Metagenome Family F016094

Basic Information
Family ID	F016094
Family Type	Metagenome
Number of Sequences	249
Average Sequence Length	47 residues
Representative Sequence	MGRPASPFIGEGKARVIEEEKEKNEREKKASRVAGSFFSFMRVPPIL
Number of Associated Samples	69
Number of Associated Scaffolds	248

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	21.30 %
% of genes near scaffold ends (potentially truncated)	17.27 %
% of genes from short scaffolds (< 2000 bps)	86.75 %
Associated GOLD sequencing projects	69
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.51

Most Common Taxonomy
Group	Unclassified (99.598 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere (99.197 % of family members)
Environment Ontology (ENVO)	Unclassified (99.197 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant surface (99.197 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 48.00% β-sheet: 0.00% Coil/Unstructured: 52.00%
Feature Viewer

Powered by Feature Viewer

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.60 %
All Organisms	root	All Organisms	0.40 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.60 %
cellular organisms	root	All Organisms → cellular organisms	0.40 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.60 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	0.40 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.60 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	0.40 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.60 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	0.40 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.60 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	0.40 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.60 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	0.40 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.60 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	0.40 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.60 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	0.40 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.60 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	0.40 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.60 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	0.40 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.60 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	0.40 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.60 %
Liliopsida	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida	0.40 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.60 %
Petrosaviidae	subclass	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae	0.40 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.60 %
commelinids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids	0.40 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.60 %
Poales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales	0.40 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.60 %
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	0.40 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.60 %
PACMAD clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade	0.40 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.60 %
Panicoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	0.40 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.60 %
Andropogonodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae	0.40 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.60 %
Andropogoneae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	0.40 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.60 %
Sorghinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae	0.40 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.60 %
Sorghum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum	0.40 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.60 %
Sorghum bicolor	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	0.40 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300013297\|Ga0157378_13203486	Not Available	508	Open in IMG/M
3300014745\|Ga0157377_10857031	Not Available	675	Open in IMG/M
3300015267\|Ga0182122_1039530	Not Available	596	Open in IMG/M
3300015267\|Ga0182122_1042591	Not Available	584	Open in IMG/M
3300015268\|Ga0182154_1038267	Not Available	606	Open in IMG/M
3300015268\|Ga0182154_1059899	Not Available	534	Open in IMG/M
3300015268\|Ga0182154_1066439	Not Available	518	Open in IMG/M
3300015269\|Ga0182113_1030433	Not Available	712	Open in IMG/M
3300015269\|Ga0182113_1044295	Not Available	638	Open in IMG/M
3300015269\|Ga0182113_1078765	Not Available	537	Open in IMG/M
3300015269\|Ga0182113_1086293	Not Available	522	Open in IMG/M
3300015274\|Ga0182188_1021576	Not Available	663	Open in IMG/M
3300015274\|Ga0182188_1022932	Not Available	653	Open in IMG/M
3300015274\|Ga0182188_1027058	Not Available	626	Open in IMG/M
3300015275\|Ga0182172_1013965	Not Available	805	Open in IMG/M
3300015275\|Ga0182172_1028395	Not Available	667	Open in IMG/M
3300015276\|Ga0182170_1013418	Not Available	818	Open in IMG/M
3300015276\|Ga0182170_1076726	Not Available	503	Open in IMG/M
3300015277\|Ga0182128_1030721	Not Available	660	Open in IMG/M
3300015277\|Ga0182128_1033039	Not Available	647	Open in IMG/M
3300015277\|Ga0182128_1051644	Not Available	571	Open in IMG/M
3300015277\|Ga0182128_1058522	Not Available	551	Open in IMG/M
3300015279\|Ga0182174_1039217	Not Available	634	Open in IMG/M
3300015279\|Ga0182174_1060807	Not Available	559	Open in IMG/M
3300015279\|Ga0182174_1073765	Not Available	527	Open in IMG/M
3300015279\|Ga0182174_1073765	Not Available	527	Open in IMG/M
3300015281\|Ga0182160_1034657	Not Available	648	Open in IMG/M
3300015281\|Ga0182160_1035502	Not Available	643	Open in IMG/M
3300015281\|Ga0182160_1041556	Not Available	617	Open in IMG/M
3300015281\|Ga0182160_1064782	Not Available	544	Open in IMG/M
3300015282\|Ga0182124_1026166	Not Available	695	Open in IMG/M
3300015282\|Ga0182124_1034513	Not Available	645	Open in IMG/M
3300015283\|Ga0182156_1026536	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	712	Open in IMG/M
3300015283\|Ga0182156_1041391	Not Available	628	Open in IMG/M
3300015283\|Ga0182156_1063507	Not Available	555	Open in IMG/M
3300015283\|Ga0182156_1079150	Not Available	519	Open in IMG/M
3300015285\|Ga0182186_1006145	Not Available	1054	Open in IMG/M
3300015285\|Ga0182186_1031903	Not Available	664	Open in IMG/M
3300015285\|Ga0182186_1040212	Not Available	622	Open in IMG/M
3300015286\|Ga0182176_1028281	Not Available	711	Open in IMG/M
3300015286\|Ga0182176_1039112	Not Available	644	Open in IMG/M
3300015286\|Ga0182176_1062017	Not Available	558	Open in IMG/M
3300015286\|Ga0182176_1080630	Not Available	513	Open in IMG/M
3300015287\|Ga0182171_1047450	Not Available	605	Open in IMG/M
3300015287\|Ga0182171_1070666	Not Available	539	Open in IMG/M
3300015287\|Ga0182171_1075265	Not Available	528	Open in IMG/M
3300015288\|Ga0182173_1039384	Not Available	631	Open in IMG/M
3300015288\|Ga0182173_1045936	Not Available	605	Open in IMG/M
3300015288\|Ga0182173_1065102	Not Available	548	Open in IMG/M
3300015288\|Ga0182173_1078820	Not Available	517	Open in IMG/M
3300015288\|Ga0182173_1081060	Not Available	512	Open in IMG/M
3300015289\|Ga0182138_1045168	Not Available	615	Open in IMG/M
3300015289\|Ga0182138_1048402	Not Available	603	Open in IMG/M
3300015289\|Ga0182138_1057383	Not Available	574	Open in IMG/M
3300015289\|Ga0182138_1062075	Not Available	561	Open in IMG/M
3300015291\|Ga0182125_1039115	Not Available	652	Open in IMG/M
3300015291\|Ga0182125_1058371	Not Available	582	Open in IMG/M
3300015291\|Ga0182125_1061766	Not Available	572	Open in IMG/M
3300015291\|Ga0182125_1067701	Not Available	557	Open in IMG/M
3300015291\|Ga0182125_1067881	Not Available	556	Open in IMG/M
3300015291\|Ga0182125_1075474	Not Available	539	Open in IMG/M
3300015291\|Ga0182125_1079818	Not Available	530	Open in IMG/M
3300015292\|Ga0182141_1043094	Not Available	633	Open in IMG/M
3300015292\|Ga0182141_1081265	Not Available	526	Open in IMG/M
3300015292\|Ga0182141_1091662	Not Available	507	Open in IMG/M
3300015294\|Ga0182126_1028165	Not Available	719	Open in IMG/M
3300015294\|Ga0182126_1029134	Not Available	712	Open in IMG/M
3300015294\|Ga0182126_1041942	Not Available	643	Open in IMG/M
3300015294\|Ga0182126_1076295	Not Available	539	Open in IMG/M
3300015294\|Ga0182126_1084070	Not Available	524	Open in IMG/M
3300015295\|Ga0182175_1045749	Not Available	633	Open in IMG/M
3300015295\|Ga0182175_1094370	Not Available	509	Open in IMG/M
3300015296\|Ga0182157_1007084	Not Available	1082	Open in IMG/M
3300015299\|Ga0182107_1034147	Not Available	703	Open in IMG/M
3300015300\|Ga0182108_1063172	Not Available	592	Open in IMG/M
3300015300\|Ga0182108_1070452	Not Available	572	Open in IMG/M
3300015302\|Ga0182143_1041823	Not Available	662	Open in IMG/M
3300015302\|Ga0182143_1046662	Not Available	641	Open in IMG/M
3300015302\|Ga0182143_1069724	Not Available	570	Open in IMG/M
3300015302\|Ga0182143_1089031	Not Available	528	Open in IMG/M
3300015302\|Ga0182143_1089525	Not Available	528	Open in IMG/M
3300015302\|Ga0182143_1096146	Not Available	516	Open in IMG/M
3300015303\|Ga0182123_1008335	Not Available	994	Open in IMG/M
3300015303\|Ga0182123_1029194	Not Available	712	Open in IMG/M
3300015303\|Ga0182123_1066191	Not Available	566	Open in IMG/M
3300015304\|Ga0182112_1028415	Not Available	741	Open in IMG/M
3300015304\|Ga0182112_1032815	Not Available	711	Open in IMG/M
3300015304\|Ga0182112_1058245	Not Available	603	Open in IMG/M
3300015304\|Ga0182112_1103556	Not Available	506	Open in IMG/M
3300015305\|Ga0182158_1031161	Not Available	718	Open in IMG/M
3300015305\|Ga0182158_1055905	Not Available	608	Open in IMG/M
3300015305\|Ga0182158_1073387	Not Available	561	Open in IMG/M
3300015305\|Ga0182158_1096106	Not Available	516	Open in IMG/M
3300015305\|Ga0182158_1106143	Not Available	500	Open in IMG/M
3300015307\|Ga0182144_1050195	Not Available	636	Open in IMG/M
3300015307\|Ga0182144_1086567	Not Available	540	Open in IMG/M
3300015307\|Ga0182144_1094274	Not Available	526	Open in IMG/M
3300015308\|Ga0182142_1020865	Not Available	834	Open in IMG/M
3300015308\|Ga0182142_1024299	Not Available	799	Open in IMG/M
3300015308\|Ga0182142_1085426	Not Available	552	Open in IMG/M
3300015308\|Ga0182142_1091526	Not Available	541	Open in IMG/M
3300015314\|Ga0182140_1033444	Not Available	731	Open in IMG/M
3300015314\|Ga0182140_1035000	Not Available	721	Open in IMG/M
3300015314\|Ga0182140_1058621	Not Available	621	Open in IMG/M
3300015314\|Ga0182140_1073322	Not Available	581	Open in IMG/M
3300015314\|Ga0182140_1090655	Not Available	544	Open in IMG/M
3300015322\|Ga0182110_1045218	Not Available	687	Open in IMG/M
3300015322\|Ga0182110_1046609	Not Available	681	Open in IMG/M
3300015322\|Ga0182110_1062393	Not Available	625	Open in IMG/M
3300015322\|Ga0182110_1105607	Not Available	530	Open in IMG/M
3300015322\|Ga0182110_1110035	Not Available	523	Open in IMG/M
3300015323\|Ga0182129_1080161	Not Available	564	Open in IMG/M
3300015341\|Ga0182187_1125869	Not Available	596	Open in IMG/M
3300015341\|Ga0182187_1171287	Not Available	533	Open in IMG/M
3300015341\|Ga0182187_1194692	Not Available	507	Open in IMG/M
3300015342\|Ga0182109_1127884	Not Available	622	Open in IMG/M
3300015342\|Ga0182109_1148143	Not Available	589	Open in IMG/M
3300015342\|Ga0182109_1167633	Not Available	561	Open in IMG/M
3300015342\|Ga0182109_1185931	Not Available	539	Open in IMG/M
3300015342\|Ga0182109_1222097	Not Available	503	Open in IMG/M
3300015343\|Ga0182155_1026405	Not Available	1054	Open in IMG/M
3300015343\|Ga0182155_1045776	Not Available	883	Open in IMG/M
3300015343\|Ga0182155_1073284	Not Available	753	Open in IMG/M
3300015343\|Ga0182155_1081679	Not Available	725	Open in IMG/M
3300015343\|Ga0182155_1143924	Not Available	594	Open in IMG/M
3300015343\|Ga0182155_1174034	Not Available	554	Open in IMG/M
3300015343\|Ga0182155_1198773	Not Available	527	Open in IMG/M
3300015344\|Ga0182189_1095365	Not Available	697	Open in IMG/M
3300015344\|Ga0182189_1137082	Not Available	611	Open in IMG/M
3300015344\|Ga0182189_1191104	Not Available	539	Open in IMG/M
3300015344\|Ga0182189_1192229	Not Available	538	Open in IMG/M
3300015344\|Ga0182189_1227350	Not Available	503	Open in IMG/M
3300015345\|Ga0182111_1150327	Not Available	608	Open in IMG/M
3300015345\|Ga0182111_1152568	Not Available	605	Open in IMG/M
3300015345\|Ga0182111_1162486	Not Available	590	Open in IMG/M
3300015345\|Ga0182111_1164449	Not Available	587	Open in IMG/M
3300015345\|Ga0182111_1178555	Not Available	569	Open in IMG/M
3300015345\|Ga0182111_1199359	Not Available	545	Open in IMG/M
3300015345\|Ga0182111_1247006	Not Available	500	Open in IMG/M
3300015346\|Ga0182139_1184363	Not Available	563	Open in IMG/M
3300015346\|Ga0182139_1188181	Not Available	558	Open in IMG/M
3300015347\|Ga0182177_1028459	Not Available	1115	Open in IMG/M
3300015347\|Ga0182177_1104539	Not Available	700	Open in IMG/M
3300015347\|Ga0182177_1159838	Not Available	597	Open in IMG/M
3300015347\|Ga0182177_1177726	Not Available	573	Open in IMG/M
3300015347\|Ga0182177_1218269	Not Available	529	Open in IMG/M
3300015347\|Ga0182177_1233947	Not Available	515	Open in IMG/M
3300015347\|Ga0182177_1241731	Not Available	508	Open in IMG/M
3300015351\|Ga0182161_1111999	Not Available	709	Open in IMG/M
3300015351\|Ga0182161_1124670	Not Available	681	Open in IMG/M
3300015351\|Ga0182161_1143989	Not Available	644	Open in IMG/M
3300015351\|Ga0182161_1235898	Not Available	529	Open in IMG/M
3300015355\|Ga0182159_1045089	Not Available	1169	Open in IMG/M
3300015355\|Ga0182159_1063948	Not Available	1023	Open in IMG/M
3300015355\|Ga0182159_1107528	Not Available	833	Open in IMG/M
3300015355\|Ga0182159_1178592	Not Available	675	Open in IMG/M
3300015355\|Ga0182159_1191753	Not Available	654	Open in IMG/M
3300015361\|Ga0182145_1060719	Not Available	741	Open in IMG/M
3300015361\|Ga0182145_1145547	Not Available	554	Open in IMG/M
3300015361\|Ga0182145_1154999	Not Available	543	Open in IMG/M
3300015361\|Ga0182145_1167552	Not Available	529	Open in IMG/M
3300015361\|Ga0182145_1193426	Not Available	503	Open in IMG/M
3300017404\|Ga0182203_1070635	Not Available	661	Open in IMG/M
3300017407\|Ga0182220_1088776	Not Available	533	Open in IMG/M
3300017409\|Ga0182204_1066719	Not Available	602	Open in IMG/M
3300017410\|Ga0182207_1132568	Not Available	555	Open in IMG/M
3300017410\|Ga0182207_1164601	Not Available	514	Open in IMG/M
3300017411\|Ga0182208_1010951	Not Available	1047	Open in IMG/M
3300017415\|Ga0182202_1070378	Not Available	627	Open in IMG/M
3300017415\|Ga0182202_1131246	Not Available	512	Open in IMG/M
3300017417\|Ga0182230_1059252	Not Available	677	Open in IMG/M
3300017424\|Ga0182219_1048531	Not Available	699	Open in IMG/M
3300017424\|Ga0182219_1079151	Not Available	601	Open in IMG/M
3300017424\|Ga0182219_1113072	Not Available	538	Open in IMG/M
3300017424\|Ga0182219_1129776	Not Available	515	Open in IMG/M
3300017424\|Ga0182219_1130274	Not Available	514	Open in IMG/M
3300017425\|Ga0182224_1071986	Not Available	656	Open in IMG/M
3300017425\|Ga0182224_1109313	Not Available	576	Open in IMG/M
3300017425\|Ga0182224_1135941	Not Available	536	Open in IMG/M
3300017427\|Ga0182190_1087576	Not Available	625	Open in IMG/M
3300017430\|Ga0182192_1043533	Not Available	807	Open in IMG/M
3300017430\|Ga0182192_1051084	Not Available	765	Open in IMG/M
3300017433\|Ga0182206_1096757	Not Available	590	Open in IMG/M
3300017433\|Ga0182206_1123155	Not Available	546	Open in IMG/M
3300017436\|Ga0182209_1073524	Not Available	664	Open in IMG/M
3300017436\|Ga0182209_1085806	Not Available	632	Open in IMG/M
3300017436\|Ga0182209_1139882	Not Available	540	Open in IMG/M
3300017436\|Ga0182209_1168787	Not Available	507	Open in IMG/M
3300017438\|Ga0182191_1062985	Not Available	718	Open in IMG/M
3300017438\|Ga0182191_1176668	Not Available	508	Open in IMG/M
3300017442\|Ga0182221_1068540	Not Available	667	Open in IMG/M
3300017442\|Ga0182221_1113760	Not Available	571	Open in IMG/M
3300017442\|Ga0182221_1151794	Not Available	521	Open in IMG/M
3300017443\|Ga0182193_1051894	Not Available	787	Open in IMG/M
3300017443\|Ga0182193_1086163	Not Available	668	Open in IMG/M
3300017443\|Ga0182193_1089907	Not Available	659	Open in IMG/M
3300017443\|Ga0182193_1108762	Not Available	618	Open in IMG/M
3300017443\|Ga0182193_1134657	Not Available	575	Open in IMG/M
3300017443\|Ga0182193_1183108	Not Available	515	Open in IMG/M
3300017680\|Ga0182233_1096373	Not Available	545	Open in IMG/M
3300017681\|Ga0182226_1052838	Not Available	736	Open in IMG/M
3300017681\|Ga0182226_1071126	Not Available	640	Open in IMG/M
3300017681\|Ga0182226_1099798	Not Available	547	Open in IMG/M
3300017682\|Ga0182229_1069670	Not Available	604	Open in IMG/M
3300017683\|Ga0182218_1017497	Not Available	959	Open in IMG/M
3300017683\|Ga0182218_1062204	Not Available	664	Open in IMG/M
3300017683\|Ga0182218_1099860	Not Available	575	Open in IMG/M
3300017683\|Ga0182218_1134587	Not Available	524	Open in IMG/M
3300017684\|Ga0182225_1031491	Not Available	806	Open in IMG/M
3300017684\|Ga0182225_1073477	Not Available	620	Open in IMG/M
3300017684\|Ga0182225_1128906	Not Available	521	Open in IMG/M
3300017686\|Ga0182205_1053800	Not Available	739	Open in IMG/M
3300017686\|Ga0182205_1094631	Not Available	615	Open in IMG/M
3300017686\|Ga0182205_1104299	Not Available	595	Open in IMG/M
3300017686\|Ga0182205_1162091	Not Available	512	Open in IMG/M
3300017689\|Ga0182231_1104678	Not Available	548	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	100.00%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	100.00%

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	99.20%
Rhizosphere	Host-Associated → Plants → Rhizosphere	0.80%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	99.20%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	0.80%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	99.20%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	0.80%

Habitat	Taxonomy	Distribution
Miscanthus Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere	99.20%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.80%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated	Open in IMG/M
3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Host-Associated	Open in IMG/M
3300015267	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015268	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015269	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015274	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015275	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015276	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015277	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015279	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015281	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015282	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015283	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015285	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015286	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015287	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015288	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015289	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015291	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015292	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015294	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015295	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015296	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015299	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015300	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015302	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015303	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015304	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015305	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015307	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015308	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015314	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015322	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015323	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015341	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015342	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015343	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015344	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015345	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015346	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015347	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015351	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015355	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015361	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300017404	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017407	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017409	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017410	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017411	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017413	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017415	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017417	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017420	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017424	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017425	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017427	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017430	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017433	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017436	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017438	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017442	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017443	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017680	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017681	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017682	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017683	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017684	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017686	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017689	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0157378_132034861	3300013297	Miscanthus Rhizosphere	FLGRLASPFIGDGKARVTPKENEKNEREKKASRIAGSFFSFMRVLPIL*
Ga0157377_108570311	3300014745	Miscanthus Rhizosphere	MGRPASPFIGEGKARVTEEKKEKNEREKKASRVAGSFFSFIRVPPIL*
Ga0182122_10395301	3300015267	Miscanthus Phyllosphere	MGCPASSFIGEGKARVTTEEKKMNEREKAFRIAGSFFFMRIPPIL*
Ga0182122_10425911	3300015267	Miscanthus Phyllosphere	MGRTASPFIGEGKARVTAEENEKNKREKKASRIVGSFFSFMWIPPIL*
Ga0182122_10530251	3300015267	Miscanthus Phyllosphere	MLCSFDKISSFIGPSAFPFIGEGKARIIEEEKVKNKTEKKASRVAGSFFSFMRVPLIL*
Ga0182154_10382672	3300015268	Miscanthus Phyllosphere	MGHPASPFIGQGKAWVTTEEKEKNEREKKASRVARSFFSFMRVPPIL*
Ga0182154_10598991	3300015268	Miscanthus Phyllosphere	MGCPASPFIGKGKAWVTEEEKEKNEREKKASRVAGSFFSFM*
Ga0182154_10664392	3300015268	Miscanthus Phyllosphere	MGCPASPFIGEGKARIIEKEKEKNEREKKASRVAGSFFSFMRVPPIL*
Ga0182113_10110111	3300015269	Miscanthus Phyllosphere	MGCPASHFIGEGRARITTEEKEKNQREKKASRIIGSFFLFMRVSPTL*
Ga0182113_10304331	3300015269	Miscanthus Phyllosphere	MGCHVSSFIGEGKVWVTAVEKEKNEREKKASRIAGSIFSFMRVPQIL*
Ga0182113_10442951	3300015269	Miscanthus Phyllosphere	MGHPASPFIGEGKARVIEEEKEKNEREKKASRPTRSFFSFMPVPPIL*
Ga0182113_10787651	3300015269	Miscanthus Phyllosphere	MGCPASPFIGEGKTLVTEEEKEKNERGEKASRIAGSFFSFMRVPPIL*
Ga0182113_10862931	3300015269	Miscanthus Phyllosphere	PTSPFTGEGKAHVTEEKKEKNKREKKASRVVGSFFSFMWVPMIL*
Ga0182188_10215761	3300015274	Miscanthus Phyllosphere	MGCPASPFIGEGKARVTEKEKEKNKRDKKASRVARSFFMRISLIM*
Ga0182188_10219141	3300015274	Miscanthus Phyllosphere	MGHPASPFISKGKARVTAEEKEKNEREKKASRIAGPFFSFMGVPPIL*
Ga0182188_10229321	3300015274	Miscanthus Phyllosphere	MGCPTSPLSDEGKSWVTEEEKEKNEREKKASRVGGSFFSFMRVPLIL*
Ga0182188_10270581	3300015274	Miscanthus Phyllosphere	MGCPTFCFIGQGKVWVIAEEKEKNEREKASRVAGSFFSFMRIPLIL*
Ga0182188_10390131	3300015274	Miscanthus Phyllosphere	MGHPASPFIGEGKSRVTNEEKEKNEREKKASRVAMSFFSFMRVPPIL*
Ga0182172_10139652	3300015275	Miscanthus Phyllosphere	VRRPASPFIGEGKARVIEEENEKNEREKKASRITGSFSFMRVSPIL*
Ga0182172_10283951	3300015275	Miscanthus Phyllosphere	MGRPTSPFIGKGKARVTEEKKEKNEREKKAFRVAGSFFSFMRVSPIL*
Ga0182170_10134181	3300015276	Miscanthus Phyllosphere	MGWPAFPFIGKGKARVTTEEKEKNEREKKASRIAGSFFFFMRVLPIL*
Ga0182170_10767262	3300015276	Miscanthus Phyllosphere	MGRPAFPFIGEGKAWVTEEEKEKNEREKKASRAVGSFFSFMRAPPTL*
Ga0182128_10307211	3300015277	Miscanthus Phyllosphere	RPASPFIGEGKAWVTTEEKEKNEREPKASRIAGSFYSFMQVLPIL*
Ga0182128_10330391	3300015277	Miscanthus Phyllosphere	MGRPASPFIGEGKARVTEEEKEKNEREKKASRVARSFFSFMRVPPIL*
Ga0182128_10516441	3300015277	Miscanthus Phyllosphere	VGRPASPFIGEGKARVTEEKKEKNEREKKASRVVGSFFSFMRVSLIL*
Ga0182128_10585221	3300015277	Miscanthus Phyllosphere	MGHPASSFIGEGKTRVTAEEKKKNEKEKKASRIVGSFFMWVMLIL*
Ga0182174_10392172	3300015279	Miscanthus Phyllosphere	MGRPASPFLDEGKAWVTVEEKEKNEREKKAFRIVGSFFSFMRVPLIL*
Ga0182174_10608071	3300015279	Miscanthus Phyllosphere	LFIGEGKARVTEEEEEKNEREKNASRIVGSFSFMRVPPTL*
Ga0182174_10737652	3300015279	Miscanthus Phyllosphere	MGCPAASFIGEGKARVTEEQKEKNKREKKAFRVAGSFFSFMRVPLIL*
Ga0182174_10737653	3300015279	Miscanthus Phyllosphere	PASPFIGEGKARDTEEKIEKNEREKNASRVAGSFFSFMRVPPIL*
Ga0182160_10346572	3300015281	Miscanthus Phyllosphere	MGRPASPFIGEGKARVKQEEKEKNEREQKASRVARSFFSFMRVPLIL*
Ga0182160_10355021	3300015281	Miscanthus Phyllosphere	FMGHPASLFIGKGKTRVTKEKKENEREKKAVRVAGSFSFMRVPPIL*
Ga0182160_10365772	3300015281	Miscanthus Phyllosphere	MGRPAFPFIGEGKAWVTEEEKEKNEREKKASRIIGSFFFFMRVTPIL*
Ga0182160_10415561	3300015281	Miscanthus Phyllosphere	MGRPASSFTDEGKTRVIEEEKEKNEREKKASRVVGSFFSFMRVPLIL*
Ga0182160_10647822	3300015281	Miscanthus Phyllosphere	MGHPASPFIGEGKARVTEEEKEKNEREKNASRVVGSFFSFMCVPLIL*
Ga0182124_10261662	3300015282	Miscanthus Phyllosphere	MWRPASPFIDEGKARVTEEEKEKNEREKASRVAGSFFSFMRVPPLL*
Ga0182124_10312671	3300015282	Miscanthus Phyllosphere	VPYFPFIGEGKAQVIEEEKEKNERERASRVVGSFFSFMQVPLTL*
Ga0182124_10345131	3300015282	Miscanthus Phyllosphere	MGCPASPFIGEGKARIIEKEKEKNEREKKASRVAGSFFSFIRVPPIL*
Ga0182156_10265362	3300015283	Miscanthus Phyllosphere	MGHPASPFISEGKAHVTEEEKEKNEREKKASRVAGSFFSFMRVL
Ga0182156_10413911	3300015283	Miscanthus Phyllosphere	MGHPASPFIGERKGRVTTEEKEKNEREKKASRIVGSFFSFMQVPSIL*
Ga0182156_10635071	3300015283	Miscanthus Phyllosphere	MGRPASPFIDEGKARVTAEEKKKNEREKKGSRIAGSFFSFMGVPPIL*
Ga0182156_10791501	3300015283	Miscanthus Phyllosphere	MGCPASPFIGEGKAWVTAEKKEKNEREKKACRIVGSFFSFMRVPSIL*
Ga0182156_10796592	3300015283	Miscanthus Phyllosphere	FMGCPAFPFIGEGKARITEEEKEKNEREKNASRVVGSFFSFMCVPLIL*
Ga0182186_10061452	3300015285	Miscanthus Phyllosphere	FLSRGFPCADFFPFMGRPTSLFIGEGKARVTAEEKEKKASRVAGSFFSFMQVSSTL*
Ga0182186_10319032	3300015285	Miscanthus Phyllosphere	MGRPTFSFIGEGKARVTEEEKEKNEREKKASRVAGSFFSFTRVPPIL*
Ga0182186_10402121	3300015285	Miscanthus Phyllosphere	MEHHAFPFIGEGKTRVTEEENEKNEREKKTFKVVGSFFSFMRIPPIL*
Ga0182176_10271112	3300015286	Miscanthus Phyllosphere	MGRPAFPFIGEGKACVTAEEKEKNEREKKASRIIGSFFLFMWVPPTL*
Ga0182176_10282811	3300015286	Miscanthus Phyllosphere	MGRPASPFIGEGKARVIEEEKEKNEREKKASRVAGSFFSFMRVPPIL*
Ga0182176_10391121	3300015286	Miscanthus Phyllosphere	MGHPASPFIDEGKARVTEEKREKNEREKKASRVAGSFSFMPLLLIM*
Ga0182176_10620171	3300015286	Miscanthus Phyllosphere	VGRPAFLFIGEGKARVTEEEKEKNEREKKAFRVAGSFFSFMRVPLIL*
Ga0182176_10787001	3300015286	Miscanthus Phyllosphere	MGSPASPFRGEGKARVTEEKNKKNVREKKAFRVAGSFSFPLIL*
Ga0182176_10806301	3300015286	Miscanthus Phyllosphere	PFIGEGTALIVEEEKGEEREREKKASRVVESFFSFMRVPPIL*
Ga0182171_10474501	3300015287	Miscanthus Phyllosphere	VFLISLFMGRPASPFIGEGKARVTEEENEKNEREKKASRVAGSFSFMWVPPIL*
Ga0182171_10566291	3300015287	Miscanthus Phyllosphere	MGRPSFPFIGEGKARVTAEEKEKNKREKKAFRIAGSFFFFMRVPPTL*
Ga0182171_10706661	3300015287	Miscanthus Phyllosphere	MGCPASPFIGEGKAWVITEEKEKNEREKVSRVARSFFSFMWVPPIL*
Ga0182171_10752651	3300015287	Miscanthus Phyllosphere	MGRPASPFIGEGKTRVTEEENEKNEREKKTFKVVGSFFSFIRLLPIL*
Ga0182173_10393841	3300015288	Miscanthus Phyllosphere	MGCPTSSFIGEGKAWVTTEEKEKNEREKKASRVARSFFSFMRVPPIL*
Ga0182173_10459362	3300015288	Miscanthus Phyllosphere	MGRPASPFIGEGKARVTADEKEKNEREKKAFRIVGSFFSFMRVPPIL*
Ga0182173_10651021	3300015288	Miscanthus Phyllosphere	MGCPASPFIGEGKAQVAEEEKEKNEREKMACRVVGSFFSFIWVSSIL*
Ga0182173_10788202	3300015288	Miscanthus Phyllosphere	MPFMGRPAFPFIGQGKARVIVEEKEKNEREKKTSRIIGSFFSFMRVPLIL*
Ga0182173_10810601	3300015288	Miscanthus Phyllosphere	MGHPASPFIGKGKARVTVEEMEKNEREKKASRIVGSFFSFMRVPPIL*
Ga0182138_10451681	3300015289	Miscanthus Phyllosphere	MGHPAFPFIEEGKAWVIEEEKEKNKREKKASKVDGSFFSFMRVPSIL*
Ga0182138_10484022	3300015289	Miscanthus Phyllosphere	MGRPASPFIDEEKARVIEEEKYKNEIGKKASRVAGSFFSFMRVLLIL*
Ga0182138_10573831	3300015289	Miscanthus Phyllosphere	MGRPASPFIGEGKARVIEEKKEKNEREKKASRIAGSFFSFMWVPLIL*
Ga0182138_10620752	3300015289	Miscanthus Phyllosphere	MGRPASPFIGEGKARVTAEKKEKNGREKKASRIAGSFSFMRVPLIL*
Ga0182125_10391152	3300015291	Miscanthus Phyllosphere	MRRPASPFIGKGKTWVIEEEKEKNDREKGSRVAGSFSSMRVPPIL*
Ga0182125_10430911	3300015291	Miscanthus Phyllosphere	MRLPAFPFIDEWKTRVIEEEKEKNQREKKASRVVGSFFNFILVPPIL*
Ga0182125_10583711	3300015291	Miscanthus Phyllosphere	MGCPASPFIGEGKAWVTEEEKEKNEREKKASRVAGSFLSFMRVPPIL*
Ga0182125_10617661	3300015291	Miscanthus Phyllosphere	GSGSPFMGLPTSPFICEGKAWVIAEEKEKNEIEKKASRIAGSFFSFMRVPLIL*
Ga0182125_10677011	3300015291	Miscanthus Phyllosphere	MGCPAFPFIGEGKAWVTTEEKEKNERERRRLRIVGSFFFMRVPPIL*
Ga0182125_10678812	3300015291	Miscanthus Phyllosphere	VRRPASPCIGEGKARVTEEENEKNEREKKASRITGSFSFMRVSPIL*
Ga0182125_10754742	3300015291	Miscanthus Phyllosphere	MEHHAFPFIGEGKTRVTEEENEKNERERKASRVAGSFFSFMRVPPIL*
Ga0182125_10798181	3300015291	Miscanthus Phyllosphere	VFISPGVGRPASPFIDTGKARVTEEEKEKNEREKKASRVTGSFFSFMRVPPIM*
Ga0182141_10430941	3300015292	Miscanthus Phyllosphere	MGRPASPFIGEGKARVTEEKKEKNEREKKASRVVGSFFSFIRVPLIL*
Ga0182141_10812652	3300015292	Miscanthus Phyllosphere	VGHPASLFIGEGKARVTEEEKEKNERKKKVFRVTESFSFMRVPPIL*
Ga0182141_10884701	3300015292	Miscanthus Phyllosphere	SPFKGCLAFHFIGKGKAWITKEEKVMNEREKASRVVGSFFSFMRVPLIL*
Ga0182141_10916621	3300015292	Miscanthus Phyllosphere	ASPFIGEGKARVIKEEKKNEREKKASRVAGSFFSFIRVLPIL*
Ga0182126_10281651	3300015294	Miscanthus Phyllosphere	MGRPASPFIGERKARVIAEEEEKNEREKKASRVVGSFFSFMRVLSIL*
Ga0182126_10291342	3300015294	Miscanthus Phyllosphere	MGRTASPFIGEGKARVTEEENEKNERERKASRVAGSFFSFMRVPPIL*
Ga0182126_10419421	3300015294	Miscanthus Phyllosphere	MGRPSSPFIGEGKAQVTEEEKEKNERERKASRVVGSFFSIMWVLIDV*
Ga0182126_10762951	3300015294	Miscanthus Phyllosphere	MGRPASLFIGEGKAQVTTEEKDKNKRENKAFRIAESFFFFMQVPPIL*
Ga0182126_10840701	3300015294	Miscanthus Phyllosphere	MGRPAFPFIGPGKARVTAEEKEKNEREKKASRIAGSFFSFMQVPLTL*
Ga0182175_10457491	3300015295	Miscanthus Phyllosphere	MGCPASPFIGEGKARVTVEKNEKNEREKASKVAGSFFSFMRVLSTL*
Ga0182175_10943701	3300015295	Miscanthus Phyllosphere	SGSPFMGRPASPFIGEEKAQVTAEEMEKNEREKKAYRITRSFFSFMRVSPIL*
Ga0182157_10070841	3300015296	Miscanthus Phyllosphere	MGCPTSPFIGEWKAWVTEEEKEKNEREKASRVARSFFSFMWAPPIL*
Ga0182107_10266123	3300015299	Miscanthus Phyllosphere	MGRPAFSFIGEGKARVTAEKKEKNEREKKATRTVGSFFSFMRVPPIDVNRDGSTS
Ga0182107_10341472	3300015299	Miscanthus Phyllosphere	MGHPASSFIGEGEAWVTEEEKEKNEREKKASRVVVSFFSFIQVPLIL*
Ga0182107_10421711	3300015299	Miscanthus Phyllosphere	MGRPASPFIGEGKAWVIAEEKEKNERDREKREKKASRIVGSFSFMRVLPIL*
Ga0182107_10731941	3300015299	Miscanthus Phyllosphere	MGRLASSFIGEGKARVTTEEEERNGRERERNASRVVGSFFSFMQVPPIL*
Ga0182108_10631721	3300015300	Miscanthus Phyllosphere	VGRLASPFIGERKARIIEEEKEKNEREKKASRVAGSFSIMRVPLIL*
Ga0182108_10704521	3300015300	Miscanthus Phyllosphere	MGRPASPFIGEGKTRVTAEEKEKNEREKKASRITESFFSFMWVPPIL*
Ga0182143_10418232	3300015302	Miscanthus Phyllosphere	MGHPASPFIGEGKTQVTEEEKKKNETEKKASRVAGSFFTFMRVSLIL*
Ga0182143_10466622	3300015302	Miscanthus Phyllosphere	VLFCFDLVLLSSVGRPASPFIGKGKARVTEEKKEKNEREKKASRVVGFFFSFMRVPLIL*
Ga0182143_10681921	3300015302	Miscanthus Phyllosphere	MGHPSSPFIGEGKAQVIEEEKEKNEREEKVSRVVRSFFSFISVPPIL*
Ga0182143_10697241	3300015302	Miscanthus Phyllosphere	MGCPASPFIGYGKAQVTEEEKEKNEREKKASRVARAFFSFIRVPPIL*
Ga0182143_10890312	3300015302	Miscanthus Phyllosphere	MGHPASSFIGEGKARVTEEEKEKNEIEKKASRVAGSFFSFMRVPPIL*
Ga0182143_10895251	3300015302	Miscanthus Phyllosphere	MGRPAFPSIGEGKVWVTAEEKEKNEREKKASRIAVSFFSFMRVPSIM*
Ga0182143_10961462	3300015302	Miscanthus Phyllosphere	MGHPASPFIGEGKGRVTTEEKEKNKREKKASRVAESFFPFMWVPPIL*
Ga0182123_10083351	3300015303	Miscanthus Phyllosphere	MGCPAFPFIGERKAWVTTEKKEKNKREKKASEIIGSIFSFMWAPLIL*
Ga0182123_10291942	3300015303	Miscanthus Phyllosphere	MGCPTFPFIGEGKVRVIEEEKEKNKREKKAFRVVGSFFSFMRV*
Ga0182123_10661911	3300015303	Miscanthus Phyllosphere	MGRPASPFIGQGKAWVIVEEKEKNEREKKASRIAGSFFSFMRVSPIL*
Ga0182123_10878061	3300015303	Miscanthus Phyllosphere	MGRPTFPFIGEGKAQVIEEEKEKNEREKKVSRIVGSFFNFMRVSPIL*
Ga0182123_10968891	3300015303	Miscanthus Phyllosphere	MGCPASPFIGEGKSWVTEENKEKNEREKKDSRVVGSFSFMRVPPIL*
Ga0182112_10284151	3300015304	Miscanthus Phyllosphere	MGHPASPFIGEGKAWVTAEEKEKNEREKKASRVLGSFFSFMRVLLIL*
Ga0182112_10328151	3300015304	Miscanthus Phyllosphere	MVYHASPFIGEGKARVIEEEKERNKREKKVFRIAGSFSFIRVPLIL*
Ga0182112_10559811	3300015304	Miscanthus Phyllosphere	MGHPASHFIGEGKERVTAEEKEKNEREKKASRITESFFSFMWVPPIL*
Ga0182112_10582451	3300015304	Miscanthus Phyllosphere	MGRPASPFIGEGKARVIADEKEKNEREKKAFRVTGSFSFMRVSPIL*
Ga0182112_11035561	3300015304	Miscanthus Phyllosphere	MGRPASLFIDEGKARVIDEENEKNEIEKKASKIIGSFFSFMGVPSIV*
Ga0182158_10311612	3300015305	Miscanthus Phyllosphere	MGCPTSPFIGQGKALVIAEEKEKNEREKKASRVAGSFSFIWIPPIL*
Ga0182158_10559051	3300015305	Miscanthus Phyllosphere	MGHPASPFIGKGKAWVIEEEKEKNEREKRASRVVESLFSFMRVPPIL*
Ga0182158_10732732	3300015305	Miscanthus Phyllosphere	MGCPASPFISEGKAWVIAEEKEKNEREKKASKIVGSFSFMGVLLIL*
Ga0182158_10733872	3300015305	Miscanthus Phyllosphere	ADLSPPFIGEGKAWVTSEEKKNEREKKASRIAGSFFSFMRVPLIL*
Ga0182158_10961061	3300015305	Miscanthus Phyllosphere	MGHPASPFISEGKARVTEEENEKKASRVARSFFSFMRVSPIL*
Ga0182158_11061431	3300015305	Miscanthus Phyllosphere	MGRPASPFIGEGKARVTEEEKEKNEGEKKASSVAGFFFSFMRVPPIV*
Ga0182144_10501951	3300015307	Miscanthus Phyllosphere	MGRPASPFIGEGKVWVIEEKKENNEREKKASRVTGSFFSFMRVLPIL*
Ga0182144_10650091	3300015307	Miscanthus Phyllosphere	MGCPASHFIGEGRAWITTEEKEKNQREKKASKIVGSFFLFMRVPPPL*
Ga0182144_10865671	3300015307	Miscanthus Phyllosphere	ICISNYPAFSFTGEGKTRVTAEENDKNEREKKASRIVGSFFSFMKVPLIL*
Ga0182144_10942742	3300015307	Miscanthus Phyllosphere	SCPLFMGRPASPFIDEGKARVTTEEKEKNEREKTSRVVGSFFSFMLVLLIL*
Ga0182142_10208652	3300015308	Miscanthus Phyllosphere	VGHPASLFIGEGKARVTEEEKEKNEREKKASRVARSFFSFMRVPPIL*
Ga0182142_10242991	3300015308	Miscanthus Phyllosphere	MGRSAFPFIDEGKVRVIEEEKEKNEREKKASRVVGFFFSFIWVPPIL*
Ga0182142_10854261	3300015308	Miscanthus Phyllosphere	MGRPASPFIGEGKARVTMKEKEKNEREKKASRVVGSFFSFMWVPLIL*
Ga0182142_10915261	3300015308	Miscanthus Phyllosphere	MGRPAFPFIGEGKARVTEEEKEKNEREKKAYRVVGSFFSFMRVPLIL*
Ga0182140_10334441	3300015314	Miscanthus Phyllosphere	MRHPASPFIGEGKAWVIEEEKEKNEREKKASRVARSFFSFMWVPL
Ga0182140_10350001	3300015314	Miscanthus Phyllosphere	MGCPASPFIGEGKARVTVEKNEKNEREKASKVAGSFFSFMR
Ga0182140_10586211	3300015314	Miscanthus Phyllosphere	MKRPASPFIDEGKARVIELESRRTRERERERKVSRVAGSFFSFMRVPLIL*
Ga0182140_10733221	3300015314	Miscanthus Phyllosphere	MERPASPFIGQGKARVTQEEKEKNEREKKAFRVAGSFFSFMRVLPIL*
Ga0182140_10906552	3300015314	Miscanthus Phyllosphere	GEGKARVTTEEKEKNQREKMASMIARSFFSFMRVLSIL*
Ga0182110_10452182	3300015322	Miscanthus Phyllosphere	MGRPASPFIGEGKARVIEEKNEKNEREKKASRVTGSFFSSMRVSLIL*
Ga0182110_10466091	3300015322	Miscanthus Phyllosphere	MGCSASPFIGEGKARVIEEEDEKNEREKKASRVAESFFSFMRVPPIL*
Ga0182110_10623931	3300015322	Miscanthus Phyllosphere	MGRPASSFIGKGKARVTEEKKEKNEREKKASRVARSFFSFMWVPLIL*
Ga0182110_11056071	3300015322	Miscanthus Phyllosphere	HPTSPFIGKGKAWVIEEEKKKNQREKKASRVVGSFFSFMRVPLIL*
Ga0182110_11100351	3300015322	Miscanthus Phyllosphere	VGRPASSFIGEGKAHVIEEEKEKNKREKKASRIAGSFFSFMRVSSTL*
Ga0182129_10801612	3300015323	Miscanthus Phyllosphere	SSSPIQIFLFMGRPASPFIGEGKTRVTEEEKEKNEREKKASRVAGSFFMQVPLIL*
Ga0182187_11258691	3300015341	Miscanthus Phyllosphere	MGCHASSFIGEGKARVTEEEKEKNKREKASRVAGFFSFMRVPPTV*
Ga0182187_11712871	3300015341	Miscanthus Phyllosphere	MGHPASPFIGEGKAWVIAEEKEKNEIEKKASRIAGSFFSFMRVSPIL*
Ga0182187_11946921	3300015341	Miscanthus Phyllosphere	VGRPAFSFIGEWKARVTGEKKEKNEIGKKAFRVAGSFFSFIRVPPIL*
Ga0182109_11278841	3300015342	Miscanthus Phyllosphere	MGRPAFSFIGEWKARVTGEKKEKNEIGKKAFRVAGSFFSFIRVPPIL*
Ga0182109_11481431	3300015342	Miscanthus Phyllosphere	MGRPASPFIDEGKAWGTEKEKEKNEREKKASRVTGSFFSFMRVPLILSFIPYRMKDQ*
Ga0182109_11528321	3300015342	Miscanthus Phyllosphere	MSCSCVKIPLFMGCPASPFIGEGKAWVKEEEKENHKREKNDFRVARSFFSFMRVPPIL*
Ga0182109_11676331	3300015342	Miscanthus Phyllosphere	MGCPTSPFIGEGKARVTEEEKEKNEREKKTSWVVGSFFFFFIRVSLIL*
Ga0182109_11794241	3300015342	Miscanthus Phyllosphere	PTSPFIGEGKARVIEKEKEKNEREKNASRVAGSFSFMRVPPIL*
Ga0182109_11859311	3300015342	Miscanthus Phyllosphere	MGRPASPFIGEGKARVIEEENEKSKREKKASRVAGSFFSFMQVPPIL*
Ga0182109_12220971	3300015342	Miscanthus Phyllosphere	MGRPASPFIGKGKAWVTIEEKEKNEREPKASRITGFFFFFMRVLLIL*
Ga0182155_10264051	3300015343	Miscanthus Phyllosphere	MGRPAFPFIGQGKAWVTAEEKEKNEREKKASRIAGSFFSFMRVPPIL*
Ga0182155_10457761	3300015343	Miscanthus Phyllosphere	MGCPASPFIDEGKARVTEEKKEKNERERKASRVVGSFFSFMRVPPIL*
Ga0182155_10732841	3300015343	Miscanthus Phyllosphere	MGCPASPFTGEGKARVTVEEKEKNEREKKASRVAGSFSFMRVPLIL*
Ga0182155_10816792	3300015343	Miscanthus Phyllosphere	MGHPASLFIGEGKAWVTLEEKKKNEREKKISRIAGSFFSFKWVP*
Ga0182155_11439241	3300015343	Miscanthus Phyllosphere	PMSSSPFMGCPTSPFIGEWKAWVTEEEKEKNEREKASRVARSFFSFMRVPLIL*
Ga0182155_11740341	3300015343	Miscanthus Phyllosphere	MLCSASPFIGYGKAQVTEEEKEKNEREKKASRVARAFFSFIRVPPIL*
Ga0182155_11987731	3300015343	Miscanthus Phyllosphere	FIGGGKARVTKEEKEKNEREKKASRVAGSFFSFMWVPPIT*
Ga0182189_10953651	3300015344	Miscanthus Phyllosphere	MGRHASPFIDEGKAWVTEEEKEKNEREKKASRITGSFFFFMQVPPIL*
Ga0182189_11370822	3300015344	Miscanthus Phyllosphere	MGCPASLFIGEGKARVTADEKENNEREKKASRIAGSFFSFMRVPPIL*
Ga0182189_11438311	3300015344	Miscanthus Phyllosphere	MGCSASHFIGEEKARVTTEEKKNEREKKASRIAGFFFFFMRVPSIL*
Ga0182189_11911041	3300015344	Miscanthus Phyllosphere	MERPASPFIGEGKARVTEEEKEKNGGENKASRVVGSFFSFIRVLPIL*
Ga0182189_11922291	3300015344	Miscanthus Phyllosphere	VGRSAFPFIGEGKARVTVEEKEKNEREKAFRIAGSFSFMRVPPIL*
Ga0182189_12273501	3300015344	Miscanthus Phyllosphere	MGRSASPLIGEGKARVTEEEKEKNVREKKASKVSGSFFSFMWVPRIL*
Ga0182111_11503272	3300015345	Miscanthus Phyllosphere	MGRPASPFIGEGKAWVIEEEKGEEREREKKASRVVESFFSFMRVPPIL*
Ga0182111_11525681	3300015345	Miscanthus Phyllosphere	MGRPASPFIDEGKARVTEEKKEKNEREKKAPRVAGSFFSFMRVPPIL*
Ga0182111_11624862	3300015345	Miscanthus Phyllosphere	MGRTASLFIGERKARVIEEEKDKNEREKASRVVGSFFSFMRVPSIL*
Ga0182111_11644492	3300015345	Miscanthus Phyllosphere	MGCHASSFIDEGKAPVTEEEKEKNEREKKASRVVGSFFFFIRVSPIL*
Ga0182111_11785551	3300015345	Miscanthus Phyllosphere	PSSSVGCPASPFIGEGKAHVIEKEKEKSEREKKASRVVESFFSFMRVLSIL*
Ga0182111_11993591	3300015345	Miscanthus Phyllosphere	MGRPASPFIDEGKARVTEEKKEKNEREKKAFRFARSSFVWVPLIL*
Ga0182111_12470062	3300015345	Miscanthus Phyllosphere	MGRPTSPFIGEDKAWVTEEKKKNKREKKASRVAESFSFMWVSPIL*
Ga0182139_10754161	3300015346	Miscanthus Phyllosphere	MGRPASPFIGEGKARVTAEEKEKNKRKKKASRIVGSFFL
Ga0182139_11635031	3300015346	Miscanthus Phyllosphere	MERPAFLFIGEGKARITEEEKRRMREREKKAFRIAGSFFSFMRVPLIL*
Ga0182139_11843631	3300015346	Miscanthus Phyllosphere	VGCPASPFIGEGKARVTSEEKEKNEREKKASRIAGSFFSFMRVPLIL*
Ga0182139_11881812	3300015346	Miscanthus Phyllosphere	ALVFPIPSFMGRPTSPFIGEDKAWVTEEKKKNKREKKASRVAGSFFSFIRISSIL*
Ga0182177_10284591	3300015347	Miscanthus Phyllosphere	MGRPAFPFIGQGKAWVTAEENEKNERERKVSRIAGSFFSFM
Ga0182177_11045392	3300015347	Miscanthus Phyllosphere	MGHPASPFIGEGKVWVIEEEKGKNEREKKASRVAESFFSFMWVPPIL*
Ga0182177_11598382	3300015347	Miscanthus Phyllosphere	ASLFIGKGKAQVTVEEKEKNEGENKASRVAGSFFSFMRVSPIQ*
Ga0182177_11777261	3300015347	Miscanthus Phyllosphere	VLLCFDLSSVGRPASPFIGEGKARVIEKEKEKNEREKKASRVVGSFFSFMQVPLIL*
Ga0182177_12182691	3300015347	Miscanthus Phyllosphere	MGCPASPFIGEGKARVIEEEKEKNEREKKASRVAGSFFSFMWVPPIT*
Ga0182177_12339472	3300015347	Miscanthus Phyllosphere	VDLALFMGRHASPFISEGKERVTAEEKEKNKREKKASKIAGSFFSFMGVPPIL*
Ga0182177_12417312	3300015347	Miscanthus Phyllosphere	MGRPASPFIGKGKARDTEVEKEKNKRYKKASRVARSFFSFMQVPPIL*
Ga0182161_11119991	3300015351	Miscanthus Phyllosphere	VGRPASPFIGEGKARVIEEKKEKDEREKNTSGIVASFSFKRDP
Ga0182161_11246701	3300015351	Miscanthus Phyllosphere	VFRSSPFIGRPASPFIDEGKARVTEKEKEKNEREKKASRVAGSFFSFIRVPPIL*
Ga0182161_11439891	3300015351	Miscanthus Phyllosphere	MGCLASPFIGEGKAWVIEEEKEKNEREKKVFRVAGSFFSFKRVPPIL*
Ga0182161_11906531	3300015351	Miscanthus Phyllosphere	VGHPDSPFIGQGKAQVIEEEKKKNEREKKAFRVAGFFFSFMLVPLIL*
Ga0182161_12358982	3300015351	Miscanthus Phyllosphere	MGCYASPFIGEGKTRITEEKMEKNERENASRVVGSFFSFIRDPPIL*
Ga0182161_12666261	3300015351	Miscanthus Phyllosphere	MGCPTSSFIGEGKAWVTTEEKEKNEREKKAYRIVGSFFFFM*
Ga0182159_10450891	3300015355	Miscanthus Phyllosphere	VFISPGVGRPASPFIDTGKARVTEEEKEKNEREKKASRVTGSFFSFMR
Ga0182159_10639482	3300015355	Miscanthus Phyllosphere	SPLSDEGKSWVTEEEKEKNEREKKASRVGGSFFSLMRVPLIL*
Ga0182159_11075282	3300015355	Miscanthus Phyllosphere	MGRPASPFIGEGKAQVTEEENEKNEREKKASRVAGSFFSFMRVPLIL*
Ga0182159_11785921	3300015355	Miscanthus Phyllosphere	MGCHASPFIGEGKARITAEEKEKNEREKKVSRIAGSFFNFMRVSPIL*
Ga0182159_11917531	3300015355	Miscanthus Phyllosphere	AASFIGEGKARVTKEEKEKNERQKKASRVAGSFLSFIRVPPIL*
Ga0182145_10607192	3300015361	Miscanthus Phyllosphere	MGRPASPFIGEEKAQVTAEEMEKNEREKKAYRITRSFFSFMRVSPIL*
Ga0182145_11455471	3300015361	Miscanthus Phyllosphere	MGHPASPFIGEGKARVTEEEKEKNEGEKKASSVAGFFFSFMRVPPIL*
Ga0182145_11549991	3300015361	Miscanthus Phyllosphere	MGRPASPFIGKGKARVIEEENKKNEREKKASRVVGSFFSIMWVLID
Ga0182145_11675521	3300015361	Miscanthus Phyllosphere	MGLPASPFIGEGKARVTEEENEKNEREREKKASRVAGSFFPFMRVPLIL*
Ga0182145_11934261	3300015361	Miscanthus Phyllosphere	MGHPASPFIDEGKAHVTEEENEKNEREKKASSVVGSFFSIMWVPLIL*
Ga0182203_10706351	3300017404	Miscanthus Phyllosphere	MGHPASPFIGEGKAHVIEKEKEKSEREKKASRVVESFFSFMRVLLIL
Ga0182220_10887761	3300017407	Miscanthus Phyllosphere	MGCPASPFIGEGKARVTVEKNEKNEREKASKVAGSFFSFMRVLSTL
Ga0182204_10639932	3300017409	Miscanthus Phyllosphere	MGHLASPFIGEEKARVTVKEKEKNEREKKAFRIVGSFSFMRVPSIL
Ga0182204_10667191	3300017409	Miscanthus Phyllosphere	LMGRPASPFIGEGKARVIEKEKEKNEREKKTFRVVGSFFFFMRVPPIL
Ga0182207_11325681	3300017410	Miscanthus Phyllosphere	MGHPTSPFISEGKARVTVEEKEKNKREKKAFRIIGSFFSFMGVLPIL
Ga0182207_11646011	3300017410	Miscanthus Phyllosphere	MGRPAFSFIGEGRAQVTTEEKEKNQREKKASRIARSFSFMRVLLVL
Ga0182208_10109511	3300017411	Miscanthus Phyllosphere	MGCPASPFIGEGKEWVIEEEKEKNEREKKVFRVAGSFFSFKRVPPIL
Ga0182222_10839261	3300017413	Miscanthus Phyllosphere	MGHRASPFIGEGKARVTTEEEERNERERERNASRVIGSFFSFMQVPPIL
Ga0182202_10703781	3300017415	Miscanthus Phyllosphere	MCLSSVGHPVSPFIDEGKARVIEEEKEKNEREKKASRVVGSFFSFMRVPPIL
Ga0182202_11312461	3300017415	Miscanthus Phyllosphere	MGCPASLFIGEGKARVIAEENEKNEREKKASRIAGSFFSFMRVPLIL
Ga0182230_10592522	3300017417	Miscanthus Phyllosphere	MGRPASPFIGKGKARVTTEEKEKNEREKKASRVAGYFFSFMWVSPIL
Ga0182228_10826641	3300017420	Miscanthus Phyllosphere	MLLCFDPLFMGRPASPFIGEGKARVTEEENEKNEREREKKASRVAGSFFPFMRVPLIL
Ga0182219_10485312	3300017424	Miscanthus Phyllosphere	MGRPASPFIDEGKVRVIEEEKEKTEREKKASRVVGSFFSFMRVPPIL
Ga0182219_10791511	3300017424	Miscanthus Phyllosphere	MGRPASPFIGEGKARVTADEKEKNEREKKAFRIVGSFFSFMRVPPIL
Ga0182219_11130721	3300017424	Miscanthus Phyllosphere	MGCPASPFIGKGKGRVTKEEKEKNEREKKASRVVESFFSFMRVPLIL
Ga0182219_11297762	3300017424	Miscanthus Phyllosphere	MGRPASSFIGEGKARVTAEEKEKNKREKKASRIAGSFFSFVRVPPMQ
Ga0182219_11302741	3300017424	Miscanthus Phyllosphere	MGCSASPFIGEGKARVIEEEDEKNEREKKASRVAESFFSFMRVPPIL
Ga0182224_10719861	3300017425	Miscanthus Phyllosphere	MASLFIGEWKAQVTEEEKEKNEKEEASRAVGSFFSFMRVPPIM
Ga0182224_11093131	3300017425	Miscanthus Phyllosphere	MRHLASPFIGEGKVRVTEEEKEKNEREEKVSRVVRSFFSFISVPPIL
Ga0182224_11359411	3300017425	Miscanthus Phyllosphere	LSIPLLGRPASPFIGEGKAWVTKEEKEKNERENKASRVVGSFFFMRVTL
Ga0182190_10875762	3300017427	Miscanthus Phyllosphere	MGCPASPFIGEGKARVIEEEKEKNEREKKASRVVGSFFSF
Ga0182192_10435331	3300017430	Miscanthus Phyllosphere	MGRSASPFIGKGKVRVTEEEKEKNEREKKASRVAGSFISFMRVPSIL
Ga0182192_10510841	3300017430	Miscanthus Phyllosphere	MGRPAFPFIGQGKALVIVEGKEKEKEKKSSRITGSFSSMRVWATL
Ga0182206_10967572	3300017433	Miscanthus Phyllosphere	MGLPTSPFICEGKAWVIAEEKEKNEIEKKASRIAKSFFSFMRVPLIL
Ga0182206_11231551	3300017433	Miscanthus Phyllosphere	VGHHASPFIGEGKARVTEEEKEKNEGEKKASRVAGSFFSFLQVMLIL
Ga0182209_10735241	3300017436	Miscanthus Phyllosphere	VGRPASSFIGEGKAHVIEEEKEKNKREKKASRIAGSFFSFMRVSLIL
Ga0182209_10858062	3300017436	Miscanthus Phyllosphere	MGRPASPFIGEGKARVTEEEKKKNGREKKASRITWSFFFFMWVSSIL
Ga0182209_11398822	3300017436	Miscanthus Phyllosphere	MGHPASPFIGKGKARVTTEEKEKNKREKKASRVDGSFFSFMRAPPIL
Ga0182209_11687871	3300017436	Miscanthus Phyllosphere	MGCPASPFIGKGKARVIAEEKQKNEREKKASKIAMSFSFIGIPPTL
Ga0182191_10629851	3300017438	Miscanthus Phyllosphere	MGRPTSPFIGKGKAQVTEEEKEKNETEKKASRVAESIFSFMRVPPIL
Ga0182191_11766681	3300017438	Miscanthus Phyllosphere	MRRPAFPFIGKGKALVTEEEKEKNEREKKASRVARSFFSFMRVLLIL
Ga0182221_10685401	3300017442	Miscanthus Phyllosphere	VGRPASPFIGKGKAWVTEEEKEKNEREKKASRFAESFFSFMRVSPIL
Ga0182221_11137602	3300017442	Miscanthus Phyllosphere	SKSTFMGYPASPFIGEKKARVIEETKEKNERGKASRVAGSFFSFLRVLPIL
Ga0182221_11517941	3300017442	Miscanthus Phyllosphere	MGHTASPFIGEWKARVIGEENDKNEREKKASRVVGSFFSFLQVSPIL
Ga0182221_11580511	3300017442	Miscanthus Phyllosphere	MGHLASPFIGEEKAWVTVKEKEKNEREKKAFRIVGSFSFMWVLTIL
Ga0182193_10518942	3300017443	Miscanthus Phyllosphere	MGRLASPFIGEGKARVTVEEKEKNETEKKTSRIARSVFSFMWVPPIL
Ga0182193_10861631	3300017443	Miscanthus Phyllosphere	MGRSASLFIGEGKARVTEEENEKNPREKKASRVAGSFSFMRVSPIL
Ga0182193_10899071	3300017443	Miscanthus Phyllosphere	MGCPAFPFIGKGKARVTTEEKEKNEREKKASRIAGSFFFFMRVPSIL
Ga0182193_11087621	3300017443	Miscanthus Phyllosphere	MGRLASPFICEGKAWVTAEEKEKNETEKKTSRIARSVFSFMWVP
Ga0182193_11346571	3300017443	Miscanthus Phyllosphere	MGRPASPFMDEEKAWVIEEENEKNQREKKVSRAVESFFSFMRVPPIP
Ga0182193_11831082	3300017443	Miscanthus Phyllosphere	PTSPFIGEGKVRVTKEEKEKNKREKNVSRVVRSFFSFIWVPSIL
Ga0182233_10963731	3300017680	Miscanthus Phyllosphere	MRRPASSFIGEGKTRVTEEEKEKNEIEKNAYRVAVSFFSFMRVPSIL
Ga0182226_10528382	3300017681	Miscanthus Phyllosphere	MGHLASPFIGEGKAWVIVEEKEKNERERERERKASRIAGSFFSFMRVPLTL
Ga0182226_10711261	3300017681	Miscanthus Phyllosphere	MGRPASPFIGERKARVIAEEEEKNEREKKASRIAGSFFSFMVVPPIL
Ga0182226_10997982	3300017681	Miscanthus Phyllosphere	MGRLASPFIGEGKVWVIDEEKEKNEREKKASRVVGSFFSFIRVSPIM
Ga0182229_10696702	3300017682	Miscanthus Phyllosphere	MGRPASPFIGEERAWVTEEEKEKNEREKKASRFAWSFFSF
Ga0182218_10174972	3300017683	Miscanthus Phyllosphere	MGRPASPFIGEGKAWVIEEEKEKNKREKKASRVAGSSFSFMKVPLIL
Ga0182218_10622042	3300017683	Miscanthus Phyllosphere	MGRPTSPFIGEGKARVTKEEKEKNEREKKASRVVGSFFSFMRVPLIL
Ga0182218_10998601	3300017683	Miscanthus Phyllosphere	MRRFASPFIGEGKARVTEKEKEKNERDKKASRVAESFSSFMRVPLIL
Ga0182218_11345872	3300017683	Miscanthus Phyllosphere	MGHPASPFIGEGKAWVKEEEKEKNEKEKKASRVARSFFNFMRAPPIL
Ga0182225_10314911	3300017684	Miscanthus Phyllosphere	MGRPAFPFIGKGKARVTVEEKEKNEREKKASRVVGSFFSFMRVPLIL
Ga0182225_10734771	3300017684	Miscanthus Phyllosphere	VFRSPLYGRPASPFIDEGKARVTEEEKEKNKREKKTSRVTESFFSFMRVPLIL
Ga0182225_11289061	3300017684	Miscanthus Phyllosphere	MGRPASSFIGEGKTWVTEEEKEKNKREKKASRVARSFSFVQVPPIL
Ga0182205_10538002	3300017686	Miscanthus Phyllosphere	MGRHASHFIGEGKARVTEEENEKNEIEKKASRVVGSFFSFMRVPPIL
Ga0182205_10946312	3300017686	Miscanthus Phyllosphere	VGRPASPFIGEGKTWVTDEEKEKNEREKKASRVAGSFFSFMRVLLIQ
Ga0182205_11042991	3300017686	Miscanthus Phyllosphere	MGCPTSPFIDQGKAGVIVEGKEENEKEKKSCRIAGSFFFFMRVQPIL
Ga0182205_11620911	3300017686	Miscanthus Phyllosphere	MGHPTSPFIGKGKARVIEEEKEKNEREKKASRVAGSFFSYIQVLLIL
Ga0182231_11046781	3300017689	Miscanthus Phyllosphere	MGCPASPFIGEGKARVIEEEKEKNEREKKASRVVGSFFSFMQVPLIL
Ga0182231_11140801	3300017689	Miscanthus Phyllosphere	MLLCFDYPSVGRTASPFIGEWKVRVTEEEKKKNKREKKASRVPGSFFSFMRVPLIL

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.51
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.51
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F016094

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign