Metagenome Family F015699

Basic Information
Family ID	F015699
Family Type	Metagenome
Number of Sequences	252
Average Sequence Length	68 residues
Representative Sequence	FPVAIETAGTWNQMAVELVQEIGRRTTLVTEDSRETVFLFQRLSIALQRGNAVSFLSTFTATD
Number of Associated Samples	42
Number of Associated Scaffolds	252

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Eukaryota
% of genes with valid RBS motifs	4.89 %
% of genes near scaffold ends (potentially truncated)	65.08 %
% of genes from short scaffolds (< 2000 bps)	71.03 %
Associated GOLD sequencing projects	35
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.43

Most Common Taxonomy
Group	Eukaryota (88.095 % of family members)
NCBI Taxonomy ID	2759
Taxonomy	All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Annelida → Digestive System → Unclassified → Unclassified → Marine Gutless Worms (44.048 % of family members)
Environment Ontology (ENVO)	Unclassified (100.000 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Animal → Animal proximal gut (100.000 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 58.24% β-sheet: 0.00% Coil/Unstructured: 41.76%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 252 Family Scaffolds
PF00078	RVT_1	1.19
PF08282	Hydrolase_3	1.19
PF00014	Kunitz_BPTI	0.79
PF07714	PK_Tyr_Ser-Thr	0.79
PF00010	HLH	0.40
PF00621	RhoGEF	0.40
PF12697	Abhydrolase_6	0.40
PF01150	GDA1_CD39	0.40
PF02932	Neur_chan_memb	0.40
PF00001	7tm_1	0.40
PF00630	Filamin	0.40
PF13912	zf-C2H2_6	0.40
PF00028	Cadherin	0.40
PF03407	Nucleotid_trans	0.40
PF00063	Myosin_head	0.40

COG ID	Name	Functional Category	% Frequency in 252 Family Scaffolds
COG0515	Serine/threonine protein kinase	Signal transduction mechanisms [T]	3.17
COG2217	Cation-transporting P-type ATPase	Inorganic ion transport and metabolism [P]	1.19
COG3769	Mannosyl-3-phosphoglycerate phosphatase YedP/MpgP, HAD superfamily	Carbohydrate transport and metabolism [G]	1.19
COG0560	Phosphoserine phosphatase	Amino acid transport and metabolism [E]	1.19
COG0561	Hydroxymethylpyrimidine pyrophosphatase and other HAD family phosphatases	Coenzyme transport and metabolism [H]	1.19
COG1877	Trehalose-6-phosphate phosphatase	Carbohydrate transport and metabolism [G]	1.19
COG5371	Nucleoside diphosphatase, GDA1/CD39 family	Nucleotide transport and metabolism [F]	0.79

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	89.29 %
Unclassified	root	N/A	10.71 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	89.29 %
Unclassified	root	N/A	10.71 %

Name	Rank	Taxonomy	Distribution
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	88.10 %
Unclassified	root	N/A	10.71 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	1.19 %

Name	Rank	Taxonomy	Distribution
Opisthokonta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta	12.70 %
Unclassified	root	N/A	10.71 %
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	1.19 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	10.71 %
Metazoa	kingdom	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa	4.76 %
Bacteroidetes/Chlorobi group	clade	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group	1.19 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	10.71 %
Eumetazoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa	4.76 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	1.19 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	10.71 %
Bilateria	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria	4.37 %
Cytophagia	class	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia	1.19 %
Cnidaria	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria	0.40 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	10.71 %
Protostomia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia	3.57 %
Cytophagales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales	1.19 %
Deuterostomia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia	0.79 %
Hydrozoa	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Hydrozoa	0.40 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	10.71 %
Spiralia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia	2.38 %
Cytophagaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae	1.19 %
Ecdysozoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa	1.19 %
Chordata	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata	0.79 %
Hydroidolina	subclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Hydrozoa → Hydroidolina	0.40 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	10.71 %
Lophotrochozoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa	2.38 %
Candidatus Nephrothrix	genus	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix	1.19 %
Panarthropoda	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda	0.79 %
Anthoathecata	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Hydrozoa → Hydroidolina → Anthoathecata	0.40 %
Nematoda	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda	0.40 %
Cephalochordata	subphylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Cephalochordata	0.40 %
Craniata	subphylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata	0.40 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	10.71 %
Annelida	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida	1.98 %
unclassified Candidatus Nephrothrix	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix	1.19 %
Arthropoda	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda	0.79 %
Chromadorea	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea	0.40 %
Aplanulata	suborder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Hydrozoa → Hydroidolina → Anthoathecata → Aplanulata	0.40 %
Leptocardii	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Cephalochordata → Leptocardii	0.40 %
Vertebrata	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata	0.40 %
Mollusca	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca	0.40 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	10.71 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1.19 %
Polychaeta	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta	1.19 %
Clitellata	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata	0.79 %
Mandibulata	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata	0.79 %
Strongylida	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Strongylida	0.40 %
Hydridae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Hydrozoa → Hydroidolina → Anthoathecata → Aplanulata → Hydridae	0.40 %
Amphioxiformes	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Cephalochordata → Leptocardii → Amphioxiformes	0.40 %
Gnathostomata	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata	0.40 %
Bivalvia	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Bivalvia	0.40 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	10.71 %
Sedentaria	subclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria	1.19 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1.19 %
Pancrustacea	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea	0.79 %
Hirudinea	subclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea	0.79 %
Ancylostomatoidea	superfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Strongylida → Ancylostomatoidea	0.40 %
Autobranchia	subclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Bivalvia → Autobranchia	0.40 %
Hydra	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Hydrozoa → Hydroidolina → Anthoathecata → Aplanulata → Hydridae → Hydra	0.40 %
Teleostomi	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi	0.40 %
Branchiostomidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Cephalochordata → Leptocardii → Amphioxiformes → Branchiostomidae	0.40 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	10.71 %
Scolecida	infraclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida	1.19 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1.19 %
Hexapoda	subphylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda	0.79 %
Rhynchobdellida	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida	0.79 %
Euteleostomi	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi	0.40 %
Hydra vulgaris	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Hydrozoa → Hydroidolina → Anthoathecata → Aplanulata → Hydridae → Hydra → Hydra vulgaris	0.40 %
Ancylostomatidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Strongylida → Ancylostomatoidea → Ancylostomatidae	0.40 %
