tropical Forest Soil | MQIGEPLRTIVVEPLELPVNTPAVEPELEPKPLKPESDPERVPASV* |
Ga0181518_100161214 | 3300014156 | Bog | MMQIGKPLRTIVVEPLELPVSEPTREPEPEPIQSPESEPEQVPAKQ* |
Ga0181518_101737701 | 3300014156 | Bog | IGKPLRTIVVEPLELPVEQPTREPEHEPIQSPEPEPEQVPAKQ* |
Ga0181518_105821492 | 3300014156 | Bog | MMQIGKPLRTIVVEPLELPVEQPTREPEPEPIQSPESVPEQVPAKQ* |
Ga0181530_100132935 | 3300014159 | Bog | AGRVEGSKHMQIGKPLRTIVVEPLELPVEQPTREPEPEPVQSPESEPEQVPAKQ* |
Ga0181530_104491272 | 3300014159 | Bog | GGWSAERESKHMQIGEPLRTTIVEPLELPVKEPTREPEPDPIQSPESEPQRVLVTR* |
Ga0181538_101671582 | 3300014162 | Bog | MMQIGKPLRTIVVEPLELPVEQPTREPEHEPIQSPEPEPEQVPAKQ* |
Ga0181538_106409762 | 3300014162 | Bog | MQIGKPLRTIVVEPLELPVEQPKGEPEPEPIQSPESEPEQVPVTP* |
Ga0181532_100080526 | 3300014164 | Bog | LRTIVVEPLELPVEQPTREPEPEPMHSPESEPKQVPAKQ* |
Ga0182018_100299834 | 3300014489 | Palsa | MMQIGKPLRTIVVEPLDLPVEQPTREPEPEPLHSPESEPEQVPAKQ* |
Ga0182018_101364933 | 3300014489 | Palsa | MMQIGKPLRTIVVEPLELSVEQPTREPEPEPIQSPESEPEQVPAKQ* |
Ga0182018_103382032 | 3300014489 | Palsa | MMQIGKPLRTIVVEPLELPVEQPTGEPEPEPVQSSEPEPQQVPVTP* |
Ga0182014_100459743 | 3300014491 | Bog | MQIGEPLRTIVVEPLELPVKEPRREPEPIQSPEPEPEQVPVAP* |
Ga0182014_100739122 | 3300014491 | Bog | MMQIGKPLRTIVVEPLELPVEQPTREPEPEPVQSPESEPEQVPVTP* |
Ga0182017_106343081 | 3300014494 | Fen | VQIGKSVKTILVEPLELPVAEPESQPEPEPIQSSESE |
Ga0182015_109064122 | 3300014495 | Palsa | MQIGKPLRTIVVEPLELPVEQPTGEPEPEPVQSSEPEPQQVPVTP* |
Ga0182011_105290081 | 3300014496 | Fen | VQIGKSVKTVLVEPLELPVAEPESQPEPEPIQSPESEPEQVPVKP* |
Ga0182019_102068512 | 3300014498 | Fen | MQIGEPLRTIIIEPLELPVKQPEPEPIQSPESEPEEVPVTP* |
Ga0182024_101484314 | 3300014501 | Permafrost | MQIGEPLRTIVVEPLELPVEQPTREPEPEPIQSPESEPEQVPVTP* |
Ga0182024_102153695 | 3300014501 | Permafrost | MQIGDALRTIIVELLELPVDESTANPNPDPIPSPETEPEQVPATR* |
Ga0182024_105939692 | 3300014501 | Permafrost | MQIGKPLRTIVVEPLERPVEQPTREPEPEPIQSPESEPEQVPAKQ* |
Ga0182024_116338252 | 3300014501 | Permafrost | QIGAPLRTIVVEPLELPVQEPVVEPEPETVHVVPESEPEPEQVPVAQ* |
Ga0182024_119053531 | 3300014501 | Permafrost | MMQICEPLRTFIVEPLELPVEQPTGEPEPKPKPIQSPESEPEQV |
Ga0182024_127593612 | 3300014501 | Permafrost | MMQIGKPLRTIVVEPLELPVEQPTREPEPEPVQQPESEPEQVPAKQ* |
Ga0181536_100076811 | 3300014638 | Bog | GSKHMQIGKPLRTIVVEPLELPVEQPTREPEPEPMHSPESEPKQVPAKQ* |
Ga0181536_102669522 | 3300014638 | Bog | MQIGKPLRTIVVEPLELPVEQPTREPEPEPIQSPESEPEQVPAKQ* |
Ga0137409_111361162 | 3300015245 | Vadose Zone Soil | MQIGEPLRTIIVEPLELPVKRPTGETEPEPIQSPESDPQEVPVTP* |
Ga0182041_110287881 | 3300016294 | Soil | MQMGEPLRTIVVEPLELPVNKPAVEPELEPEPLKPESDPERVPASV |
Ga0182034_106771322 | 3300016371 | Soil | GDPQRTIIVEPLELPVKQPTGEPEPVVSQQPDPERVPVAQ |
Ga0181505_108496133 | 3300016750 | Peatland | VEGSKHMQIGKPLRTIVVEPLDLPVEQPTREPEPEPIQSPEQEPQQVPVTQ |
Ga0187818_101471562 | 3300017823 | Freshwater Sediment | MQIGEPLRTVIVEPLELPVKQPTREPEPEPIQSPESEPEQVPAKQ |
Ga0187818_102666872 | 3300017823 | Freshwater Sediment | MMLIGEPLRTIVVEPLELPVVEPKTEPEADPVAQPEPEPEQVPAKS |
Ga0187818_103576641 | 3300017823 | Freshwater Sediment | IGEPLRTIVVEPLELPVEQPTREPEPEPIESPESEPDQVPVTP |
Ga0187818_105029932 | 3300017823 | Freshwater Sediment | LKERVNMQIGEPLRTIVVEPLELPVNDPQTQPEPAPQPESEPEQVPATR |
Ga0187818_105035371 | 3300017823 | Freshwater Sediment | MQIGDPLRTIIVEPLELPVEEPKAEPQPEPMHAPE |
Ga0187856_10021134 | 3300017925 | Peatland | MMQIGKPLRTIVVEPLELPVEQPTREPEPEPIQSPESEPEQVPAEP |
Ga0187856_10051984 | 3300017925 | Peatland | MQIGEPLRTIVVEPLELPVQQPTDEPEPVPVPEPEQVPVAQ |
Ga0187806_13160802 | 3300017928 | Freshwater Sediment | MMLIGEPLRTIVVEPLELPVVEPKTEPEADPVAQPEPEPEQVPAKQ |
Ga0187849_10482101 | 3300017929 | Peatland | MQVGEPLRTIVVEPLEFPVKQPTGEPEPEPIQSPESEPEQVPAAP |
Ga0187849_10825442 | 3300017929 | Peatland | VQIGKSVKTILVEPLELPVAEPESQPEPEPIQSPESEPEQVPVKP |
Ga0187849_11462393 | 3300017929 | Peatland | MQIGEALRTVVVEPLELPVKQSTHEPEPVPVPELEPETEQVLVAR |
Ga0187801_101609701 | 3300017933 | Freshwater Sediment | MQIGKPLRTIVVEPLELPVEQPTREPEPEPVQSPESEPEQVPAKQ |
Ga0187801_103411071 | 3300017933 | Freshwater Sediment | MQIGKPLRTIVVEPLELPVEQPTSEPEPEPMQSPELEPEQVP |
Ga0187803_101412132 | 3300017934 | Freshwater Sediment | MQIGEPLRTIVVEPLELPVEQPTREPEPEPIQSPESEPEQVPAKQ |
Ga0187854_102475882 | 3300017938 | Peatland | MQIGEPLRTVIVEPLEVPVKEPTRGLEPEPIQSPEPEPEQVPAAP |
Ga0187775_101607052 | 3300017939 | Tropical Peatland | MQIGDPSRTIIVEPLELPVKQPMREPEPDPVPETEPEQTLAAQ |
Ga0187850_105380481 | 3300017941 | Peatland | KQHENWGQMMQIGKPLRTIVVEPLELPVEQPTREPEPEPIQSPESEPEQVPAKQ |
Ga0187819_104264362 | 3300017943 | Freshwater Sediment | MQIGEPLRTIVVEPLELPVEQPTREPEPEPIQSPEAEPEQVPAEQ |
Ga0187819_106172422 | 3300017943 | Freshwater Sediment | MRIGEPLRTIVVEPLELPVNQPAGEPEPVPMVSEPEPEQVPVAQ |
Ga0187879_101377782 | 3300017946 | Peatland | MQIGKPLRTIVVEPLDLPVEQPTREPEPEPIQSPEQEPQQVPVTQ |
Ga0187879_104114322 | 3300017946 | Peatland | IVVEPLELPVEQPTREPEPEPIQSPESEPEQVPAEP |
Ga0187847_103484732 | 3300017948 | Peatland | MQIGKPLRTIVVEPLELPVEQPTREPEPEPIQSPESEPEQVPTKP |
Ga0187817_101074182 | 3300017955 | Freshwater Sediment | MQIGKPLRTIVVEPLEVPVEQPTREPQPEPIQSPESEPEQVPVTP |
Ga0187817_103876371 | 3300017955 | Freshwater Sediment | RGIPKGRQQMQIGEPLRTIIVEPLELPVKEPTREPEPEPIQSPESEPQQVPVTP |
Ga0187817_105061052 | 3300017955 | Freshwater Sediment | MQIGEPLRTLVVEPLEIPVKQPAVEPETISVPEPEPEQVPVAS |
Ga0187779_100385072 | 3300017959 | Tropical Peatland | MQIGEPLRTIVVEPLELPVNEPAVEPELEPEPLRPESEPERVPG |
Ga0187779_110655742 | 3300017959 | Tropical Peatland | MQIGEPLRTIVVEPLALPVNEPAVDPELEPEPLKPESEP |
Ga0187778_100254208 | 3300017961 | Tropical Peatland | MQIGEPLRTIVVEPLELPVNEPAVEPELEPEPLRPESEPERVP |
Ga0187778_111236051 | 3300017961 | Tropical Peatland | MQIGEPLRTIVVEPLESPVNDPAVEPELEPEPLEPESEPERVRASV |
Ga0187781_101194882 | 3300017972 | Tropical Peatland | MQIGKPLRTIVVEPLELPVEQPTREPEPEPIQSPESEPEQVPAKQ |
Ga0187781_103248411 | 3300017972 | Tropical Peatland | MGECAMQIGEPLRTIVVEPLELPVNKPAVEPALEPEPSKPESDPERVPASV |
Ga0187781_112825342 | 3300017972 | Tropical Peatland | MQIGEPLRTIVVEPLELPVEQPTREPEPEPIQSPELQPEQVPAKQ |
Ga0187782_101359202 | 3300017975 | Tropical Peatland | MGECAMQIGEPLRTIVVEPLELPVNKPAVEPALEPEPLKPESDPERVPASV |
Ga0187782_106670321 | 3300017975 | Tropical Peatland | RSIGECAMQIGEPLRTIVVEPLELPVNEPAIEPEPEPEPLKPESDPERVPASV |
Ga0187816_102070001 | 3300017995 | Freshwater Sediment | MQIGKPLRTIVVEPLEVPVEQPTREPEPEPIQSPESEPEQVPVTP |
Ga0187816_103364042 | 3300017995 | Freshwater Sediment | MQIGEPLRTIIVEPLELPVKDPTREPEPEPIQSPE |
Ga0187816_104347852 | 3300017995 | Freshwater Sediment | MMQIGKPLRTIVVEPLELPLEQPTREPEPEPIQSPEREPEQVPVTP |
Ga0187870_100378513 | 3300017998 | Peatland | MQIGKPLRTIVVEPLELPVEQPTREPEPEPIQSPESEPEQVPAEP |
Ga0187870_13099351 | 3300017998 | Peatland | TIVVEPLDLPVEQPTREPEPEPIQSPEQEPQQVPVTQ |
Ga0187815_100033829 | 3300018001 | Freshwater Sediment | MLIGEPLRTIVVEPLELPVVEPKTEPEADPVAQPEPEPEQVPAKS |
Ga0187815_101414951 | 3300018001 | Freshwater Sediment | MQIGEPLRTVIVEPLELPVKQPTREPEPEPIQSPE |
Ga0187868_11137252 | 3300018002 | Peatland | MMQIGKPLRTIVVEPLELPVEQPTREPEPEPVQSPESEPEQVPAKQ |
Ga0187876_10316352 | 3300018003 | Peatland | MQIGKPLRTIVVEPLELPVEQPTREPEPEPIQSPEPEPEQLHRCGLCAA |
Ga0187876_10699562 | 3300018003 | Peatland | MQIGKPLRTIVVEPLERPVEQPAREPEPEPMQSPESEPEQVPAKQ |
Ga0187876_10933353 | 3300018003 | Peatland | MHIGKPLRTIVVEPLELPVSEPTREPEPEPIQSPEPE |
Ga0187865_10910804 | 3300018004 | Peatland | MQIGEVLRTIVVEPLELPAKQSTGEPEPVPVPEPE |
Ga0187804_100023231 | 3300018006 | Freshwater Sediment | MQIGKPLRTIVVEPLELPVEQPTCEPEPEPIQSPESEPEQVPTKQ |
Ga0187804_100101766 | 3300018006 | Freshwater Sediment | MKIGKPLRTIVVEPLELPVEQPTCEPEPHRVPSPESEPEQV |
Ga0187804_101820062 | 3300018006 | Freshwater Sediment | MQIGEPLRTIIVEPLELPVKEPTREPEPEPIQSPESEPQQVPVTP |
Ga0187804_105418422 | 3300018006 | Freshwater Sediment | MQIGEPLRAIVVEPLELPVNEPQEGPELEPIAPESDPEGDPATK |
Ga0187810_100217865 | 3300018012 | Freshwater Sediment | MQIGEPLRTIVVEPLELPVNDPQTQPEPEPMQSPESEPEQVPAAR |
Ga0187810_102772593 | 3300018012 | Freshwater Sediment | MQIGKPLRTIVVEPLELPVEQPTREPEPEPIQSPE |
Ga0187860_13761902 | 3300018014 | Peatland | MQIGEPLRTIVVEPLELPVEQPTREPEPEPMHSPESEPKQVPAKQ |
Ga0187880_10028341 | 3300018016 | Peatland | RQRENWGQMMQIGKPLRTIVVEPLELPVEQPTREPEPEPIQSPESEPEQVPAEP |
Ga0187880_10116166 | 3300018016 | Peatland | VVEPLELPVEQPTREPEPEPMHSPESEPKQVPAKQ |
Ga0187874_100166651 | 3300018019 | Peatland | MQIGKPLRTVVEPLELPVEQPTREPEPEPIQSPESEPEQVPAEP |
Ga0187861_100498796 | 3300018020 | Peatland | MQIGKPLRTIVVEPLELPVEQPTREPEPEPIQSPEP |
Ga0187861_101931852 | 3300018020 | Peatland | MMQIGKPLRTIVVEPLELPVEQPTREPEPDPIQSPESEPEQVPVTP |
Ga0187861_102964652 | 3300018020 | Peatland | MQIGKPLRTIIVEPLELPVEQPTREPEPEPVQSPESEPEQVPAKQ |
Ga0187864_103669391 | 3300018022 | Peatland | MQIGDPLRTIVVEPLELPVDQPTREPEPEPIQSPEPEP |
Ga0187867_101097834 | 3300018033 | Peatland | VQIGKSVKTILVEPLELPVAEPESQPEPEPIQSPESELEQVPVKP |
Ga0187883_104317082 | 3300018037 | Peatland | MQIGKPLRTIVVEPLELPVEQPTREPEPEPIQSPESEPERVPAKQ |
Ga0187883_104411832 | 3300018037 | Peatland | MQIGKPLRTIVVEPLELPVEQPTREPEPEPVQQPESEPEQVPVTP |
Ga0187862_100280081 | 3300018040 | Peatland | GSKHMQIGKPLRTIVVEPLELPVEQPTREPEPEPVQSPESEPEQVPAKQ |
Ga0187871_101108361 | 3300018042 | Peatland | LRTIVVEPLDLPVEQPTREPEPEPIQSPEQEPQQVPVTQ |
Ga0187887_101733183 | 3300018043 | Peatland | VHIGKSVKTILVEPLELPVAEPESQPEPEPIQSPESELEQVPVKP |
Ga0187887_103550091 | 3300018043 | Peatland | MQIGEPLRTIVVEPLESPVEQPTREPDPEPIRSPEPE |
Ga0187858_105361182 | 3300018057 | Peatland | MQIGKPLRTIVVEPLELPVEQPTREPEPEPIQSPESEPEQV |
Ga0187765_107454592 | 3300018060 | Tropical Peatland | MQIGRPLRTIIVEPLELPDNKPAVEPEGEPEPLEPNSEPEPVPTRV |
Ga0187772_106030231 | 3300018085 | Tropical Peatland | MQIGEPLRIIVVEPLELPVNEPAVEPEVEPEPRKPASDP |
Ga0187772_106595451 | 3300018085 | Tropical Peatland | MQIGEPLRTIVVEPLELPVNKPAVEPALEPEPLKPESDPERVPASV |
Ga0187770_101211272 | 3300018090 | Tropical Peatland | MQIGEPLRTVIVEPLEVPVQQPTSEPEPVSVPECEPEQVPAAP |
Ga0187770_112097572 | 3300018090 | Tropical Peatland | MQIGKPLRTIVVEPLELPVTQPTDEPEPVPVPEVEAQTEPEQVPVAP |
Ga0182025_12168511 | 3300019786 | Permafrost | MMQIGKPLRTIVVEPLELPVEQPTREPEPEPVQQPESEPEQVPAKQ |
Ga0193751_10164985 | 3300019888 | Soil | MQIGEPLRTIVVEPLELPVKQPTGEPEPVHAPKPEPERVPVAQ |
Ga0210407_104095902 | 3300020579 | Soil | MQIGEALRTIVVEPLELPVKQPPSEPESIHAPEQEPKPEQVPVAL |
Ga0210401_116043141 | 3300020583 | Soil | MQIGESLRTIVVEPLEVPVQQPTSEPEPVSVPECEPEQVPAAP |
Ga0210396_116816152 | 3300021180 | Soil | MQIGEPLRIIVVEPLELPVQQLPEEPEPVPVQEPEPEQVPVAQ |
Ga0210386_102731712 | 3300021406 | Soil | MLIGEPLRTIIVEPLEVPVNQPTREPELVPVPDTEPERTPAAQ |
Ga0210394_103550472 | 3300021420 | Soil | MQIGEALRTIVVEPLELPVKQPPSEPESIRAPEQEPKPEQVPVAL |
Ga0210409_100878911 | 3300021559 | Soil | LRTIIVEPLEVPVNQPTREPELVPVPDTEPERTPAAQ |
Ga0126371_101091313 | 3300021560 | Tropical Forest Soil | MQIGEPLRTIVVEPLELPLNKPVVEPELEPEPLKPESDPERVPASV |
Ga0126371_106718401 | 3300021560 | Tropical Forest Soil | MQIGEPVRTIVVEPLEVPAVQPMREPEPAVVPEAEPEQVPADH |
Ga0126371_130660632 | 3300021560 | Tropical Forest Soil | MQIGDPLRTIVVEPLELPLNKPAVEPELEPEPLKPESDPERVPASV |
Ga0213853_110388341 | 3300021861 | Watersheds | MQIGEPLRTIVVEPLELPVKQPTREPEPEPIQSPESEPEQVPAKQ |
Ga0224548_10413922 | 3300022518 | Soil | VMQIGEPLRTIVVEPLELPVEQPTREPEPEPIQSPE |
Ga0224545_10025882 | 3300022881 | Soil | MQIGEPLRTIVVEPLELPVEQPTREPEPEPIQSPESEPEQVPVTP |
Ga0224558_10061207 | 3300023090 | Soil | MQIGEPLRTIVVEPLELPVKEPRREPEPIQSPEPEPEQVPVAP |
Ga0208038_10777692 | 3300025446 | Peatland | MQIGKPLRTIIVEPLELLVEQPTREPEPEPIQSPEPEP |
Ga0208819_10529391 | 3300025498 | Peatland | MQIGKPLRTIVVEPLELPVEQPTREPEPEPIQSPESEPEQVP |
Ga0208819_10734881 | 3300025498 | Peatland | WGQMMQIGKPLRTIVVEPLELPVEQPTREPEPEPIQSPESEPEQVPAEP |
Ga0208686_10090975 | 3300025500 | Peatland | MMQIGKPLRTIVVEPLELPVEQPTREPEPEPIQSPESEPEQVPAKQ |
Ga0209385_11966932 | 3300025650 | Arctic Peat Soil | MQIGEPLRTIVVEPLELPVQQPAAEPETFPASAQPVPEQEPVAQ |
Ga0207646_101043216 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MQIGESLRTIVVEPLELPVQQPTGEPEPVHVPEGVPEQEPVAQ |
Ga0209881_11128372 | 3300026273 | Soil | MQIGEPLRTIVVEPLEIPVNKPSAEPEPVVEQPEPVPEQVPVAQ |
Ga0179593_10383623 | 3300026555 | Vadose Zone Soil | MQIGEPLRTIVVEPLELPVKPPVDEPEPETIQSPTREPEWMEVAQ |
Ga0207762_10413543 | 3300027063 | Tropical Forest Soil | MQIGEPLRTVIVEPLEVPVKQPAREPEPVVAPQPEPEQVPVAQ |
Ga0209904_10006824 | 3300027394 | Thawing Permafrost | MQIGKPLRTIVEPLELPVEQPTREPEPEPIQSPESEPEQVPAEP |
Ga0208043_10656292 | 3300027570 | Peatlands Soil | MQIGKPLRTIVVEALELPVEQLTREPEPEPIQSPEPEPQQVPAKQ |
Ga0207862_12523261 | 3300027703 | Tropical Forest Soil | YARRRPNMQIGEPLRTVIVEPLEVPVKQPAREPEPVVAPQPEPEQVPVAQ |
Ga0209328_102325381 | 3300027727 | Forest Soil | LIRTIVVEPLELPMKQPTGEPEPVQATEPEPEPVPVAW |
Ga0209448_102005402 | 3300027783 | Bog Forest Soil | MQIGEPLRTIVVEPLELPVKEPTRESEPQPIQSPEPEPEQVPAAP |
Ga0209656_103938111 | 3300027812 | Bog Forest Soil | IGKPLRTIVVEPLELPVEQPPREPEPEPIQSPESESEQVPAKQ |
Ga0209040_100724494 | 3300027824 | Bog Forest Soil | MQIGKPLRTIVVEPLELPVEQPPREPEPEPIQSPESESEQVPAKQ |
Ga0209039_103657771 | 3300027825 | Bog Forest Soil | LGEEQVMQIGKPLRTVVVEPLELPVSEPTADPIPGP |
Ga0209060_1000031192 | 3300027826 | Surface Soil | MEIGEPKRTIVVEPLHLPISQPAPEPEPVVVPEKEPEQVPALP |
Ga0209517_100474532 | 3300027854 | Peatlands Soil | MQIGKPLRTIVVEPLELPVEQPEREPGPKPIQSPESEPEQVPAKQ |
Ga0209517_105165791 | 3300027854 | Peatlands Soil | MQIGKPLRTIVVEPLELPVEQPTSEPEPIQSPESEPEQVPVTP |
Ga0209465_106398382 | 3300027874 | Tropical Forest Soil | IDRGCAMQIGEPLRTIVVEPLELPLNKPVVEPELEPEPLKPESDPERVPASV |
Ga0209698_105119412 | 3300027911 | Watersheds | MYIGESLRNIVVEPLESPVAEPEREPEPTSMPEPEPEQVPVAL |
Ga0137415_102541593 | 3300028536 | Vadose Zone Soil | MQIGEPLRTIVVEPLHLPVKQPAGEPEPVHVPEPEPERVPVAQ |
Ga0265338_106972073 | 3300028800 | Rhizosphere | MQIGKPLRTIVVEPLDLPVEQPTREPEPEPMHSPESEPEQVPAKQ |
Ga0247275_100175113 | 3300029817 | Soil | MQIGKPLRTIVVEPLELPVEQPTREPEPEPMHSPESEPKQVPAKQ |
Ga0246001_10591691 | 3300029889 | Peat | VQIGCEPLKTIVMGPLELPVAEPESQPEPEPIQSPESEPEQVPVK |
Ga0310039_101549582 | 3300030706 | Peatlands Soil | MMQIGKPLRTIVVEPLELPVEQPEREPGPKPIQSPESEPEQVPAKQ |
Ga0310038_101779712 | 3300030707 | Peatlands Soil | MQIGKPLRTIVVEPLELPVEQPTSEPEPEPIQSPESEPEQVPA |
Ga0302318_103402143 | 3300031258 | Bog | MQIGKPLRTIVVEPLDLPVEQPTREPEPEPMHPPESEPEQV |
Ga0302318_106121841 | 3300031258 | Bog | WSGEESKHMQIGKPIRTVVVEPLELPVSEPTREPEPEPIQSPESEPEQVPATA |
Ga0302140_108772362 | 3300031261 | Bog | MQIGKPIRTVVVEPLELPVSEPTREPEPEPIQSPESEPEQVPATA |
Ga0310686_1002536121 | 3300031708 | Soil | MQIGKPLRTIIVEPLELPVEQPTREPEPEPVQRPESEPEQVPAKQ |
Ga0307475_113158962 | 3300031754 | Hardwood Forest Soil | MQIGESLRTIIVEPLEVPVKQPTREPEPDIVPDTEPEQTTAAL |
Ga0307478_100557252 | 3300031823 | Hardwood Forest Soil | MQIGKPLRTIVVEPSEIPVYEPRRAPDNAPIVEPEREPEQEPATK |
Ga0306925_113939542 | 3300031890 | Soil | MQIGEPLRTIVVEPLELPVNKPAVEPELEPEPLKPESDPERVPASV |
Ga0306921_113306754 | 3300031912 | Soil | MRIGEPLRTIIVEPLELPVKQPTREPELVPVPDTEPEQT |
Ga0310911_108733951 | 3300032035 | Soil | MQIGEPLRTIVVEPLELPVNKPAVEPELEPEPEPLKPASDPERVPAGV |
Ga0311301_100715875 | 3300032160 | Peatlands Soil | MQIGKPLRTIIVEPLELPVERPTREPESEPMHSQESEPEQVPAKQ |
Ga0311301_109665281 | 3300032160 | Peatlands Soil | MMQIGKPLRTIVVEPLELPVSEPTREPEPEPMQSPESEPEQVPAKQ |
Ga0311301_123313593 | 3300032160 | Peatlands Soil | MQIGKPLRTIVVEPLELPVEQPKGEPEPGLIQSPESEPEQVPAKQ |
Ga0307471_1026738422 | 3300032180 | Hardwood Forest Soil | MQIGDPVRTIVVEPLELPVNQPTDEPEPVAVPEREPEQVPEAQ |
Ga0307471_1028844601 | 3300032180 | Hardwood Forest Soil | MQISGLLRTIVVEPLELPVNQPTGEPEPGPVPETE |
Ga0306920_1003106621 | 3300032261 | Soil | MQIGEPLRTIIVEPLEFPARQPTGEPEPTLVPEAEPEEAPTAQ |
Ga0306920_1006360542 | 3300032261 | Soil | MQIGEPLRTIVVEPLELPVNQPAVEPELEPEPLKPESDPERVPASV |
Ga0335085_102100572 | 3300032770 | Soil | MQIGKPLRRIVVEPLALPVAEPESQPEPEPIQSPESEPE |
Ga0335082_102789814 | 3300032782 | Soil | VQIGEPIRTIVVEPLELPVMEPQATPEPLPVAQLEAKRETVPAAP |
Ga0335081_105000381 | 3300032892 | Soil | EYAMQIGEPLRTIVVEPLELPVNAPAVEPELEPEPLKPESEPERVPASV |
Ga0370484_0136502_130_261 | 3300034125 | Untreated Peat Soil | MQIGEPLRTIVVEPLELPVEQPAGKLEPVYVPEREPEQVPVAQ |
Ga0370515_0080953_398_538 | 3300034163 | Untreated Peat Soil | MMQIGEPLRTIVVEPLELPVEQPTGEPEPEPIQSPESEPEQVPTKP |
⦗Top⦘ |