Branchiostoma	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Cephalochordata → Leptocardii → Amphioxiformes → Branchiostomidae → Branchiostoma	0.40 %
Pteriomorphia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Bivalvia → Autobranchia → Pteriomorphia	0.40 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	10.71 %
Capitellidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida → Capitellidae	1.19 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1.19 %
Insecta	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta	0.79 %
Glossiphoniidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae	0.79 %
Actinopterygii	superclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii	0.40 %
Branchiostoma belcheri	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Cephalochordata → Leptocardii → Amphioxiformes → Branchiostomidae → Branchiostoma → Branchiostoma belcheri	0.40 %
Mytiloida	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Bivalvia → Autobranchia → Pteriomorphia → Mytiloida	0.40 %
Hydra vulgaris	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Hydrozoa → Hydroidolina → Anthoathecata → Aplanulata → Hydridae → Hydra → Hydra vulgaris	0.40 %
Ancylostomatidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Strongylida → Ancylostomatoidea → Ancylostomatidae	0.40 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	10.71 %
Capitella	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida → Capitellidae → Capitella	1.19 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1.19 %
Dicondylia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia	0.79 %
Helobdella	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella	0.79 %
Actinopteri	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri	0.40 %
Mytiloidea	superfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Bivalvia → Autobranchia → Pteriomorphia → Mytiloida → Mytiloidea	0.40 %
Branchiostoma belcheri	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Cephalochordata → Leptocardii → Amphioxiformes → Branchiostomidae → Branchiostoma → Branchiostoma belcheri	0.40 %
Hydra vulgaris	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Hydrozoa → Hydroidolina → Anthoathecata → Aplanulata → Hydridae → Hydra → Hydra vulgaris	0.40 %
Ancylostomatidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Strongylida → Ancylostomatoidea → Ancylostomatidae	0.40 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	10.71 %
Capitella teleta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida → Capitellidae → Capitella → Capitella teleta	1.19 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1.19 %
Pterygota	subclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota	0.79 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	0.79 %
Mytilidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Bivalvia → Autobranchia → Pteriomorphia → Mytiloida → Mytiloidea → Mytilidae	0.40 %
Neopterygii	subclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii	0.40 %
Branchiostoma belcheri	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Cephalochordata → Leptocardii → Amphioxiformes → Branchiostomidae → Branchiostoma → Branchiostoma belcheri	0.40 %
Hydra vulgaris	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Hydrozoa → Hydroidolina → Anthoathecata → Aplanulata → Hydridae → Hydra → Hydra vulgaris	0.40 %
Ancylostomatidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Strongylida → Ancylostomatoidea → Ancylostomatidae	0.40 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	10.71 %
Capitella teleta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida → Capitellidae → Capitella → Capitella teleta	1.19 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1.19 %
Neoptera	infraclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera	0.79 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	0.79 %
Mytilinae	subfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Bivalvia → Autobranchia → Pteriomorphia → Mytiloida → Mytiloidea → Mytilidae → Mytilinae	0.40 %
Teleostei	infraclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei	0.40 %
Branchiostoma belcheri	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Cephalochordata → Leptocardii → Amphioxiformes → Branchiostomidae → Branchiostoma → Branchiostoma belcheri	0.40 %
Hydra vulgaris	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Hydrozoa → Hydroidolina → Anthoathecata → Aplanulata → Hydridae → Hydra → Hydra vulgaris	0.40 %
Ancylostomatidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Strongylida → Ancylostomatoidea → Ancylostomatidae	0.40 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	10.71 %
Capitella teleta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida → Capitellidae → Capitella → Capitella teleta	1.19 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1.19 %
Endopterygota	cohort	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota	0.79 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	0.79 %
Osteoglossocephalai	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei → Osteoglossocephalai	0.40 %
Mytilus	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Bivalvia → Autobranchia → Pteriomorphia → Mytiloida → Mytiloidea → Mytilidae → Mytilinae → Mytilus	0.40 %
Branchiostoma belcheri	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Cephalochordata → Leptocardii → Amphioxiformes → Branchiostomidae → Branchiostoma → Branchiostoma belcheri	0.40 %
Hydra vulgaris	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Hydrozoa → Hydroidolina → Anthoathecata → Aplanulata → Hydridae → Hydra → Hydra vulgaris	0.40 %
Ancylostomatidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Strongylida → Ancylostomatoidea → Ancylostomatidae	0.40 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	10.71 %
Capitella teleta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida → Capitellidae → Capitella → Capitella teleta	1.19 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1.19 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	0.79 %
Clupeocephala	no rank	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei → Osteoglossocephalai → Clupeocephala	0.40 %
Amphiesmenoptera	superorder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Amphiesmenoptera	0.40 %
Coleoptera	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Coleoptera	0.40 %
Mytilus	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Bivalvia → Autobranchia → Pteriomorphia → Mytiloida → Mytiloidea → Mytilidae → Mytilinae → Mytilus	0.40 %
Branchiostoma belcheri	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Cephalochordata → Leptocardii → Amphioxiformes → Branchiostomidae → Branchiostoma → Branchiostoma belcheri	0.40 %
Hydra vulgaris	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Hydrozoa → Hydroidolina → Anthoathecata → Aplanulata → Hydridae → Hydra → Hydra vulgaris	0.40 %
Ancylostomatidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Strongylida → Ancylostomatoidea → Ancylostomatidae	0.40 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	10.71 %
Capitella teleta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida → Capitellidae → Capitella → Capitella teleta	1.19 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1.19 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	0.79 %
Euteleosteomorpha	cohort	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei → Osteoglossocephalai → Clupeocephala → Euteleosteomorpha	0.40 %
Lepidoptera	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Amphiesmenoptera → Lepidoptera	0.40 %
Polyphaga	suborder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Coleoptera → Polyphaga	0.40 %
Mytilus	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Bivalvia → Autobranchia → Pteriomorphia → Mytiloida → Mytiloidea → Mytilidae → Mytilinae → Mytilus	0.40 %
Branchiostoma belcheri	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Cephalochordata → Leptocardii → Amphioxiformes → Branchiostomidae → Branchiostoma → Branchiostoma belcheri	0.40 %
Hydra vulgaris	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Hydrozoa → Hydroidolina → Anthoathecata → Aplanulata → Hydridae → Hydra → Hydra vulgaris	0.40 %
Ancylostomatidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Strongylida → Ancylostomatoidea → Ancylostomatidae	0.40 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	10.71 %
Capitella teleta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida → Capitellidae → Capitella → Capitella teleta	1.19 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1.19 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	0.79 %
Neoteleostei	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei → Osteoglossocephalai → Clupeocephala → Euteleosteomorpha → Neoteleostei	0.40 %
Glossata	suborder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Amphiesmenoptera → Lepidoptera → Glossata	0.40 %
Polyphaga	suborder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Coleoptera → Polyphaga	0.40 %
Mytilus	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Bivalvia → Autobranchia → Pteriomorphia → Mytiloida → Mytiloidea → Mytilidae → Mytilinae → Mytilus	0.40 %
Branchiostoma belcheri	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Cephalochordata → Leptocardii → Amphioxiformes → Branchiostomidae → Branchiostoma → Branchiostoma belcheri	0.40 %
Hydra vulgaris	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Hydrozoa → Hydroidolina → Anthoathecata → Aplanulata → Hydridae → Hydra → Hydra vulgaris	0.40 %
Ancylostomatidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Strongylida → Ancylostomatoidea → Ancylostomatidae	0.40 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	10.71 %
Capitella teleta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida → Capitellidae → Capitella → Capitella teleta	1.19 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1.19 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	0.79 %
Eurypterygia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei → Osteoglossocephalai → Clupeocephala → Euteleosteomorpha → Neoteleostei → Eurypterygia	0.40 %
Neolepidoptera	infraorder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Amphiesmenoptera → Lepidoptera → Glossata → Neolepidoptera	0.40 %
Polyphaga	suborder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Coleoptera → Polyphaga	0.40 %
Mytilus	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Bivalvia → Autobranchia → Pteriomorphia → Mytiloida → Mytiloidea → Mytilidae → Mytilinae → Mytilus	0.40 %
Branchiostoma belcheri	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Cephalochordata → Leptocardii → Amphioxiformes → Branchiostomidae → Branchiostoma → Branchiostoma belcheri	0.40 %
Hydra vulgaris	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Hydrozoa → Hydroidolina → Anthoathecata → Aplanulata → Hydridae → Hydra → Hydra vulgaris	0.40 %
Ancylostomatidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Strongylida → Ancylostomatoidea → Ancylostomatidae	0.40 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	10.71 %
Capitella teleta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida → Capitellidae → Capitella → Capitella teleta	1.19 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1.19 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	0.79 %
Ctenosquamata	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei → Osteoglossocephalai → Clupeocephala → Euteleosteomorpha → Neoteleostei → Eurypterygia → Ctenosquamata	0.40 %
Heteroneura	parvorder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Amphiesmenoptera → Lepidoptera → Glossata → Neolepidoptera → Heteroneura	0.40 %
Polyphaga	suborder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Coleoptera → Polyphaga	0.40 %
Mytilus	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Bivalvia → Autobranchia → Pteriomorphia → Mytiloida → Mytiloidea → Mytilidae → Mytilinae → Mytilus	0.40 %
Branchiostoma belcheri	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Cephalochordata → Leptocardii → Amphioxiformes → Branchiostomidae → Branchiostoma → Branchiostoma belcheri	0.40 %
Hydra vulgaris	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Hydrozoa → Hydroidolina → Anthoathecata → Aplanulata → Hydridae → Hydra → Hydra vulgaris	0.40 %
Ancylostomatidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Strongylida → Ancylostomatoidea → Ancylostomatidae	0.40 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	10.71 %
Capitella teleta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida → Capitellidae → Capitella → Capitella teleta	1.19 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1.19 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	0.79 %
Acanthomorphata	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei → Osteoglossocephalai → Clupeocephala → Euteleosteomorpha → Neoteleostei → Eurypterygia → Ctenosquamata → Acanthomorphata	0.40 %
Ditrysia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Amphiesmenoptera → Lepidoptera → Glossata → Neolepidoptera → Heteroneura → Ditrysia	0.40 %
Polyphaga	suborder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Coleoptera → Polyphaga	0.40 %
Mytilus	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Bivalvia → Autobranchia → Pteriomorphia → Mytiloida → Mytiloidea → Mytilidae → Mytilinae → Mytilus	0.40 %
Branchiostoma belcheri	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Cephalochordata → Leptocardii → Amphioxiformes → Branchiostomidae → Branchiostoma → Branchiostoma belcheri	0.40 %
Hydra vulgaris	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Hydrozoa → Hydroidolina → Anthoathecata → Aplanulata → Hydridae → Hydra → Hydra vulgaris	0.40 %
Ancylostomatidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Strongylida → Ancylostomatoidea → Ancylostomatidae	0.40 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	10.71 %
Capitella teleta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida → Capitellidae → Capitella → Capitella teleta	1.19 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1.19 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	0.79 %
Euacanthomorphacea	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei → Osteoglossocephalai → Clupeocephala → Euteleosteomorpha → Neoteleostei → Eurypterygia → Ctenosquamata → Acanthomorphata → Euacanthomorphacea	0.40 %
Obtectomera	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Amphiesmenoptera → Lepidoptera → Glossata → Neolepidoptera → Heteroneura → Ditrysia → Obtectomera	0.40 %
Polyphaga	suborder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Coleoptera → Polyphaga	0.40 %
Mytilus	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Bivalvia → Autobranchia → Pteriomorphia → Mytiloida → Mytiloidea → Mytilidae → Mytilinae → Mytilus	0.40 %
Branchiostoma belcheri	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Cephalochordata → Leptocardii → Amphioxiformes → Branchiostomidae → Branchiostoma → Branchiostoma belcheri	0.40 %
Hydra vulgaris	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Hydrozoa → Hydroidolina → Anthoathecata → Aplanulata → Hydridae → Hydra → Hydra vulgaris	0.40 %
Ancylostomatidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Strongylida → Ancylostomatoidea → Ancylostomatidae	0.40 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	10.71 %
Capitella teleta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida → Capitellidae → Capitella → Capitella teleta	1.19 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1.19 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	0.79 %
Percomorphaceae	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei → Osteoglossocephalai → Clupeocephala → Euteleosteomorpha → Neoteleostei → Eurypterygia → Ctenosquamata → Acanthomorphata → Euacanthomorphacea → Percomorphaceae	0.40 %
Bombycoidea	superfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Amphiesmenoptera → Lepidoptera → Glossata → Neolepidoptera → Heteroneura → Ditrysia → Obtectomera → Bombycoidea	0.40 %
Polyphaga	suborder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Coleoptera → Polyphaga	0.40 %
Mytilus	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Bivalvia → Autobranchia → Pteriomorphia → Mytiloida → Mytiloidea → Mytilidae → Mytilinae → Mytilus	0.40 %
Branchiostoma belcheri	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Cephalochordata → Leptocardii → Amphioxiformes → Branchiostomidae → Branchiostoma → Branchiostoma belcheri	0.40 %
Hydra vulgaris	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Hydrozoa → Hydroidolina → Anthoathecata → Aplanulata → Hydridae → Hydra → Hydra vulgaris	0.40 %
Ancylostomatidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Strongylida → Ancylostomatoidea → Ancylostomatidae	0.40 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	10.71 %
Capitella teleta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida → Capitellidae → Capitella → Capitella teleta	1.19 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1.19 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	0.79 %
Eupercaria	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei → Osteoglossocephalai → Clupeocephala → Euteleosteomorpha → Neoteleostei → Eurypterygia → Ctenosquamata → Acanthomorphata → Euacanthomorphacea → Percomorphaceae → Eupercaria	0.40 %
Bombycidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Amphiesmenoptera → Lepidoptera → Glossata → Neolepidoptera → Heteroneura → Ditrysia → Obtectomera → Bombycoidea → Bombycidae	0.40 %
Polyphaga	suborder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Coleoptera → Polyphaga	0.40 %
Mytilus	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Bivalvia → Autobranchia → Pteriomorphia → Mytiloida → Mytiloidea → Mytilidae → Mytilinae → Mytilus	0.40 %
Branchiostoma belcheri	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Cephalochordata → Leptocardii → Amphioxiformes → Branchiostomidae → Branchiostoma → Branchiostoma belcheri	0.40 %
Hydra vulgaris	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Hydrozoa → Hydroidolina → Anthoathecata → Aplanulata → Hydridae → Hydra → Hydra vulgaris	0.40 %
Ancylostomatidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Strongylida → Ancylostomatoidea → Ancylostomatidae	0.40 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	10.71 %
Capitella teleta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida → Capitellidae → Capitella → Capitella teleta	1.19 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1.19 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	0.79 %
Bombycinae	subfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Amphiesmenoptera → Lepidoptera → Glossata → Neolepidoptera → Heteroneura → Ditrysia → Obtectomera → Bombycoidea → Bombycidae → Bombycinae	0.40 %
Perciformes	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei → Osteoglossocephalai → Clupeocephala → Euteleosteomorpha → Neoteleostei → Eurypterygia → Ctenosquamata → Acanthomorphata → Euacanthomorphacea → Percomorphaceae → Eupercaria → Perciformes	0.40 %
Polyphaga	suborder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Coleoptera → Polyphaga	0.40 %
Mytilus	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Bivalvia → Autobranchia → Pteriomorphia → Mytiloida → Mytiloidea → Mytilidae → Mytilinae → Mytilus	0.40 %
Branchiostoma belcheri	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Cephalochordata → Leptocardii → Amphioxiformes → Branchiostomidae → Branchiostoma → Branchiostoma belcheri	0.40 %
Hydra vulgaris	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Hydrozoa → Hydroidolina → Anthoathecata → Aplanulata → Hydridae → Hydra → Hydra vulgaris	0.40 %
Ancylostomatidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Strongylida → Ancylostomatoidea → Ancylostomatidae	0.40 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	10.71 %
Capitella teleta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida → Capitellidae → Capitella → Capitella teleta	1.19 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1.19 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	0.79 %
Percoidei	suborder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei → Osteoglossocephalai → Clupeocephala → Euteleosteomorpha → Neoteleostei → Eurypterygia → Ctenosquamata → Acanthomorphata → Euacanthomorphacea → Percomorphaceae → Eupercaria → Perciformes → Percoidei	0.40 %
Bombyx	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Amphiesmenoptera → Lepidoptera → Glossata → Neolepidoptera → Heteroneura → Ditrysia → Obtectomera → Bombycoidea → Bombycidae → Bombycinae → Bombyx	0.40 %
Polyphaga	suborder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Coleoptera → Polyphaga	0.40 %
Mytilus	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Bivalvia → Autobranchia → Pteriomorphia → Mytiloida → Mytiloidea → Mytilidae → Mytilinae → Mytilus	0.40 %
Branchiostoma belcheri	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Cephalochordata → Leptocardii → Amphioxiformes → Branchiostomidae → Branchiostoma → Branchiostoma belcheri	0.40 %
Hydra vulgaris	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Hydrozoa → Hydroidolina → Anthoathecata → Aplanulata → Hydridae → Hydra → Hydra vulgaris	0.40 %
Ancylostomatidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Strongylida → Ancylostomatoidea → Ancylostomatidae	0.40 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	10.71 %
Capitella teleta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida → Capitellidae → Capitella → Capitella teleta	1.19 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1.19 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	0.79 %
Bombyx mori	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Amphiesmenoptera → Lepidoptera → Glossata → Neolepidoptera → Heteroneura → Ditrysia → Obtectomera → Bombycoidea → Bombycidae → Bombycinae → Bombyx → Bombyx mori	0.40 %
Percidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei → Osteoglossocephalai → Clupeocephala → Euteleosteomorpha → Neoteleostei → Eurypterygia → Ctenosquamata → Acanthomorphata → Euacanthomorphacea → Percomorphaceae → Eupercaria → Perciformes → Percoidei → Percidae	0.40 %
Polyphaga	suborder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Coleoptera → Polyphaga	0.40 %
Mytilus	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Bivalvia → Autobranchia → Pteriomorphia → Mytiloida → Mytiloidea → Mytilidae → Mytilinae → Mytilus	0.40 %
Branchiostoma belcheri	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Cephalochordata → Leptocardii → Amphioxiformes → Branchiostomidae → Branchiostoma → Branchiostoma belcheri	0.40 %
Hydra vulgaris	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Hydrozoa → Hydroidolina → Anthoathecata → Aplanulata → Hydridae → Hydra → Hydra vulgaris	0.40 %
Ancylostomatidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Strongylida → Ancylostomatoidea → Ancylostomatidae	0.40 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	10.71 %
Capitella teleta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida → Capitellidae → Capitella → Capitella teleta	1.19 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1.19 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	0.79 %
Etheostomatinae	subfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei → Osteoglossocephalai → Clupeocephala → Euteleosteomorpha → Neoteleostei → Eurypterygia → Ctenosquamata → Acanthomorphata → Euacanthomorphacea → Percomorphaceae → Eupercaria → Perciformes → Percoidei → Percidae → Etheostomatinae	0.40 %
Bombyx mori	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Amphiesmenoptera → Lepidoptera → Glossata → Neolepidoptera → Heteroneura → Ditrysia → Obtectomera → Bombycoidea → Bombycidae → Bombycinae → Bombyx → Bombyx mori	0.40 %
Polyphaga	suborder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Coleoptera → Polyphaga	0.40 %
Mytilus	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Bivalvia → Autobranchia → Pteriomorphia → Mytiloida → Mytiloidea → Mytilidae → Mytilinae → Mytilus	0.40 %
Branchiostoma belcheri	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Cephalochordata → Leptocardii → Amphioxiformes → Branchiostomidae → Branchiostoma → Branchiostoma belcheri	0.40 %
Hydra vulgaris	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Hydrozoa → Hydroidolina → Anthoathecata → Aplanulata → Hydridae → Hydra → Hydra vulgaris	0.40 %
Ancylostomatidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Strongylida → Ancylostomatoidea → Ancylostomatidae	0.40 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	10.71 %
Capitella teleta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida → Capitellidae → Capitella → Capitella teleta	1.19 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1.19 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	0.79 %
Etheostoma	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei → Osteoglossocephalai → Clupeocephala → Euteleosteomorpha → Neoteleostei → Eurypterygia → Ctenosquamata → Acanthomorphata → Euacanthomorphacea → Percomorphaceae → Eupercaria → Perciformes → Percoidei → Percidae → Etheostomatinae → Etheostoma	0.40 %
Bombyx mori	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Amphiesmenoptera → Lepidoptera → Glossata → Neolepidoptera → Heteroneura → Ditrysia → Obtectomera → Bombycoidea → Bombycidae → Bombycinae → Bombyx → Bombyx mori	0.40 %
Polyphaga	suborder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Coleoptera → Polyphaga	0.40 %
Mytilus	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Bivalvia → Autobranchia → Pteriomorphia → Mytiloida → Mytiloidea → Mytilidae → Mytilinae → Mytilus	0.40 %
Branchiostoma belcheri	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Cephalochordata → Leptocardii → Amphioxiformes → Branchiostomidae → Branchiostoma → Branchiostoma belcheri	0.40 %
Hydra vulgaris	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Hydrozoa → Hydroidolina → Anthoathecata → Aplanulata → Hydridae → Hydra → Hydra vulgaris	0.40 %
Ancylostomatidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Strongylida → Ancylostomatoidea → Ancylostomatidae	0.40 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	10.71 %
Capitella teleta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida → Capitellidae → Capitella → Capitella teleta	1.19 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1.19 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	0.79 %
Oligocephalus	subgenus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei → Osteoglossocephalai → Clupeocephala → Euteleosteomorpha → Neoteleostei → Eurypterygia → Ctenosquamata → Acanthomorphata → Euacanthomorphacea → Percomorphaceae → Eupercaria → Perciformes → Percoidei → Percidae → Etheostomatinae → Etheostoma → Oligocephalus	0.40 %
Bombyx mori	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Amphiesmenoptera → Lepidoptera → Glossata → Neolepidoptera → Heteroneura → Ditrysia → Obtectomera → Bombycoidea → Bombycidae → Bombycinae → Bombyx → Bombyx mori	0.40 %
Polyphaga	suborder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Coleoptera → Polyphaga	0.40 %
Mytilus	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Bivalvia → Autobranchia → Pteriomorphia → Mytiloida → Mytiloidea → Mytilidae → Mytilinae → Mytilus	0.40 %
Branchiostoma belcheri	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Cephalochordata → Leptocardii → Amphioxiformes → Branchiostomidae → Branchiostoma → Branchiostoma belcheri	0.40 %
Hydra vulgaris	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Hydrozoa → Hydroidolina → Anthoathecata → Aplanulata → Hydridae → Hydra → Hydra vulgaris	0.40 %
Ancylostomatidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Strongylida → Ancylostomatoidea → Ancylostomatidae	0.40 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	10.71 %
Capitella teleta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida → Capitellidae → Capitella → Capitella teleta	1.19 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1.19 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	0.79 %
Etheostoma spectabile	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei → Osteoglossocephalai → Clupeocephala → Euteleosteomorpha → Neoteleostei → Eurypterygia → Ctenosquamata → Acanthomorphata → Euacanthomorphacea → Percomorphaceae → Eupercaria → Perciformes → Percoidei → Percidae → Etheostomatinae → Etheostoma → Oligocephalus → Etheostoma spectabile	0.40 %
Bombyx mori	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Amphiesmenoptera → Lepidoptera → Glossata → Neolepidoptera → Heteroneura → Ditrysia → Obtectomera → Bombycoidea → Bombycidae → Bombycinae → Bombyx → Bombyx mori	0.40 %
Polyphaga	suborder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Coleoptera → Polyphaga	0.40 %
Mytilus	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Bivalvia → Autobranchia → Pteriomorphia → Mytiloida → Mytiloidea → Mytilidae → Mytilinae → Mytilus	0.40 %
Branchiostoma belcheri	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Cephalochordata → Leptocardii → Amphioxiformes → Branchiostomidae → Branchiostoma → Branchiostoma belcheri	0.40 %
Hydra vulgaris	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Hydrozoa → Hydroidolina → Anthoathecata → Aplanulata → Hydridae → Hydra → Hydra vulgaris	0.40 %
Ancylostomatidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Strongylida → Ancylostomatoidea → Ancylostomatidae	0.40 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300003774\|Ga0049095_10062047	All Organisms → cellular organisms → Eukaryota	980	Open in IMG/M
3300003810\|Ga0056113_1011377	All Organisms → cellular organisms → Eukaryota	969	Open in IMG/M
3300003853\|Ga0049113_10052811	All Organisms → cellular organisms → Eukaryota	1062	Open in IMG/M
3300003853\|Ga0049113_10148405	All Organisms → cellular organisms → Eukaryota	718	Open in IMG/M
3300003985\|Ga0056112_1033774	All Organisms → cellular organisms → Eukaryota	704	Open in IMG/M
3300004630\|Ga0049105_1094989	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	2112	Open in IMG/M
3300004632\|Ga0049107_10002356	All Organisms → cellular organisms → Eukaryota	7693	Open in IMG/M
3300004632\|Ga0049107_10002889	All Organisms → cellular organisms → Eukaryota → Opisthokonta	7289	Open in IMG/M
3300004632\|Ga0049107_10013175	All Organisms → cellular organisms → Eukaryota → Opisthokonta	4624	Open in IMG/M
3300004632\|Ga0049107_10032130	All Organisms → cellular organisms → Eukaryota	3393	Open in IMG/M
3300004632\|Ga0049107_10034202	All Organisms → cellular organisms → Eukaryota → Opisthokonta	3310	Open in IMG/M
3300004632\|Ga0049107_10034566	All Organisms → cellular organisms → Eukaryota	3296	Open in IMG/M
3300004632\|Ga0049107_10035523	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida → Capitellidae → Capitella → Capitella teleta	3262	Open in IMG/M
3300004632\|Ga0049107_10036402	All Organisms → cellular organisms → Eukaryota	3232	Open in IMG/M
3300004632\|Ga0049107_10048768	All Organisms → cellular organisms → Eukaryota → Opisthokonta	2868	Open in IMG/M
3300004632\|Ga0049107_10054211	All Organisms → cellular organisms → Eukaryota	2743	Open in IMG/M
3300004632\|Ga0049107_10057688	All Organisms → cellular organisms → Eukaryota	2669	Open in IMG/M
3300004632\|Ga0049107_10067238	All Organisms → cellular organisms → Eukaryota	2491	Open in IMG/M
3300004632\|Ga0049107_10068862	All Organisms → cellular organisms → Eukaryota → Opisthokonta	2465	Open in IMG/M
3300004632\|Ga0049107_10070868	All Organisms → cellular organisms → Eukaryota	2432	Open in IMG/M
3300004632\|Ga0049107_10076366	All Organisms → cellular organisms → Eukaryota	2350	Open in IMG/M
3300004632\|Ga0049107_10091870	All Organisms → cellular organisms → Eukaryota	2145	Open in IMG/M
3300004632\|Ga0049107_10105802	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Bivalvia → Autobranchia → Pteriomorphia → Mytiloida → Mytiloidea → Mytilidae → Mytilinae → Mytilus	1996	Open in IMG/M
3300004632\|Ga0049107_10116853	All Organisms → cellular organisms → Eukaryota	1892	Open in IMG/M
3300004632\|Ga0049107_10121744	All Organisms → cellular organisms → Eukaryota	1849	Open in IMG/M
3300004632\|Ga0049107_10121825	All Organisms → cellular organisms → Eukaryota	1848	Open in IMG/M
3300004632\|Ga0049107_10125135	All Organisms → cellular organisms → Eukaryota	1821	Open in IMG/M
3300004632\|Ga0049107_10131358	All Organisms → cellular organisms → Eukaryota	1771	Open in IMG/M
3300004632\|Ga0049107_10139825	All Organisms → cellular organisms → Eukaryota	1709	Open in IMG/M
3300004632\|Ga0049107_10139981	All Organisms → cellular organisms → Eukaryota	1708	Open in IMG/M
3300004632\|Ga0049107_10140906	All Organisms → cellular organisms → Eukaryota	1702	Open in IMG/M
3300004632\|Ga0049107_10149335	All Organisms → cellular organisms → Eukaryota	1644	Open in IMG/M
3300004632\|Ga0049107_10155865	All Organisms → cellular organisms → Eukaryota	1603	Open in IMG/M
3300004632\|Ga0049107_10164286	All Organisms → cellular organisms → Eukaryota	1553	Open in IMG/M
3300004632\|Ga0049107_10200426	All Organisms → cellular organisms → Eukaryota	1365	Open in IMG/M
3300004632\|Ga0049107_10225333	All Organisms → cellular organisms → Eukaryota	1257	Open in IMG/M
3300004632\|Ga0049107_10231721	All Organisms → cellular organisms → Eukaryota	1232	Open in IMG/M
3300004632\|Ga0049107_10239673	All Organisms → cellular organisms → Eukaryota	1202	Open in IMG/M
3300004632\|Ga0049107_10253568	All Organisms → cellular organisms → Eukaryota	1152	Open in IMG/M
3300004632\|Ga0049107_10270983	All Organisms → cellular organisms → Eukaryota	1094	Open in IMG/M
3300004632\|Ga0049107_10279042	All Organisms → cellular organisms → Eukaryota	1070	Open in IMG/M
3300004632\|Ga0049107_10282294	All Organisms → cellular organisms → Eukaryota	1060	Open in IMG/M
3300004632\|Ga0049107_10287066	All Organisms → cellular organisms → Eukaryota	1046	Open in IMG/M
3300004632\|Ga0049107_10299839	All Organisms → cellular organisms → Eukaryota	1010	Open in IMG/M
3300004632\|Ga0049107_10318022	All Organisms → cellular organisms → Eukaryota	962	Open in IMG/M
3300004632\|Ga0049107_10319834	All Organisms → cellular organisms → Eukaryota	957	Open in IMG/M
3300004632\|Ga0049107_10320506	All Organisms → cellular organisms → Eukaryota	955	Open in IMG/M
3300004632\|Ga0049107_10340176	All Organisms → cellular organisms → Eukaryota	908	Open in IMG/M
3300004632\|Ga0049107_10340254	All Organisms → cellular organisms → Eukaryota	908	Open in IMG/M
3300004632\|Ga0049107_10351004	All Organisms → cellular organisms → Eukaryota	884	Open in IMG/M
3300004632\|Ga0049107_10355561	All Organisms → cellular organisms → Eukaryota	874	Open in IMG/M
3300004632\|Ga0049107_10370227	All Organisms → cellular organisms → Eukaryota → Opisthokonta	843	Open in IMG/M
3300004632\|Ga0049107_10379300	All Organisms → cellular organisms → Eukaryota	825	Open in IMG/M
3300004632\|Ga0049107_10381010	All Organisms → cellular organisms → Eukaryota	821	Open in IMG/M
3300004632\|Ga0049107_10391689	All Organisms → cellular organisms → Eukaryota	801	Open in IMG/M
3300004632\|Ga0049107_10407335	All Organisms → cellular organisms → Eukaryota	773	Open in IMG/M
3300004632\|Ga0049107_10407449	All Organisms → cellular organisms → Eukaryota	773	Open in IMG/M
3300004632\|Ga0049107_10429969	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Cephalochordata → Leptocardii → Amphioxiformes → Branchiostomidae → Branchiostoma → Branchiostoma belcheri	736	Open in IMG/M
3300004632\|Ga0049107_10449883	All Organisms → cellular organisms → Eukaryota	705	Open in IMG/M
3300004632\|Ga0049107_10469237	All Organisms → cellular organisms → Eukaryota	677	Open in IMG/M
3300004632\|Ga0049107_10478072	All Organisms → cellular organisms → Eukaryota	665	Open in IMG/M
3300004632\|Ga0049107_10517215	All Organisms → cellular organisms → Eukaryota	617	Open in IMG/M
3300004632\|Ga0049107_10523031	All Organisms → cellular organisms → Eukaryota	610	Open in IMG/M
3300004632\|Ga0049107_10524660	All Organisms → cellular organisms → Eukaryota	608	Open in IMG/M
3300004632\|Ga0049107_10587802	All Organisms → cellular organisms → Eukaryota	546	Open in IMG/M
3300004632\|Ga0049107_10600348	All Organisms → cellular organisms → Eukaryota	536	Open in IMG/M
3300004632\|Ga0049107_10641503	All Organisms → cellular organisms → Eukaryota	504	Open in IMG/M
3300005170\|Ga0071327_1187660	All Organisms → cellular organisms → Eukaryota	1155	Open in IMG/M
3300005649\|Ga0056116_1023537	All Organisms → cellular organisms → Eukaryota → Opisthokonta	3705	Open in IMG/M
3300005649\|Ga0056116_1106600	All Organisms → cellular organisms → Eukaryota	1628	Open in IMG/M
3300005652\|Ga0056135_10042450	All Organisms → cellular organisms → Eukaryota	2388	Open in IMG/M
3300005653\|Ga0056133_10035338	All Organisms → cellular organisms → Eukaryota	2785	Open in IMG/M
3300005653\|Ga0056133_10062006	All Organisms → cellular organisms → Eukaryota	2204	Open in IMG/M
3300005871\|Ga0056124_1047748	All Organisms → cellular organisms → Eukaryota → Opisthokonta	2365	Open in IMG/M
3300005970\|Ga0056134_10275473	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	746	Open in IMG/M
3300008212\|Ga0056121_1003261	All Organisms → cellular organisms → Eukaryota	1633	Open in IMG/M
3300008212\|Ga0056121_1048382	All Organisms → cellular organisms → Eukaryota	751	Open in IMG/M
3300008215\|Ga0056108_1266650	All Organisms → cellular organisms → Eukaryota	1005	Open in IMG/M
3300010290\|Ga0126333_1031995	All Organisms → cellular organisms → Eukaryota	2528	Open in IMG/M
3300010290\|Ga0126333_1059092	All Organisms → cellular organisms → Eukaryota	1936	Open in IMG/M
3300010290\|Ga0126333_1086583	All Organisms → cellular organisms → Eukaryota	1589	Open in IMG/M
3300010290\|Ga0126333_1120111	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1309	Open in IMG/M
3300010290\|Ga0126333_1231920	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	798	Open in IMG/M
3300010290\|Ga0126333_1235494	All Organisms → cellular organisms → Eukaryota	787	Open in IMG/M
3300010292\|Ga0126326_1012561	All Organisms → cellular organisms → Eukaryota	3385	Open in IMG/M
3300010292\|Ga0126326_1093766	All Organisms → cellular organisms → Eukaryota	1493	Open in IMG/M
3300010292\|Ga0126326_1114302	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Coleoptera → Polyphaga	1335	Open in IMG/M
3300010292\|Ga0126326_1167454	All Organisms → cellular organisms → Eukaryota	1048	Open in IMG/M
3300010292\|Ga0126326_1188313	All Organisms → cellular organisms → Eukaryota	965	Open in IMG/M
3300010292\|Ga0126326_1205486	All Organisms → cellular organisms → Eukaryota	905	Open in IMG/M
3300010292\|Ga0126326_1217246	All Organisms → cellular organisms → Eukaryota	867	Open in IMG/M
3300010292\|Ga0126326_1242603	All Organisms → cellular organisms → Eukaryota	793	Open in IMG/M
3300010292\|Ga0126326_1273746	All Organisms → cellular organisms → Eukaryota	715	Open in IMG/M
3300010292\|Ga0126326_1285565	All Organisms → cellular organisms → Eukaryota	690	Open in IMG/M
3300010292\|Ga0126326_1289749	All Organisms → cellular organisms → Eukaryota	681	Open in IMG/M
3300010292\|Ga0126326_1367574	All Organisms → cellular organisms → Eukaryota	547	Open in IMG/M
3300010292\|Ga0126326_1378160	All Organisms → cellular organisms → Eukaryota	533	Open in IMG/M
3300010294\|Ga0126332_10058389	All Organisms → cellular organisms → Eukaryota	2227	Open in IMG/M
3300010294\|Ga0126332_10094817	All Organisms → cellular organisms → Eukaryota	1707	Open in IMG/M
3300010294\|Ga0126332_10122079	All Organisms → cellular organisms → Eukaryota	1454	Open in IMG/M
3300010294\|Ga0126332_10180741	All Organisms → cellular organisms → Eukaryota	1092	Open in IMG/M
3300010294\|Ga0126332_10182379	All Organisms → cellular organisms → Eukaryota	1084	Open in IMG/M
3300010294\|Ga0126332_10240882	All Organisms → cellular organisms → Eukaryota	856	Open in IMG/M
3300010294\|Ga0126332_10255058	All Organisms → cellular organisms → Eukaryota	813	Open in IMG/M
3300010294\|Ga0126332_10289041	All Organisms → cellular organisms → Eukaryota	722	Open in IMG/M
3300010294\|Ga0126332_10318527	All Organisms → cellular organisms → Eukaryota	657	Open in IMG/M
3300010294\|Ga0126332_10375086	All Organisms → cellular organisms → Eukaryota	561	Open in IMG/M
3300010294\|Ga0126332_10411443	All Organisms → cellular organisms → Eukaryota	514	Open in IMG/M
3300010295\|Ga0126334_10007948	All Organisms → cellular organisms → Eukaryota	4501	Open in IMG/M
3300010295\|Ga0126334_10072190	All Organisms → cellular organisms → Eukaryota	1901	Open in IMG/M
3300010295\|Ga0126334_10109398	All Organisms → cellular organisms → Eukaryota	1509	Open in IMG/M
3300010295\|Ga0126334_10139072	All Organisms → cellular organisms → Eukaryota	1297	Open in IMG/M
3300010295\|Ga0126334_10176486	All Organisms → cellular organisms → Eukaryota	1097	Open in IMG/M
3300010295\|Ga0126334_10202268	All Organisms → cellular organisms → Eukaryota	987	Open in IMG/M
3300010295\|Ga0126334_10226258	All Organisms → cellular organisms → Eukaryota	901	Open in IMG/M
3300010295\|Ga0126334_10235736	All Organisms → cellular organisms → Eukaryota	871	Open in IMG/M
3300010295\|Ga0126334_10372503	All Organisms → cellular organisms → Eukaryota	579	Open in IMG/M
3300010295\|Ga0126334_10378432	All Organisms → cellular organisms → Eukaryota	571	Open in IMG/M
3300010295\|Ga0126334_10407105	All Organisms → cellular organisms → Eukaryota	535	Open in IMG/M
3300010295\|Ga0126334_10419935	All Organisms → cellular organisms → Eukaryota	520	Open in IMG/M
3300010298\|Ga0126325_10008252	All Organisms → cellular organisms → Eukaryota	4259	Open in IMG/M
3300010298\|Ga0126325_10027640	All Organisms → cellular organisms → Eukaryota	2807	Open in IMG/M
3300010298\|Ga0126325_10038669	All Organisms → cellular organisms → Eukaryota	2457	Open in IMG/M
3300010298\|Ga0126325_10065508	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1940	Open in IMG/M
3300010298\|Ga0126325_10092479	All Organisms → cellular organisms → Eukaryota	1630	Open in IMG/M
3300010298\|Ga0126325_10096358	All Organisms → cellular organisms → Eukaryota	1594	Open in IMG/M
3300010298\|Ga0126325_10109733	All Organisms → cellular organisms → Eukaryota	1483	Open in IMG/M
3300010298\|Ga0126325_10112302	All Organisms → cellular organisms → Eukaryota	1464	Open in IMG/M
3300010298\|Ga0126325_10127008	All Organisms → cellular organisms → Eukaryota	1363	Open in IMG/M
3300010298\|Ga0126325_10139532	All Organisms → cellular organisms → Eukaryota	1286	Open in IMG/M
3300010298\|Ga0126325_10164883	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1156	Open in IMG/M
3300010298\|Ga0126325_10254787	All Organisms → cellular organisms → Eukaryota	845	Open in IMG/M
3300010298\|Ga0126325_10289371	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Amphiesmenoptera → Lepidoptera → Glossata → Neolepidoptera → Heteroneura → Ditrysia → Obtectomera → Bombycoidea → Bombycidae → Bombycinae → Bombyx → Bombyx mori	764	Open in IMG/M
3300010298\|Ga0126325_10326134	All Organisms → cellular organisms → Eukaryota	692	Open in IMG/M
3300010298\|Ga0126325_10328781	All Organisms → cellular organisms → Eukaryota	688	Open in IMG/M
3300010298\|Ga0126325_10350313	All Organisms → cellular organisms → Eukaryota	653	Open in IMG/M
3300010298\|Ga0126325_10371510	All Organisms → cellular organisms → Eukaryota	622	Open in IMG/M
3300010298\|Ga0126325_10390717	All Organisms → cellular organisms → Eukaryota → Opisthokonta	596	Open in IMG/M
3300010298\|Ga0126325_10392012	All Organisms → cellular organisms → Eukaryota	595	Open in IMG/M
3300010298\|Ga0126325_10395587	All Organisms → cellular organisms → Eukaryota	590	Open in IMG/M
3300010298\|Ga0126325_10419844	All Organisms → cellular organisms → Eukaryota	562	Open in IMG/M
3300010298\|Ga0126325_10449578	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	531	Open in IMG/M
3300010314\|Ga0126331_1003199	All Organisms → cellular organisms → Eukaryota	5783	Open in IMG/M
3300010314\|Ga0126331_1020198	All Organisms → cellular organisms → Eukaryota	3206	Open in IMG/M
3300010314\|Ga0126331_1022195	All Organisms → cellular organisms → Eukaryota	3097	Open in IMG/M
3300010314\|Ga0126331_1030447	All Organisms → cellular organisms → Eukaryota	2729	Open in IMG/M
3300010314\|Ga0126331_1346131	All Organisms → cellular organisms → Eukaryota	540	Open in IMG/M
3300010314\|Ga0126331_1359319	All Organisms → cellular organisms → Eukaryota	519	Open in IMG/M
3300010315\|Ga0136654_1045376	All Organisms → cellular organisms → Eukaryota	2298	Open in IMG/M
3300010315\|Ga0136654_1057658	All Organisms → cellular organisms → Eukaryota → Opisthokonta	2055	Open in IMG/M
3300010315\|Ga0136654_1059785	All Organisms → cellular organisms → Eukaryota	2018	Open in IMG/M
3300010315\|Ga0136654_1075193	All Organisms → cellular organisms → Eukaryota	1794	Open in IMG/M
3300010315\|Ga0136654_1211162	All Organisms → cellular organisms → Eukaryota	901	Open in IMG/M
3300010315\|Ga0136654_1237676	All Organisms → cellular organisms → Eukaryota	813	Open in IMG/M
3300010315\|Ga0136654_1257034	All Organisms → cellular organisms → Eukaryota	756	Open in IMG/M
3300010315\|Ga0136654_1281160	All Organisms → cellular organisms → Eukaryota	694	Open in IMG/M
3300010377\|Ga0126328_10024295	All Organisms → cellular organisms → Eukaryota	3005	Open in IMG/M
3300010377\|Ga0126328_10075931	All Organisms → cellular organisms → Eukaryota	1828	Open in IMG/M
3300010377\|Ga0126328_10082874	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1745	Open in IMG/M
3300010377\|Ga0126328_10101498	All Organisms → cellular organisms → Eukaryota	1556	Open in IMG/M
3300010377\|Ga0126328_10127224	All Organisms → cellular organisms → Eukaryota	1356	Open in IMG/M
3300010377\|Ga0126328_10178647	All Organisms → cellular organisms → Eukaryota	1071	Open in IMG/M
3300010377\|Ga0126328_10218682	All Organisms → cellular organisms → Eukaryota	913	Open in IMG/M
3300010377\|Ga0126328_10338173	All Organisms → cellular organisms → Eukaryota	618	Open in IMG/M
3300010377\|Ga0126328_10415258	All Organisms → cellular organisms → Eukaryota	510	Open in IMG/M
3300010378\|Ga0126330_10006302	All Organisms → cellular organisms → Eukaryota	4710	Open in IMG/M
3300010378\|Ga0126330_10011970	All Organisms → cellular organisms → Eukaryota	3860	Open in IMG/M
3300010378\|Ga0126330_10093497	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Hydrozoa → Hydroidolina → Anthoathecata → Aplanulata → Hydridae → Hydra → Hydra vulgaris	1632	Open in IMG/M
3300010378\|Ga0126330_10142397	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida → Capitellidae → Capitella → Capitella teleta	1257	Open in IMG/M
3300010378\|Ga0126330_10312040	All Organisms → cellular organisms → Eukaryota	669	Open in IMG/M
3300010378\|Ga0126330_10315356	All Organisms → cellular organisms → Eukaryota	663	Open in IMG/M
3300010378\|Ga0126330_10422163	All Organisms → cellular organisms → Eukaryota → Opisthokonta	507	Open in IMG/M
3300011190\|Ga0126327_10161716	All Organisms → cellular organisms → Eukaryota	1111	Open in IMG/M
3300011190\|Ga0126327_10279771	All Organisms → cellular organisms → Eukaryota	729	Open in IMG/M
3300011190\|Ga0126327_10379350	All Organisms → cellular organisms → Eukaryota	555	Open in IMG/M
3300011190\|Ga0126327_10415560	All Organisms → cellular organisms → Eukaryota	511	Open in IMG/M
3300012273\|Ga0126329_10130986	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1324	Open in IMG/M
3300012273\|Ga0126329_10152984	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida → Capitellidae → Capitella → Capitella teleta	1199	Open in IMG/M
3300012273\|Ga0126329_10200280	All Organisms → cellular organisms → Eukaryota → Opisthokonta	993	Open in IMG/M
3300012273\|Ga0126329_10250510	All Organisms → cellular organisms → Eukaryota	836	Open in IMG/M
3300012273\|Ga0126329_10269098	All Organisms → cellular organisms → Eukaryota	788	Open in IMG/M
3300012273\|Ga0126329_10274573	All Organisms → cellular organisms → Eukaryota	775	Open in IMG/M
3300012273\|Ga0126329_10322503	All Organisms → cellular organisms → Eukaryota	676	Open in IMG/M
3300012273\|Ga0126329_10437487	All Organisms → cellular organisms → Eukaryota	519	Open in IMG/M
3300012887\|Ga0126335_1012863	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei → Osteoglossocephalai → Clupeocephala → Euteleosteomorpha → Neoteleostei → Eurypterygia → Ctenosquamata → Acanthomorphata → Euacanthomorphacea → Percomorphaceae → Eupercaria → Perciformes → Percoidei → Percidae → Etheostomatinae → Etheostoma → Oligocephalus → Etheostoma spectabile	5627	Open in IMG/M
3300012887\|Ga0126335_1030655	All Organisms → cellular organisms → Eukaryota	3428	Open in IMG/M
3300027377\|Ga0209363_1006077	All Organisms → cellular organisms → Eukaryota	7323	Open in IMG/M
3300027382\|Ga0209783_1012201	All Organisms → cellular organisms → Eukaryota → Opisthokonta	3314	Open in IMG/M
3300027550\|Ga0209255_1191916	All Organisms → cellular organisms → Eukaryota	1040	Open in IMG/M
3300027557\|Ga0209679_1009262	All Organisms → cellular organisms → Eukaryota → Opisthokonta	6049	Open in IMG/M
3300027557\|Ga0209679_1193166	All Organisms → cellular organisms → Eukaryota	1060	Open in IMG/M
3300027599\|Ga0209786_1003436	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	4176	Open in IMG/M
3300027599\|Ga0209786_1021333	All Organisms → cellular organisms → Eukaryota	2292	Open in IMG/M
3300027599\|Ga0209786_1034090	All Organisms → cellular organisms → Eukaryota	1946	Open in IMG/M
3300027599\|Ga0209786_1052365	All Organisms → cellular organisms → Eukaryota	1661	Open in IMG/M
3300027599\|Ga0209786_1068323	All Organisms → cellular organisms → Eukaryota	1490	Open in IMG/M
3300027599\|Ga0209786_1128386	All Organisms → cellular organisms → Eukaryota	1120	Open in IMG/M
3300027599\|Ga0209786_1130561	All Organisms → cellular organisms → Eukaryota	1110	Open in IMG/M
3300027599\|Ga0209786_1132500	All Organisms → cellular organisms → Eukaryota	1102	Open in IMG/M
3300027599\|Ga0209786_1152589	All Organisms → cellular organisms → Eukaryota	1026	Open in IMG/M
3300027599\|Ga0209786_1170904	All Organisms → cellular organisms → Eukaryota	966	Open in IMG/M
3300027599\|Ga0209786_1189611	All Organisms → cellular organisms → Eukaryota	913	Open in IMG/M
3300027599\|Ga0209786_1194583	All Organisms → cellular organisms → Eukaryota	900	Open in IMG/M
3300027599\|Ga0209786_1319780	All Organisms → cellular organisms → Eukaryota	649	Open in IMG/M
3300027599\|Ga0209786_1394245	All Organisms → cellular organisms → Eukaryota	550	Open in IMG/M
3300027599\|Ga0209786_1395865	All Organisms → cellular organisms → Eukaryota	548	Open in IMG/M
3300027599\|Ga0209786_1402414	All Organisms → cellular organisms → Eukaryota	541	Open in IMG/M
3300027599\|Ga0209786_1403398	All Organisms → cellular organisms → Eukaryota	540	Open in IMG/M
3300027602\|Ga0209781_1081225	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1985	Open in IMG/M
3300027615\|Ga0209678_1054683	All Organisms → cellular organisms → Eukaryota	1776	Open in IMG/M
3300027615\|Ga0209678_1075232	All Organisms → cellular organisms → Eukaryota	1555	Open in IMG/M
3300027615\|Ga0209678_1083022	All Organisms → cellular organisms → Eukaryota	1488	Open in IMG/M
3300027615\|Ga0209678_1103285	All Organisms → cellular organisms → Eukaryota	1344	Open in IMG/M
3300027615\|Ga0209678_1135704	All Organisms → cellular organisms → Eukaryota	1175	Open in IMG/M
3300027615\|Ga0209678_1149947	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Strongylida → Ancylostomatoidea → Ancylostomatidae	1115	Open in IMG/M
3300027615\|Ga0209678_1161003	All Organisms → cellular organisms → Eukaryota	1072	Open in IMG/M
3300027615\|Ga0209678_1192897	All Organisms → cellular organisms → Eukaryota	969	Open in IMG/M
3300027615\|Ga0209678_1195058	All Organisms → cellular organisms → Eukaryota	962	Open in IMG/M
3300027615\|Ga0209678_1264543	All Organisms → cellular organisms → Eukaryota	793	Open in IMG/M
3300027615\|Ga0209678_1301605	All Organisms → cellular organisms → Eukaryota	722	Open in IMG/M
3300027615\|Ga0209678_1344638	All Organisms → cellular organisms → Eukaryota	652	Open in IMG/M
3300027615\|Ga0209678_1426626	All Organisms → cellular organisms → Eukaryota	542	Open in IMG/M
3300027620\|Ga0209260_10134217	All Organisms → cellular organisms → Eukaryota	756	Open in IMG/M
3300027658\|Ga0209259_1240035	All Organisms → cellular organisms → Eukaryota	963	Open in IMG/M
3300027661\|Ga0209459_10243820	All Organisms → cellular organisms → Eukaryota	890	Open in IMG/M

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.43
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.43
Powered by PDBe Molstar

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Annelida → Digestive System → Unclassified	78.57%
Digestive Tube	Host-Associated → Annelida → Digestive System → Digestive Tube	21.43%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Annelida → Digestive System → Unclassified → Unclassified	78.57%
Extracellular Symbionts	Host-Associated → Annelida → Digestive System → Digestive Tube → Extracellular Symbionts	21.43%

Habitat	Taxonomy	Distribution
Marine Gutless Worms	Host-Associated → Annelida → Digestive System → Unclassified → Unclassified → Marine Gutless Worms	44.05%
Marine Gutless Worms Symbiont	Host-Associated → Annelida → Digestive System → Unclassified → Unclassified → Marine Gutless Worms Symbiont	34.52%
Marine Gutless Worms Symbiont	Host-Associated → Annelida → Digestive System → Digestive Tube → Extracellular Symbionts → Marine Gutless Worms Symbiont	21.43%

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F015699

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300003774	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Inanidrilus exumae BAHAMAS.3	Host-Associated	Open in IMG/M
3300003810	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius ilvae ELBA.2	Host-Associated	Open in IMG/M
3300003853	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius tantulus BELIZE.1	Host-Associated	Open in IMG/M
3300003904	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius albidus HERON ISLAND.2	Host-Associated	Open in IMG/M
3300003906	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius vacuus BAHAMAS.2	Host-Associated	Open in IMG/M
3300003985	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius ilvae ELBA.1	Host-Associated	Open in IMG/M
3300004630	Worm MetaG Olavius vacuus BAHAMAS.1	Host-Associated	Open in IMG/M
3300004632	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius ilvae PIANOSA.1	Host-Associated	Open in IMG/M
3300005170	Worm MetaG Olavius vacuus BAHAMAS.1 (version 1)	Host-Associated	Open in IMG/M
3300005649	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius sp. DAHAB.2	Host-Associated	Open in IMG/M
3300005652	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Inanidrilus leukodermatus Group 1a BELIZE.1	Host-Associated	Open in IMG/M
3300005653	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Inanidrilus leukodermatus Group 2 BELIZE.1	Host-Associated	Open in IMG/M
3300005871	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius sp. 4 HERON ISLAND	Host-Associated	Open in IMG/M
3300005968	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius loisae LIZARD ISLAND.2	Host-Associated	Open in IMG/M
3300005970	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Inanidrilus leukodermatus Group 2 BELIZE.2	Host-Associated	Open in IMG/M
3300005978	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius loisae LIZARD ISLAND.1	Host-Associated	Open in IMG/M
3300006000	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius sp. 3 HERON ISLAND	Host-Associated	Open in IMG/M
3300006912	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius loisae HERON ISLAND.1	Host-Associated	Open in IMG/M
3300008212	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius sp. 1 HERON ISLAND	Host-Associated	Open in IMG/M
3300008215	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Inanidrilus leukodermatus Group 1 BERMUDA.1	Host-Associated	Open in IMG/M
3300010290	Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 2 OAHU.JWI-54 metaG	Host-Associated	Open in IMG/M
3300010292	Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 1 OAHU.JWI-67 metaG	Host-Associated	Open in IMG/M
3300010294	Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 2 OAHU.JWI-42 metaG	Host-Associated	Open in IMG/M
3300010295	Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 2 OAHU.JWI-49 metaG	Host-Associated	Open in IMG/M
3300010298	Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 1 OAHU.JWI-14 metaG	Host-Associated	Open in IMG/M
3300010314	Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 2 OAHU.JWI-98 metaG	Host-Associated	Open in IMG/M
3300010315	Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 1 OAHU.JWI-70 metaG	Host-Associated	Open in IMG/M
3300010377	Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 1 OAHU.JWI-13 metaG	Host-Associated	Open in IMG/M
3300010378	Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 2 OAHU.JWI-91 metaG	Host-Associated	Open in IMG/M
3300011190	Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 1 OAHU.JWI-30 metaG	Host-Associated	Open in IMG/M
3300012273	Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 2 OAHU.JWI-85 metaG	Host-Associated	Open in IMG/M
3300012887	Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Olavius sp. 1 OAHU.JWI-45 metaG	Host-Associated	Open in IMG/M
3300027377	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Inanidrilus exumae BAHAMAS.3 (SPAdes)	Host-Associated	Open in IMG/M
3300027382	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius filocauda PIANOSA.1	Host-Associated	Open in IMG/M
3300027550	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius vacuus BAHAMAS.2 (SPAdes)	Host-Associated	Open in IMG/M
3300027557	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius sp. 2 HERON ISLAND (SPAdes)	Host-Associated	Open in IMG/M
3300027599	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius ilvae ELBA.2 (SPAdes)	Host-Associated	Open in IMG/M
3300027602	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius albidus HERON ISLAND.1 (SPAdes)	Host-Associated	Open in IMG/M
3300027615	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius ilvae ELBA.1 (SPAdes)	Host-Associated	Open in IMG/M
3300027620	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius algarvensis Type G CAVOLI (SPAdes)	Host-Associated	Open in IMG/M
3300027658	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Inanidrilus leukodermatus Group 2 BELIZE.1 (SPAdes)	Host-Associated	Open in IMG/M
3300027661	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Inanidrilus leukodermatus Group 1a BELIZE.1 (SPAdes)	Host-Associated	Open in IMG/M

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign