Basic Information | |
---|---|
Family ID | F016188 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 249 |
Average Sequence Length | 42 residues |
Representative Sequence | VLSTVAASGDQAIAFVILASIVIPLAALGWVCWFFWKHRHDE |
Number of Associated Samples | 184 |
Number of Associated Scaffolds | 249 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 42.97 % |
% of genes near scaffold ends (potentially truncated) | 23.29 % |
% of genes from short scaffolds (< 2000 bps) | 83.94 % |
Associated GOLD sequencing projects | 172 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.57 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (77.510 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (20.080 % of family members) |
Environment Ontology (ENVO) | Unclassified (30.924 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (59.036 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 51.43% β-sheet: 0.00% Coil/Unstructured: 48.57% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.57 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 249 Family Scaffolds |
---|---|---|
PF07969 | Amidohydro_3 | 5.22 |
PF07690 | MFS_1 | 4.02 |
PF03640 | Lipoprotein_15 | 3.61 |
PF13419 | HAD_2 | 3.21 |
PF00583 | Acetyltransf_1 | 2.81 |
PF03069 | FmdA_AmdA | 2.81 |
PF00188 | CAP | 2.41 |
PF01638 | HxlR | 2.41 |
PF04191 | PEMT | 2.41 |
PF01479 | S4 | 1.61 |
PF07883 | Cupin_2 | 1.61 |
PF03734 | YkuD | 1.61 |
PF00756 | Esterase | 1.20 |
PF13493 | DUF4118 | 1.20 |
PF00072 | Response_reg | 1.20 |
PF01386 | Ribosomal_L25p | 1.20 |
PF06224 | HTH_42 | 0.80 |
PF05378 | Hydant_A_N | 0.80 |
PF00392 | GntR | 0.80 |
PF08327 | AHSA1 | 0.80 |
PF08281 | Sigma70_r4_2 | 0.80 |
PF00042 | Globin | 0.80 |
PF01402 | RHH_1 | 0.80 |
PF12730 | ABC2_membrane_4 | 0.80 |
PF13302 | Acetyltransf_3 | 0.80 |
PF04828 | GFA | 0.80 |
PF00574 | CLP_protease | 0.80 |
PF14693 | Ribosomal_TL5_C | 0.80 |
PF03459 | TOBE | 0.80 |
PF03992 | ABM | 0.80 |
PF04140 | ICMT | 0.80 |
PF02824 | TGS | 0.80 |
PF01613 | Flavin_Reduct | 0.80 |
PF03795 | YCII | 0.40 |
PF09852 | DUF2079 | 0.40 |
PF01636 | APH | 0.40 |
PF00211 | Guanylate_cyc | 0.40 |
PF01471 | PG_binding_1 | 0.40 |
PF13668 | Ferritin_2 | 0.40 |
PF13673 | Acetyltransf_10 | 0.40 |
PF12681 | Glyoxalase_2 | 0.40 |
PF02403 | Seryl_tRNA_N | 0.40 |
PF02518 | HATPase_c | 0.40 |
PF01266 | DAO | 0.40 |
PF01797 | Y1_Tnp | 0.40 |
PF00561 | Abhydrolase_1 | 0.40 |
PF13474 | SnoaL_3 | 0.40 |
PF02621 | VitK2_biosynth | 0.40 |
PF04542 | Sigma70_r2 | 0.40 |
PF01957 | NfeD | 0.40 |
PF01926 | MMR_HSR1 | 0.40 |
PF14472 | DUF4429 | 0.40 |
PF00324 | AA_permease | 0.40 |
PF14020 | DUF4236 | 0.40 |
PF13683 | rve_3 | 0.40 |
PF12697 | Abhydrolase_6 | 0.40 |
PF03006 | HlyIII | 0.40 |
PF00730 | HhH-GPD | 0.40 |
PF13616 | Rotamase_3 | 0.40 |
PF06525 | SoxE | 0.40 |
PF00903 | Glyoxalase | 0.40 |
PF01546 | Peptidase_M20 | 0.40 |
PF00909 | Ammonium_transp | 0.40 |
PF02557 | VanY | 0.40 |
PF01566 | Nramp | 0.40 |
PF01883 | FeS_assembly_P | 0.40 |
PF02362 | B3 | 0.40 |
PF00109 | ketoacyl-synt | 0.40 |
PF13424 | TPR_12 | 0.40 |
PF00753 | Lactamase_B | 0.40 |
PF13407 | Peripla_BP_4 | 0.40 |
PF16350 | FAO_M | 0.40 |
PF03691 | UPF0167 | 0.40 |
PF00892 | EamA | 0.40 |
PF00389 | 2-Hacid_dh | 0.40 |
PF09413 | DUF2007 | 0.40 |
PF00877 | NLPC_P60 | 0.40 |
PF00296 | Bac_luciferase | 0.40 |
PF07676 | PD40 | 0.40 |
PF10066 | DUF2304 | 0.40 |
PF13240 | zinc_ribbon_2 | 0.40 |
PF07366 | SnoaL | 0.40 |
COG ID | Name | Functional Category | % Frequency in 249 Family Scaffolds |
---|---|---|---|
COG4315 | Predicted lipoprotein with conserved Yx(FWY)xxD motif (function unknown) | Function unknown [S] | 3.61 |
COG2421 | Acetamidase/formamidase | Energy production and conversion [C] | 2.81 |
COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 2.41 |
COG2340 | Spore germination protein YkwD and related proteins with CAP (CSP/antigen 5/PR1) domain | Cell cycle control, cell division, chromosome partitioning [D] | 2.41 |
COG0145 | N-methylhydantoinase A/oxoprolinase/acetone carboxylase, beta subunit | Amino acid transport and metabolism [E] | 1.61 |
COG0616 | Periplasmic serine protease, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 1.61 |
COG0740 | ATP-dependent protease ClpP, protease subunit | Posttranslational modification, protein turnover, chaperones [O] | 1.61 |
COG1376 | Lipoprotein-anchoring transpeptidase ErfK/SrfK | Cell wall/membrane/envelope biogenesis [M] | 1.61 |
COG3034 | Murein L,D-transpeptidase YafK | Cell wall/membrane/envelope biogenesis [M] | 1.61 |
COG1825 | Ribosomal protein L25 (general stress protein Ctc) | Translation, ribosomal structure and biogenesis [J] | 1.20 |
COG1017 | Hemoglobin-like flavoprotein | Energy production and conversion [C] | 0.80 |
COG1030 | Membrane-bound serine protease NfeD, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 0.80 |
COG1853 | FMN reductase RutF, DIM6/NTAB family | Energy production and conversion [C] | 0.80 |
COG3214 | DNA glycosylase YcaQ, repair of DNA interstrand crosslinks | Replication, recombination and repair [L] | 0.80 |
COG3791 | Uncharacterized conserved protein | Function unknown [S] | 0.80 |
COG0004 | Ammonia channel protein AmtB | Inorganic ion transport and metabolism [P] | 0.40 |
COG0122 | 3-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 0.40 |
COG0172 | Seryl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.40 |
COG0177 | Endonuclease III | Replication, recombination and repair [L] | 0.40 |
COG0531 | Serine transporter YbeC, amino acid:H+ symporter family | Amino acid transport and metabolism [E] | 0.40 |
COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.40 |
COG0791 | Cell wall-associated hydrolase, NlpC_P60 family | Cell wall/membrane/envelope biogenesis [M] | 0.40 |
COG0833 | Amino acid permease | Amino acid transport and metabolism [E] | 0.40 |
COG1059 | Thermostable 8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 0.40 |
COG1113 | L-asparagine transporter or related permease | Amino acid transport and metabolism [E] | 0.40 |
COG1115 | Na+/alanine symporter | Amino acid transport and metabolism [E] | 0.40 |
COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.40 |
COG1194 | Adenine-specific DNA glycosylase, acts on AG and A-oxoG pairs | Replication, recombination and repair [L] | 0.40 |
COG1272 | Predicted membrane channel-forming protein YqfA, hemolysin III family | Intracellular trafficking, secretion, and vesicular transport [U] | 0.40 |
COG1427 | Chorismate dehydratase (menaquinone biosynthesis, futalosine pathway) | Coenzyme transport and metabolism [H] | 0.40 |
COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.40 |
COG1876 | LD-carboxypeptidase LdcB, LAS superfamily | Cell wall/membrane/envelope biogenesis [M] | 0.40 |
COG1914 | Mn2+ or Fe2+ transporter, NRAMP family | Inorganic ion transport and metabolism [P] | 0.40 |
COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 0.40 |
COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.40 |
COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.40 |
COG2173 | D-alanyl-D-alanine dipeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.40 |
COG2231 | 3-Methyladenine DNA glycosylase, HhH-GPD/Endo3 superfamily | Replication, recombination and repair [L] | 0.40 |
COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.40 |
COG3196 | Colicin E2 tolerance protein CbrC, UPF0167 family | General function prediction only [R] | 0.40 |
COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.40 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 77.51 % |
Unclassified | root | N/A | 22.49 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2170459015|G14TP7Y02JIWTM | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
2170459018|G1P06HT02G9JD1 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 562 | Open in IMG/M |
2209111006|2214941612 | Not Available | 539 | Open in IMG/M |
3300000156|NODE_c0744245 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 19143 | Open in IMG/M |
3300000956|JGI10216J12902_106252666 | Not Available | 828 | Open in IMG/M |
3300000956|JGI10216J12902_109333402 | All Organisms → cellular organisms → Bacteria | 1041 | Open in IMG/M |
3300000956|JGI10216J12902_123057468 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 610 | Open in IMG/M |
3300001205|C688J13580_1022742 | Not Available | 765 | Open in IMG/M |
3300001333|A21PFW6_1106785 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1191 | Open in IMG/M |
3300001334|A2165W6_1033157 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 620 | Open in IMG/M |
3300001664|P5cmW16_1081858 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 508 | Open in IMG/M |
3300004156|Ga0062589_102268389 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 557 | Open in IMG/M |
3300004157|Ga0062590_100208259 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1422 | Open in IMG/M |
3300004479|Ga0062595_100014708 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2738 | Open in IMG/M |
3300004479|Ga0062595_100345151 | All Organisms → cellular organisms → Bacteria | 1033 | Open in IMG/M |
3300005093|Ga0062594_102407590 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 575 | Open in IMG/M |
3300005167|Ga0066672_10045999 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2479 | Open in IMG/M |
3300005167|Ga0066672_10137351 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1524 | Open in IMG/M |
3300005171|Ga0066677_10102374 | Not Available | 1518 | Open in IMG/M |
3300005171|Ga0066677_10376998 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 812 | Open in IMG/M |
3300005172|Ga0066683_10759607 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 568 | Open in IMG/M |
3300005172|Ga0066683_10906502 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → unclassified Chromatiales → Chromatiales bacterium (ex Bugula neritina AB1) | 505 | Open in IMG/M |
3300005174|Ga0066680_10660361 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 647 | Open in IMG/M |
3300005176|Ga0066679_10012149 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. URHD0082 | 4307 | Open in IMG/M |
3300005177|Ga0066690_10002467 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 7602 | Open in IMG/M |
3300005177|Ga0066690_10357102 | Not Available | 991 | Open in IMG/M |
3300005178|Ga0066688_10259666 | All Organisms → cellular organisms → Bacteria | 1114 | Open in IMG/M |
3300005179|Ga0066684_10011399 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4321 | Open in IMG/M |
3300005179|Ga0066684_10030808 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 2917 | Open in IMG/M |
3300005179|Ga0066684_10036611 | All Organisms → cellular organisms → Bacteria | 2722 | Open in IMG/M |
3300005181|Ga0066678_10503913 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 805 | Open in IMG/M |
3300005181|Ga0066678_10703357 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 673 | Open in IMG/M |
3300005184|Ga0066671_10001650 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 7364 | Open in IMG/M |
3300005184|Ga0066671_10081173 | All Organisms → cellular organisms → Bacteria | 1746 | Open in IMG/M |
3300005184|Ga0066671_10460934 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 815 | Open in IMG/M |
3300005332|Ga0066388_100951312 | Not Available | 1430 | Open in IMG/M |
3300005332|Ga0066388_103707290 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 780 | Open in IMG/M |
3300005332|Ga0066388_105120212 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
3300005336|Ga0070680_100979475 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 730 | Open in IMG/M |
3300005337|Ga0070682_100005025 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 7351 | Open in IMG/M |
3300005341|Ga0070691_10130174 | All Organisms → cellular organisms → Bacteria | 1275 | Open in IMG/M |
3300005355|Ga0070671_100257522 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1483 | Open in IMG/M |
3300005434|Ga0070709_10333004 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1117 | Open in IMG/M |
3300005434|Ga0070709_10838652 | Not Available | 723 | Open in IMG/M |
3300005434|Ga0070709_11057035 | Not Available | 648 | Open in IMG/M |
3300005436|Ga0070713_100278552 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1534 | Open in IMG/M |
3300005436|Ga0070713_100304711 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1467 | Open in IMG/M |
3300005439|Ga0070711_100048544 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2904 | Open in IMG/M |
3300005439|Ga0070711_100124697 | All Organisms → cellular organisms → Bacteria | 1910 | Open in IMG/M |
3300005440|Ga0070705_100227791 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1294 | Open in IMG/M |
3300005444|Ga0070694_101712043 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 535 | Open in IMG/M |
3300005445|Ga0070708_100010241 | All Organisms → cellular organisms → Bacteria | 7590 | Open in IMG/M |
3300005451|Ga0066681_10972721 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 507 | Open in IMG/M |
3300005454|Ga0066687_10024908 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2569 | Open in IMG/M |
3300005458|Ga0070681_10325482 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1447 | Open in IMG/M |
3300005459|Ga0068867_101946933 | Not Available | 555 | Open in IMG/M |
3300005467|Ga0070706_100306356 | All Organisms → cellular organisms → Bacteria | 1482 | Open in IMG/M |
3300005529|Ga0070741_10073490 | All Organisms → cellular organisms → Bacteria | 3830 | Open in IMG/M |
3300005529|Ga0070741_10852732 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
3300005540|Ga0066697_10471761 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 718 | Open in IMG/M |
3300005542|Ga0070732_10400752 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 828 | Open in IMG/M |
3300005552|Ga0066701_10028700 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. URHD0082 | 2868 | Open in IMG/M |
3300005552|Ga0066701_10155134 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1381 | Open in IMG/M |
3300005553|Ga0066695_10484947 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 761 | Open in IMG/M |
3300005555|Ga0066692_10898310 | Not Available | 543 | Open in IMG/M |
3300005560|Ga0066670_10737678 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 597 | Open in IMG/M |
3300005561|Ga0066699_10403792 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 978 | Open in IMG/M |
3300005568|Ga0066703_10675386 | Not Available | 596 | Open in IMG/M |
3300005569|Ga0066705_10347268 | All Organisms → cellular organisms → Bacteria | 936 | Open in IMG/M |
3300005576|Ga0066708_10161359 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1384 | Open in IMG/M |
3300005576|Ga0066708_10459639 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 818 | Open in IMG/M |
3300005586|Ga0066691_10485033 | Not Available | 739 | Open in IMG/M |
3300005587|Ga0066654_10040388 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2006 | Open in IMG/M |
3300005764|Ga0066903_100205278 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2957 | Open in IMG/M |
3300005764|Ga0066903_100308672 | Not Available | 2512 | Open in IMG/M |
3300005764|Ga0066903_100398211 | All Organisms → cellular organisms → Bacteria | 2263 | Open in IMG/M |
3300005983|Ga0081540_1351619 | Not Available | 504 | Open in IMG/M |
3300006028|Ga0070717_10292039 | All Organisms → cellular organisms → Bacteria | 1448 | Open in IMG/M |
3300006031|Ga0066651_10289543 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 873 | Open in IMG/M |
3300006032|Ga0066696_10889776 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 567 | Open in IMG/M |
3300006046|Ga0066652_100503115 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1126 | Open in IMG/M |
3300006046|Ga0066652_100626494 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1017 | Open in IMG/M |
3300006173|Ga0070716_100766913 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 744 | Open in IMG/M |
3300006581|Ga0074048_10036583 | All Organisms → cellular organisms → Bacteria | 1008 | Open in IMG/M |
3300006755|Ga0079222_10101687 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1512 | Open in IMG/M |
3300006791|Ga0066653_10427414 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 677 | Open in IMG/M |
3300006794|Ga0066658_10601409 | Not Available | 599 | Open in IMG/M |
3300006854|Ga0075425_101632929 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 726 | Open in IMG/M |
3300006954|Ga0079219_10034814 | All Organisms → cellular organisms → Bacteria | 2030 | Open in IMG/M |
3300007258|Ga0099793_10555774 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 573 | Open in IMG/M |
3300009012|Ga0066710_101483588 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1047 | Open in IMG/M |
3300009012|Ga0066710_103773743 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 569 | Open in IMG/M |
3300009012|Ga0066710_103842710 | Not Available | 563 | Open in IMG/M |
3300009088|Ga0099830_10280801 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1325 | Open in IMG/M |
3300009090|Ga0099827_10013594 | All Organisms → cellular organisms → Bacteria | 5382 | Open in IMG/M |
3300009090|Ga0099827_10435960 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1122 | Open in IMG/M |
3300009098|Ga0105245_10028846 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4898 | Open in IMG/M |
3300009137|Ga0066709_100341804 | All Organisms → cellular organisms → Bacteria | 2052 | Open in IMG/M |
3300009137|Ga0066709_100851892 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1325 | Open in IMG/M |
3300009137|Ga0066709_101953037 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 815 | Open in IMG/M |
3300009137|Ga0066709_103393119 | Not Available | 579 | Open in IMG/M |
3300009137|Ga0066709_103861916 | Not Available | 544 | Open in IMG/M |
3300009137|Ga0066709_104439039 | Not Available | 512 | Open in IMG/M |
3300009137|Ga0066709_104451007 | Not Available | 512 | Open in IMG/M |
3300009137|Ga0066709_104478153 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 510 | Open in IMG/M |
3300009137|Ga0066709_104527728 | Not Available | 508 | Open in IMG/M |
3300010326|Ga0134065_10492033 | Not Available | 509 | Open in IMG/M |
3300010360|Ga0126372_13003133 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 523 | Open in IMG/M |
3300010366|Ga0126379_10654446 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1141 | Open in IMG/M |
3300010373|Ga0134128_12950908 | Not Available | 523 | Open in IMG/M |
3300010396|Ga0134126_10759316 | Not Available | 1098 | Open in IMG/M |
3300010396|Ga0134126_12389082 | Not Available | 575 | Open in IMG/M |
3300011003|Ga0138514_100000736 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3740 | Open in IMG/M |
3300011003|Ga0138514_100103021 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 620 | Open in IMG/M |
3300011994|Ga0120157_1055378 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 842 | Open in IMG/M |
3300011996|Ga0120156_1026893 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1075 | Open in IMG/M |
3300012011|Ga0120152_1159922 | Not Available | 590 | Open in IMG/M |
3300012014|Ga0120159_1037092 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1631 | Open in IMG/M |
3300012096|Ga0137389_11756146 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 516 | Open in IMG/M |
3300012198|Ga0137364_10059541 | All Organisms → cellular organisms → Bacteria | 2575 | Open in IMG/M |
3300012198|Ga0137364_10317984 | All Organisms → cellular organisms → Bacteria | 1158 | Open in IMG/M |
3300012199|Ga0137383_10924005 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 637 | Open in IMG/M |
3300012200|Ga0137382_10085306 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. | 2056 | Open in IMG/M |
3300012200|Ga0137382_10757031 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 698 | Open in IMG/M |
3300012201|Ga0137365_10196475 | All Organisms → cellular organisms → Bacteria | 1509 | Open in IMG/M |
3300012202|Ga0137363_11806199 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
3300012206|Ga0137380_11158845 | Not Available | 657 | Open in IMG/M |
3300012206|Ga0137380_11309858 | Not Available | 609 | Open in IMG/M |
3300012207|Ga0137381_10881606 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 774 | Open in IMG/M |
3300012208|Ga0137376_10213683 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1670 | Open in IMG/M |
3300012209|Ga0137379_10801246 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 847 | Open in IMG/M |
3300012209|Ga0137379_11189633 | Not Available | 669 | Open in IMG/M |
3300012211|Ga0137377_10994733 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 770 | Open in IMG/M |
3300012211|Ga0137377_11533843 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 592 | Open in IMG/M |
3300012349|Ga0137387_11070214 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 576 | Open in IMG/M |
3300012350|Ga0137372_10323016 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1190 | Open in IMG/M |
3300012350|Ga0137372_11052553 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 563 | Open in IMG/M |
3300012356|Ga0137371_10502064 | All Organisms → cellular organisms → Bacteria | 936 | Open in IMG/M |
3300012356|Ga0137371_11172414 | Not Available | 574 | Open in IMG/M |
3300012362|Ga0137361_10977187 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 766 | Open in IMG/M |
3300012469|Ga0150984_110261860 | Not Available | 1131 | Open in IMG/M |
3300012507|Ga0157342_1014909 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 846 | Open in IMG/M |
3300012582|Ga0137358_10982586 | Not Available | 547 | Open in IMG/M |
3300012917|Ga0137395_10161705 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1539 | Open in IMG/M |
3300012929|Ga0137404_11662263 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
3300012955|Ga0164298_10615806 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 748 | Open in IMG/M |
3300012955|Ga0164298_10762867 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 687 | Open in IMG/M |
3300012958|Ga0164299_10055573 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1874 | Open in IMG/M |
3300012960|Ga0164301_10060370 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2003 | Open in IMG/M |
3300012960|Ga0164301_10222221 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1220 | Open in IMG/M |
3300012976|Ga0134076_10515860 | Not Available | 548 | Open in IMG/M |
3300012985|Ga0164308_10192387 | Not Available | 1548 | Open in IMG/M |
3300012985|Ga0164308_10503774 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Phycicoccus → unclassified Phycicoccus → Phycicoccus sp. Soil748 | 1013 | Open in IMG/M |
3300012989|Ga0164305_11140583 | Not Available | 672 | Open in IMG/M |
3300013758|Ga0120147_1062682 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 641 | Open in IMG/M |
3300013764|Ga0120111_1078707 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 792 | Open in IMG/M |
3300013770|Ga0120123_1021579 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1300 | Open in IMG/M |
3300013772|Ga0120158_10195182 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1064 | Open in IMG/M |
3300013772|Ga0120158_10347500 | Not Available | 699 | Open in IMG/M |
3300014326|Ga0157380_12790709 | Not Available | 555 | Open in IMG/M |
3300014487|Ga0182000_10116256 | Not Available | 921 | Open in IMG/M |
3300014829|Ga0120104_1064185 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 705 | Open in IMG/M |
3300015357|Ga0134072_10154507 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 758 | Open in IMG/M |
3300015357|Ga0134072_10167776 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 736 | Open in IMG/M |
3300015371|Ga0132258_13845262 | All Organisms → cellular organisms → Bacteria | 1022 | Open in IMG/M |
3300015372|Ga0132256_100008153 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 9003 | Open in IMG/M |
3300015372|Ga0132256_100074677 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3224 | Open in IMG/M |
3300015372|Ga0132256_101022906 | Not Available | 941 | Open in IMG/M |
3300015374|Ga0132255_100609897 | All Organisms → cellular organisms → Bacteria | 1614 | Open in IMG/M |
3300017959|Ga0187779_10011840 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4978 | Open in IMG/M |
3300017966|Ga0187776_10026010 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3226 | Open in IMG/M |
3300017974|Ga0187777_10008229 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 6595 | Open in IMG/M |
3300018028|Ga0184608_10025600 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2183 | Open in IMG/M |
3300018060|Ga0187765_10718033 | Not Available | 658 | Open in IMG/M |
3300018073|Ga0184624_10439408 | Not Available | 574 | Open in IMG/M |
3300018081|Ga0184625_10159346 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1180 | Open in IMG/M |
3300018431|Ga0066655_10206000 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1220 | Open in IMG/M |
3300018431|Ga0066655_10371344 | Not Available | 941 | Open in IMG/M |
3300018431|Ga0066655_10672982 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 700 | Open in IMG/M |
3300018433|Ga0066667_10098008 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1942 | Open in IMG/M |
3300018433|Ga0066667_10199444 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1469 | Open in IMG/M |
3300018433|Ga0066667_10327793 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1205 | Open in IMG/M |
3300018468|Ga0066662_10005974 | All Organisms → cellular organisms → Bacteria | 6016 | Open in IMG/M |
3300018468|Ga0066662_11543076 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 692 | Open in IMG/M |
3300018468|Ga0066662_11594199 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 681 | Open in IMG/M |
3300018468|Ga0066662_12201172 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 578 | Open in IMG/M |
3300018468|Ga0066662_12741690 | Not Available | 522 | Open in IMG/M |
3300018482|Ga0066669_10552815 | Not Available | 1003 | Open in IMG/M |
3300018482|Ga0066669_11325013 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 652 | Open in IMG/M |
3300019255|Ga0184643_1378759 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 839 | Open in IMG/M |
3300019887|Ga0193729_1017537 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 3137 | Open in IMG/M |
3300019888|Ga0193751_1080328 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1304 | Open in IMG/M |
3300019888|Ga0193751_1199614 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 671 | Open in IMG/M |
3300020006|Ga0193735_1103498 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 791 | Open in IMG/M |
3300022534|Ga0224452_1055360 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1182 | Open in IMG/M |
3300022694|Ga0222623_10402666 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Microbacterium | 520 | Open in IMG/M |
3300022756|Ga0222622_10422399 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 942 | Open in IMG/M |
3300024182|Ga0247669_1014556 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1398 | Open in IMG/M |
3300024186|Ga0247688_1034991 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 777 | Open in IMG/M |
3300024232|Ga0247664_1105597 | Not Available | 654 | Open in IMG/M |
3300024245|Ga0247677_1035469 | Not Available | 721 | Open in IMG/M |
3300025898|Ga0207692_10515712 | Not Available | 760 | Open in IMG/M |
3300025903|Ga0207680_11207347 | Not Available | 539 | Open in IMG/M |
3300025906|Ga0207699_11098418 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 589 | Open in IMG/M |
3300025906|Ga0207699_11147345 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 575 | Open in IMG/M |
3300025910|Ga0207684_10537327 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1001 | Open in IMG/M |
3300025911|Ga0207654_10679536 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 739 | Open in IMG/M |
3300025915|Ga0207693_10362466 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1134 | Open in IMG/M |
3300025916|Ga0207663_10307012 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1188 | Open in IMG/M |
3300025916|Ga0207663_10764110 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 768 | Open in IMG/M |
3300025922|Ga0207646_10091108 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2729 | Open in IMG/M |
3300025927|Ga0207687_10637948 | Not Available | 900 | Open in IMG/M |
3300025930|Ga0207701_11421599 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
3300025933|Ga0207706_10261634 | All Organisms → cellular organisms → Bacteria | 1510 | Open in IMG/M |
3300025937|Ga0207669_10748259 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 807 | Open in IMG/M |
3300025938|Ga0207704_11097051 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Microbacterium | 676 | Open in IMG/M |
3300026067|Ga0207678_10067356 | All Organisms → cellular organisms → Bacteria | 3074 | Open in IMG/M |
3300026312|Ga0209153_1001341 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 8598 | Open in IMG/M |
3300026325|Ga0209152_10505329 | Not Available | 500 | Open in IMG/M |
3300026330|Ga0209473_1052289 | All Organisms → cellular organisms → Bacteria | 1779 | Open in IMG/M |
3300026524|Ga0209690_1154703 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 833 | Open in IMG/M |
3300026538|Ga0209056_10308608 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1082 | Open in IMG/M |
3300026548|Ga0209161_10427141 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 582 | Open in IMG/M |
3300026552|Ga0209577_10243446 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1360 | Open in IMG/M |
3300026552|Ga0209577_10250935 | Not Available | 1335 | Open in IMG/M |
3300026552|Ga0209577_10761771 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 542 | Open in IMG/M |
3300026899|Ga0209326_1019471 | Not Available | 540 | Open in IMG/M |
3300027560|Ga0207981_1031488 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 963 | Open in IMG/M |
3300027725|Ga0209178_1327056 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 569 | Open in IMG/M |
3300027842|Ga0209580_10432142 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 656 | Open in IMG/M |
3300027882|Ga0209590_10007777 | All Organisms → cellular organisms → Bacteria | 4835 | Open in IMG/M |
3300028704|Ga0307321_1023111 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1103 | Open in IMG/M |
3300028717|Ga0307298_10059082 | All Organisms → cellular organisms → Bacteria | 1058 | Open in IMG/M |
3300028755|Ga0307316_10223929 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
3300028787|Ga0307323_10332411 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 545 | Open in IMG/M |
3300028807|Ga0307305_10073142 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1582 | Open in IMG/M |
3300028819|Ga0307296_10366866 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 786 | Open in IMG/M |
3300028878|Ga0307278_10038504 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2178 | Open in IMG/M |
3300028884|Ga0307308_10493241 | Not Available | 587 | Open in IMG/M |
3300031562|Ga0310886_10809091 | Not Available | 590 | Open in IMG/M |
3300031720|Ga0307469_12502934 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 504 | Open in IMG/M |
3300031944|Ga0310884_10053586 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1819 | Open in IMG/M |
3300032013|Ga0310906_10542664 | Not Available | 793 | Open in IMG/M |
3300032075|Ga0310890_11540167 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 549 | Open in IMG/M |
3300032180|Ga0307471_101918747 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 741 | Open in IMG/M |
3300032205|Ga0307472_101065296 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 762 | Open in IMG/M |
3300032770|Ga0335085_10878171 | Not Available | 979 | Open in IMG/M |
3300033500|Ga0326730_1075762 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 632 | Open in IMG/M |
3300034820|Ga0373959_0027420 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1132 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 20.08% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 12.05% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 10.04% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 8.84% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.03% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 5.22% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.41% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.01% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.61% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.61% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.61% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.61% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.61% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.20% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.20% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.20% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.20% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.20% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.20% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.20% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.20% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.20% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.20% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.80% |
Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.80% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.80% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.80% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.80% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.80% |
Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.80% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.40% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.40% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.40% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.40% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.40% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.40% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.40% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.40% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.40% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.40% |
Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.40% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.40% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.40% |
Sugar Cane Bagasse Incubating Bioreactor | Engineered → Solid Waste → Grass → Composting → Bioreactor → Sugar Cane Bagasse Incubating Bioreactor | 0.40% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459015 | Litter degradation PV4 | Engineered | Open in IMG/M |
2170459018 | Litter degradation MG2 | Engineered | Open in IMG/M |
2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 | Host-Associated | Open in IMG/M |
3300000156 | Sugar cane bagasse incubating bioreactor microbial communities from Sao Carlos, Brazil, that are aerobic and semianaerobic | Engineered | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300001205 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300001333 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A21-PF)- 6 month illumina | Environmental | Open in IMG/M |
3300001334 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A21-65cm)- 6 month illumina | Environmental | Open in IMG/M |
3300001664 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - 5cm_reassembled | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006581 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300011003 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015 | Environmental | Open in IMG/M |
3300011994 | Permafrost microbial communities from Nunavut, Canada - A7_65cm_12M | Environmental | Open in IMG/M |
3300011996 | Permafrost microbial communities from Nunavut, Canada - A39_65cm_12M | Environmental | Open in IMG/M |
3300012011 | Permafrost microbial communities from Nunavut, Canada - A30_65cm_6M | Environmental | Open in IMG/M |
3300012014 | Permafrost microbial communities from Nunavut, Canada - A10_80cm_6M | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Host-Associated | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013758 | Permafrost microbial communities from Nunavut, Canada - A24_65cm_12M | Environmental | Open in IMG/M |
3300013764 | Permafrost microbial communities from Nunavut, Canada - A28_35cm_6M | Environmental | Open in IMG/M |
3300013770 | Permafrost microbial communities from Nunavut, Canada - A15_5cm_18M | Environmental | Open in IMG/M |
3300013772 | Permafrost microbial communities from Nunavut, Canada - A10_80_0.25M | Environmental | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300014487 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG | Environmental | Open in IMG/M |
3300014829 | Permafrost microbial communities from Nunavut, Canada - A10_35cm_6M | Environmental | Open in IMG/M |
3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019255 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
3300020006 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2 | Environmental | Open in IMG/M |
3300022534 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1 | Environmental | Open in IMG/M |
3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
3300024182 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK10 | Environmental | Open in IMG/M |
3300024186 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK29 | Environmental | Open in IMG/M |
3300024232 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK05 | Environmental | Open in IMG/M |
3300024245 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK18 | Environmental | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
3300026899 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_O3 (SPAdes) | Environmental | Open in IMG/M |
3300027560 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPC (SPAdes) | Environmental | Open in IMG/M |
3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300028704 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_379 | Environmental | Open in IMG/M |
3300028717 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158 | Environmental | Open in IMG/M |
3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300033500 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF7AN SIP fraction | Environmental | Open in IMG/M |
3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
4PV_04454780 | 2170459015 | Switchgrass, Maize And Mischanthus Litter | VIVAASGDGAMTAVILASIVVPLVVVGWLCWFFWKHRHDE |
2MG_00078360 | 2170459018 | Switchgrass, Maize And Mischanthus Litter | LLDLVRQAALDVLAATGDQAIALVIVASIVIPLAILTALCWYFWKH |
2214005315 | 2209111006 | Arabidopsis Rhizosphere | VLSLLAARGDQATALVVLASIVIPLTVLGGVCWYFWRHRHDE |
NODE_074424514 | 3300000156 | Sugar Cane Bagasse Incubating Bioreactor | VLAAQGDNAIAAVIVVSIVVPLAAVGWLCWFFWKHRHDE* |
JGI10216J12902_1062526662 | 3300000956 | Soil | LQRTGHDFPVEVFATGDQATSFVILGSIIIPLAILTALCWFFWKHRHDE* |
JGI10216J12902_1093334022 | 3300000956 | Soil | MSVVAASGDEAIAVVIIASIVVPLGALGWLCWFFWKHRHDQ* |
JGI10216J12902_1230574682 | 3300000956 | Soil | MSLLAAQGDQAIAVVIVASIVVPLGALGWLCWFFWKHRHDE* |
C688J13580_10227421 | 3300001205 | Soil | VSSLVVAAGDGAVVVILASIVVPMVALAGLCWVFWKHRHDE* |
A21PFW6_11067852 | 3300001333 | Permafrost | MVDMLAANGDQATAFIILGSIVVPLALLAVVCWFFWAHRHDD* |
A2165W6_10331572 | 3300001334 | Permafrost | VDQATALVILASIVIPVAILIVVCWFFWRHRHDD* |
P5cmW16_10818582 | 3300001664 | Permafrost | VDQATALVILASIVVPVAILIFVCWFFWKHRHDE* |
Ga0062589_1022683892 | 3300004156 | Soil | MLVSAAGDQATAFVILGSIVVPLAILTAVCWFFWKHRHDD* |
Ga0062590_1002082593 | 3300004157 | Soil | MLVSAAGDQATAFVILGSIVVPLAILTAVCWFFWKHRRDD* |
Ga0062595_1000147083 | 3300004479 | Soil | MEVLAARGDQATAFVILGSIVVPLAVLAAVCWFFWKHRHDD* |
Ga0062595_1003451512 | 3300004479 | Soil | VWGLAAFSGGQATAVVILGSIVFPLLALGWLCWFFWRHRHDD* |
Ga0062594_1024075902 | 3300005093 | Soil | VLSLLAARGDQATALVVLASIVIPLAVLGGLCWYFWRHRHDD* |
Ga0066672_100459992 | 3300005167 | Soil | VGSAVLDLVAAAGDQATAVVVVASIVVPLGILAVVCWFFWKHRHDD* |
Ga0066672_101373512 | 3300005167 | Soil | MLAARGDQATALVILASIVIPLVVLGGLCWFFWVHRRDE* |
Ga0066677_101023742 | 3300005171 | Soil | TVVALTGGQATAVVILGSIVFPLLAVGGLCWFFWRHRHDE* |
Ga0066677_103769981 | 3300005171 | Soil | MGYAAIGLLAARGDQGIAVVLVASIVVPLAILTGVCWFFWKHRHDE* |
Ga0066683_107596071 | 3300005172 | Soil | AAVLSTIAASGDQAIAFVILGSIVIPVAALGWLCWFFWKHRHDE* |
Ga0066683_109065022 | 3300005172 | Soil | MDVLAAAGDQATAFVILGSIVIPLAILTAVCWFFWKHRDDD* |
Ga0066680_106603612 | 3300005174 | Soil | VIFLLAAHGDQATALVILASIVVPLVVLGAVCWFFWTHRHDQ* |
Ga0066679_100121492 | 3300005176 | Soil | VQLASGLVNTVVALTGGQATAVVILGSIVFPLLAVGGLCWFFWRHRHDE* |
Ga0066690_100024672 | 3300005177 | Soil | VRQAALDLLAAAGDRAIALVIVASIVIPLAILTALCWYFWKHRHDG* |
Ga0066690_103571021 | 3300005177 | Soil | VGGGAICIVAAAGDQATAVVVVASIVVPLGILAAVCWFFWKHRHDD* |
Ga0066688_102596662 | 3300005178 | Soil | MLAARGDQATALVILASIVIPLVVLGCLCWFFWVHRRDE* |
Ga0066684_100113997 | 3300005179 | Soil | MLAARGDQATALVILASIVIPLVVLGGLCLFFWVHRRDE* |
Ga0066684_100308085 | 3300005179 | Soil | VVAAAGDQAIAVVVVASIVVPLAVLAAVCWFFWKHRADE* |
Ga0066684_100366113 | 3300005179 | Soil | VRQAALDVLAAAGDQAIALVIVASIVIPLAILTALCWYFWKHRHDG* |
Ga0066678_105039132 | 3300005181 | Soil | VLSLVAASGDRAIAIVILGSIVIPLAALGWLCWFFWKHRHDD* |
Ga0066678_107033572 | 3300005181 | Soil | MVGLGSLVASSGGQAIAIVILASIVIPAVALGWLCWFFWKHRHDQ* |
Ga0066671_100016502 | 3300005184 | Soil | VDVFEVLAARADQATAFVILGSIVVPLAVLAAVCLFFWRHRHDD* |
Ga0066671_100811732 | 3300005184 | Soil | VRQAALDVLAAAGDQAIALVVVASIVIPLAILAALCWYFWKHRHDG* |
Ga0066671_104609341 | 3300005184 | Soil | MGTAAIGLLAARGDQGIAVVLVASIVVPLAILTGVCWFFWKHRHDE* |
Ga0066388_1009513123 | 3300005332 | Tropical Forest Soil | MPSLLAARGDQATALVILASIVIPLAVLGGVCWYFWRHRNDE* |
Ga0066388_1037072903 | 3300005332 | Tropical Forest Soil | VPPLLAAHGDQAIALVILASIVIPLAALGGVSWYFWRHRHDE* |
Ga0066388_1051202122 | 3300005332 | Tropical Forest Soil | VFSLLAASGDRATELVILGSIVIPLIALGWLCWFFWVHRHDD* |
Ga0070680_1009794751 | 3300005336 | Corn Rhizosphere | IGLAAAGDQAIAGVIVASIVVPLAVLGVVLWFFWKHRHDD* |
Ga0070682_1000050255 | 3300005337 | Corn Rhizosphere | LLVIGLAAAGDQAIAGVIVASIVVPLAVLGVVLWFFWKHRHDD* |
Ga0070691_101301743 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | REPALLIVAASGDGAIAVVILASMVVPLVVVGWLCWFFWKHRHDE* |
Ga0070671_1002575221 | 3300005355 | Switchgrass Rhizosphere | AGRSSVIGLAAAGDQAIAGVIVASIVVPLALLGGVLWFFWKHRHDD* |
Ga0070709_103330042 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | VLAAAGDQAIALGIVASIVIPLAILTALCWYFWKHRHDG* |
Ga0070709_108386522 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | VIGLAAAGDQAIAGVIVASIVVPLALLGVVLWFFWKHRHDD* |
Ga0070709_110570351 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | TPKRQRAAVLSTVAASGDQAIAFVILASIVIPLAALGWVCWFFWKHRHDE* |
Ga0070713_1002785523 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | VLSTVAASGDQAIAFVILASIVIPLAALGWVCWFFWKHRHDE* |
Ga0070713_1003047113 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | VIGLAAAGDQAIAGVIVASIVVPLAVLGVVLWFFWKHRHDD* |
Ga0070711_1000485445 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | VLSLLAARGDQATALVVLASIVIPLAVLGGVCWYFWRHRHDE* |
Ga0070711_1001246975 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | LLVICLAAAGDGAIAGVLVASIVVPLAVLGVVLWFFWKHRHDD* |
Ga0070705_1002277912 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | VLSVIAASGDQAIAFVILGSIVIPVAALAWLCWFFWKHRHDD* |
Ga0070694_1017120431 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | LLDLVRQAALDVLAAAGDQAIALVIVASIVIPLAILTALCWYFWKHRHDG* |
Ga0070708_10001024113 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | VLSTVAASGDQAIAFVILASIVIPLAALAWVCWLFWKHRHDE* |
Ga0066681_109727212 | 3300005451 | Soil | LQLACGCAVLSVVAFSGGQATAVVVLGSIVFPLLAVGWLCWFFWRHRHDE* |
Ga0066687_100249082 | 3300005454 | Soil | VDVFEVLAARADQATAFVILGSIVVPLAVLAAVCLFFWGHRHDD* |
Ga0070681_103254823 | 3300005458 | Corn Rhizosphere | VWGLAAFSGGQATAVVILVSIVFPLLALGWLCWFFWRHRHDD* |
Ga0068867_1019469332 | 3300005459 | Miscanthus Rhizosphere | VGFSSLLAASGDGAIAVVIVASIVVPLLALAGLCWFFWNHRHDE* |
Ga0070706_1003063563 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | VLSTVAASGDQAIAFVILASIVIPLAALAWVCWFFWKHRHDE* |
Ga0070741_100734904 | 3300005529 | Surface Soil | VALLLAAQDNGAVAIIVLGSIVVPLAGTAFLCWIFWRHRHDD* |
Ga0070741_108527322 | 3300005529 | Surface Soil | VDLLLAAQDNGAVAIIVLGSIVVPLAGTAVLCWIFWRHRHDD* |
Ga0066697_104717612 | 3300005540 | Soil | LQLAWGCAVFSVVAFSGGQATAVVVLGSIVFPLLAVGWLCWFFWRHRHDE* |
Ga0070732_104007523 | 3300005542 | Surface Soil | VLSLLAASGDQATAYVILASIVIPLAVLGGVCWFFWKHRHDE* |
Ga0066701_100287003 | 3300005552 | Soil | VDQATTFVILGSIVIPLAILTVVCWFFWKHRHDA* |
Ga0066701_101551342 | 3300005552 | Soil | MVNVLAANGDQATAFIVLASIVVPLAVLVVVCWFFWTHRHDD* |
Ga0066695_104849472 | 3300005553 | Soil | VVALGSLVASGGQAIAIVILASIVIPAVALGWLCWFFWKHRHD |
Ga0066692_108983102 | 3300005555 | Soil | VLSTIADSGDQAIAFVILASIVIPLAVLGWLCWFFWKHRHDE* |
Ga0066670_107376782 | 3300005560 | Soil | VYWLVSIALLVNVLAASGDRATAVVILGSIVIPLLAVAWLCWFFW |
Ga0066699_104037922 | 3300005561 | Soil | AARVFALLAARGDQATALVILASIVIPLAILAAVSWYFWAHRHDE* |
Ga0066703_106753862 | 3300005568 | Soil | NTVVALTGGQATAVVILGSIVFPLLAVGGLCWFFWRHRHDE* |
Ga0066705_103472681 | 3300005569 | Soil | MLAARGDQATALVILASIVIPLVVLGCLCWFFWVHRRDE |
Ga0066708_101613592 | 3300005576 | Soil | MVDMLAANGDQATAFIILGSIIVPLAALAVVCWFFWTHRHDD* |
Ga0066708_104596392 | 3300005576 | Soil | VDQATTFVILGSIVIPLAILTVVCWFFWKHRHDD* |
Ga0066691_104850331 | 3300005586 | Soil | AWRSLVVNVVAFSGGEATAVILLGSIVFPLLAVAWLCWFFWRHRHDE* |
Ga0066654_100403883 | 3300005587 | Soil | MSVLAASGNGAKAVVILGSIVIPLLTVAWLCWFFWRHRHDE* |
Ga0066903_1002052784 | 3300005764 | Tropical Forest Soil | VIGLAAAGDQAIAAVVVASIVVPLAILGVVLWFFWKHRHDD* |
Ga0066903_1003086724 | 3300005764 | Tropical Forest Soil | VPPLLAAHGDQAIALVILASIVIPLAVLGGVSWYFWRHRHDE* |
Ga0066903_1003982111 | 3300005764 | Tropical Forest Soil | VLSVLAARGDQATALVIFASIVIPLAVLGGVCWYFWRHRHDD* |
Ga0081540_13516192 | 3300005983 | Tabebuia Heterophylla Rhizosphere | VSSLLAAPGDQATAIVVLASIVVPLAVLGGLCWYFWRHRHDD* |
Ga0070717_102920392 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VICLAAAGDGAIAGVLVASIVVPLAVLGVVLWFFWKHRHDD* |
Ga0066651_102895432 | 3300006031 | Soil | MDVLAAAGDQATAFVILGSIVIPLAILTAVGWFFWKHRDDD* |
Ga0066696_108897761 | 3300006032 | Soil | VLSVVAFSGGQATAVVVLGSIVFPLLAVGWLCWFFWRHRHDE* |
Ga0066652_1005031151 | 3300006046 | Soil | VLSTVAASGDQAIAFVILGSIVIPLAALGWLCWFFWKHRHDE* |
Ga0066652_1006264943 | 3300006046 | Soil | MVDSASLAASSGGQAIAIVIVASIVIPGVALGWLCWYFWKHRHDE* |
Ga0070716_1007669132 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | KRQRAAVLSTVAASGDQAIAFVILASIVIPLAALGWVCWFFWKHRHDE* |
Ga0074048_100365832 | 3300006581 | Soil | MFASGDQAIALVVLASIVIPAAALAWLCWFFWKHRHDD* |
Ga0079222_101016872 | 3300006755 | Agricultural Soil | LAGLSAVIAAAGDGAIAGVIVGSIVVPLAILGLVLWFFWKHRHDD* |
Ga0066653_104274142 | 3300006791 | Soil | MVDSASLAASSGGQAIAIVIVASIVIPGVALGGLCWYFWKHRHDE* |
Ga0066658_106014091 | 3300006794 | Soil | VLTVVAVSGGTATALVILGSIVFPLLAVGWLCWFFWRHRHDE* |
Ga0075425_1016329292 | 3300006854 | Populus Rhizosphere | VTDQATSFVILGSIVVPLALLGLICWYFWKHRHDD* |
Ga0079219_100348141 | 3300006954 | Agricultural Soil | VISLAAAGDQAIAGVIVASIVVPLALLGVVLWFFWKHRHDD* |
Ga0099793_105557742 | 3300007258 | Vadose Zone Soil | VDQATTFLILGSIVIPLAILTVVCWFFWKHRHDD* |
Ga0066710_1014835882 | 3300009012 | Grasslands Soil | VRAAIGVVAAAGDQATAFVIVASIVVPLAILSGVCWFFWKHRHDD |
Ga0066710_1037737432 | 3300009012 | Grasslands Soil | VVAAVVDQATGFVILGSIVIPLAILTAVCWFFWKHRHDD |
Ga0066710_1038427102 | 3300009012 | Grasslands Soil | VNVVAFSGGEATAVILLGSIVFPLLAVAWLCWFFWRHRHDE |
Ga0099830_102808012 | 3300009088 | Vadose Zone Soil | VDQATALVILASIVIPLAILIVVCWFFWKHRRDD* |
Ga0099827_100135944 | 3300009090 | Vadose Zone Soil | VIFVLAANGDQATALVILASIVIPLAVLAAVCWFFWTHRHDE* |
Ga0099827_104359602 | 3300009090 | Vadose Zone Soil | VVSLLAARGDQATALVILASIVIPLAALAAVCWFFWTRRHDQ* |
Ga0105245_100288461 | 3300009098 | Miscanthus Rhizosphere | VLSVIAASGDQAIAFVILGSIVIPVAALAWLCWFFWKHRH |
Ga0066709_1003418041 | 3300009137 | Grasslands Soil | VNTVVALTGGQATAVVILGSIVFPLLAVGGLCWFFWRHRHDE* |
Ga0066709_1008518921 | 3300009137 | Grasslands Soil | VCLVGVQYRRVSLLAARGDQATALVIVGSIVVPLVILAVVCWIFWTHRHDD* |
Ga0066709_1019530371 | 3300009137 | Grasslands Soil | MMVDMLAANGDRATAFIVLGSIVIPLAVLAVVCWFFWTHRHDD* |
Ga0066709_1033931191 | 3300009137 | Grasslands Soil | VVSAAGDQATAFVILGSIVIPLAILTAVCWFFWKH |
Ga0066709_1038619162 | 3300009137 | Grasslands Soil | VNVVAFSGGEATAVILLGSIVFPLLAVAWLCWFFWRHR |
Ga0066709_1044390391 | 3300009137 | Grasslands Soil | MVDMLAANGDQATAFIILGSIVVPLAVLAVVCCFFWTHRHDD* |
Ga0066709_1044510071 | 3300009137 | Grasslands Soil | MADMLAANGDQATAFIILGSIVVPLAVLAVVCWFFWTHRYGD* |
Ga0066709_1044781531 | 3300009137 | Grasslands Soil | EGPVNATDVVILLSIVVPLLALGVVCWIFWQHRHDE* |
Ga0066709_1045277282 | 3300009137 | Grasslands Soil | VRAAIGVVAAAGDQVTAFVIVASIVVPLAILSGVCWFFWKHRHDD* |
Ga0134065_104920331 | 3300010326 | Grasslands Soil | VFSVVAFSGGQATAVVVLGSIVFPLLAVGWLCWFFWRHRHDE* |
Ga0126372_130031332 | 3300010360 | Tropical Forest Soil | SLAAAGDQAIAGVVVASIVVPLLVLGIVLWFFWKHRHDD* |
Ga0126379_106544462 | 3300010366 | Tropical Forest Soil | MGPTALNLLAAAGAQAVSFVILGSIVIPLAILAAVCWFFWKHRHDD* |
Ga0134128_129509082 | 3300010373 | Terrestrial Soil | VAASGDQAIAFVILASIVVPLAALGWGCWFFWKHRHDE* |
Ga0134126_107593161 | 3300010396 | Terrestrial Soil | AVSGGTATAVVILGSIVVPLLAVGWLCWFFWRHRHDE* |
Ga0134126_123890821 | 3300010396 | Terrestrial Soil | VLSVIAASGGQAIAFVILGSIVIPVAALAWLCWFFLKHRHDD* |
Ga0138514_1000007364 | 3300011003 | Soil | MVDVLAANGDQATAFIVLASIVVPLAVLVVVCWFFWTHRHDD* |
Ga0138514_1001030212 | 3300011003 | Soil | LSVAASGDQAIAVVIVASIVIPLAVLGWLSWFFWKHRHDD* |
Ga0120157_10553782 | 3300011994 | Permafrost | VDQATALVILASIVIPVAILIFVCWFFWKHRHDD* |
Ga0120156_10268932 | 3300011996 | Permafrost | VDQATALVILASIVIPVTILVAVCWFFWKHRHDD* |
Ga0120152_11599222 | 3300012011 | Permafrost | VTTLAAVSGGTATAVVILGSIVFPLLAVGWLCWFFWRHRHDE* |
Ga0120159_10370921 | 3300012014 | Permafrost | LINALVASGGQATAIVILGSIVFPLLAVAWLCWFFWRHRHDE* |
Ga0137389_117561462 | 3300012096 | Vadose Zone Soil | AGVDRATAFVILGSIVIPLAILTAVCWFFWKHRHDD* |
Ga0137364_100595411 | 3300012198 | Vadose Zone Soil | VLSTIAASGDQAIAFVILGSIVIPVAALGWLCWFFWKHRHDE |
Ga0137364_103179842 | 3300012198 | Vadose Zone Soil | MTLAAVSGGTATAVVILGSIVFPLLAVGGLCWFFWRHRHDE* |
Ga0137383_109240052 | 3300012199 | Vadose Zone Soil | VDQATTFVILCSIVIPLAILTVVCWFFWKHRHDA* |
Ga0137382_100853062 | 3300012200 | Vadose Zone Soil | MTLAAVSGGTATAVVILGSIVFPLVAVGWLCWFFWRHRHDE* |
Ga0137382_107570312 | 3300012200 | Vadose Zone Soil | LQLAWGCAVLSVVAFSGGQATAVVVLGSIVFPLLAVGWLCWFFWRHRHDE* |
Ga0137365_101964753 | 3300012201 | Vadose Zone Soil | VVSAAGDQATAFVILGSIVIPLAILTAVCWFFWKHRHDD* |
Ga0137363_118061991 | 3300012202 | Vadose Zone Soil | VLSTIADSGDQAIAFVILASIVIPLAALGWLCWFFWKHRHDE* |
Ga0137380_111588452 | 3300012206 | Vadose Zone Soil | MEDMLAANGDQATAFIILGSIVVPLAVLAVVCWFFWT |
Ga0137380_113098582 | 3300012206 | Vadose Zone Soil | VLWLVAPPGDQATALVILASIVIPLVALGWLCWFFWTRRHDE* |
Ga0137381_108816061 | 3300012207 | Vadose Zone Soil | VVAAAVDQATAFVILGSIVIPVLILTAVCWFFWKHRHDD* |
Ga0137376_102136832 | 3300012208 | Vadose Zone Soil | VDQGTALVILGSIVIPVAIVIVVCWFFWKHRHDD* |
Ga0137379_108012461 | 3300012209 | Vadose Zone Soil | RVIFVLAANGDQATALVILASIVVPLVVLGAVCWFFWTRRHDD* |
Ga0137379_111896331 | 3300012209 | Vadose Zone Soil | MTSWSELRMLSPPAGDKALAFVIVGSIVIPLAILAAVCWFFWKHRHDD* |
Ga0137377_109947332 | 3300012211 | Vadose Zone Soil | CEAVNIMEVLAARGDQATAFVILGSIVVPLAVLAAVCWFFWKHRHDD* |
Ga0137377_115338431 | 3300012211 | Vadose Zone Soil | VDQATALVILGSIVIPLAILTVVCWFFWKHRHDD* |
Ga0137387_110702142 | 3300012349 | Vadose Zone Soil | VIFLLAAHGDQATALVILASIVVPLLVLGAVCWFFWTHRHDQ* |
Ga0137372_103230161 | 3300012350 | Vadose Zone Soil | LSLAASGDQAIAVVIVASIVIPLAALGWLSWFFWKHRHDD* |
Ga0137372_110525531 | 3300012350 | Vadose Zone Soil | MVEMLAANGDQAPAFIILGSIVVPLAVLALVCWFFWTHRHDD* |
Ga0137371_105020642 | 3300012356 | Vadose Zone Soil | VLSTIAASGDQAIAFVILGSIMIPVAALGWLCWFFWKHRHDE* |
Ga0137371_111724141 | 3300012356 | Vadose Zone Soil | VLSLVAASGDRAIAIVILGSIVIPLEALGWLCWFFWKHRHDD* |
Ga0137361_109771872 | 3300012362 | Vadose Zone Soil | VLTTIADSGDQAIAFVILASIVIPLAALGWLCWFFWKHRHDE* |
Ga0150984_1102618602 | 3300012469 | Avena Fatua Rhizosphere | VSSLVVAAGDGAVAVVILASIVVPMVALAGLCWVFWKHRHDE* |
Ga0157342_10149093 | 3300012507 | Arabidopsis Rhizosphere | VIGLAAAGDQAIAGVIIASIVVPLAVLGVVLWFFWKHRHDD* |
Ga0137358_109825862 | 3300012582 | Vadose Zone Soil | MTLAAVSGGTATAVVILGSIVFPLVAVGWLCWFFWRHRH |
Ga0137395_101617053 | 3300012917 | Vadose Zone Soil | AAAGDRATAFVIFGSIVIPLAILTAVCWFFWKHRHDD* |
Ga0137404_116622632 | 3300012929 | Vadose Zone Soil | MTLAVVSGGTATAVVILGSIVFPLLAVGWLCWFFWRHRHDE* |
Ga0164298_106158062 | 3300012955 | Soil | MGLAAAGDQAIAGVIVASIVVPLAVLGVVLWFFWKHRHDD* |
Ga0164298_107628672 | 3300012955 | Soil | VGVLSFVAAQGDGAIAVVIVASIVVPLVALAGLCWFFWNHRHDE* |
Ga0164299_100555732 | 3300012958 | Soil | VLSFVAAQGDGAIAVVIVASIVVPLVALAGLCWFFWNHRHDE* |
Ga0164301_100603702 | 3300012960 | Soil | VWGLAAFSGGQATAVVILGSIVFPSLALGWLCWFFWRHRHDD* |
Ga0164301_102222214 | 3300012960 | Soil | LLVIGLAAAGDQAIAGVIVASIVVPLAVLGVVLWFFWKH |
Ga0134076_105158601 | 3300012976 | Grasslands Soil | IDTLAQTDHATSFVILGSIVVPLALLALICWYFWKHRHDD* |
Ga0164308_101923873 | 3300012985 | Soil | VGVLSLVAAQGDGAIAVVIVASIVVPLVALAGLCWFFWNHRHDE* |
Ga0164308_105037743 | 3300012985 | Soil | VVTLAAVSGGTATAVVILGSIVVPLLAVGWLCWFFWRHRHDE* |
Ga0164305_111405832 | 3300012989 | Soil | VERAIRFTAVLSTIAASGDQAIAFVILASIVIPLAALGWLCWFFWKHRHDE* |
Ga0120147_10626822 | 3300013758 | Permafrost | VDQATALVILASIVIPVAILIVVCWFFWRHRHDE* |
Ga0120111_10787072 | 3300013764 | Permafrost | VDQATAFVILRSIVIPLAILTVLCWFFWKHRHDE* |
Ga0120123_10215792 | 3300013770 | Permafrost | VDQATALVILASIVVPVAILIFVCWFFWKHRHDD* |
Ga0120158_101951822 | 3300013772 | Permafrost | MVDMFAANGGQATAFIILGSIVVPLALLAVVCWFFWIHRHDD* |
Ga0120158_103475001 | 3300013772 | Permafrost | QLACAPHVMTIAAVSGGTATAVVILGSIVVPLLAVGWLCWFFWRHRHDE* |
Ga0157380_127907093 | 3300014326 | Switchgrass Rhizosphere | MLSLAAAGDEAIAGVIVASIVVPLAVLGVVLWFFWKHRHDD* |
Ga0182000_101162563 | 3300014487 | Soil | MGTAATGLLAARGDQGIAVVLVASIVVPLAILTGVCWFFWKHRHDD* |
Ga0120104_10641852 | 3300014829 | Permafrost | VDQATAFVILGSILIPLAILTAVCWFFWKHRHDE* |
Ga0134072_101545072 | 3300015357 | Grasslands Soil | VLAAGGDQATTFIVLGSIVVPLVLLAVVCWFFWTHRHDD* |
Ga0134072_101677761 | 3300015357 | Grasslands Soil | VVAAAGDQAIAVVVVASIVVPLAVLAAVCWFFWKHRADD* |
Ga0132258_138452623 | 3300015371 | Arabidopsis Rhizosphere | MSLLAARGDQATELVILGSIVVPLAILGVVCWYFWRHRHDE* |
Ga0132256_1000081537 | 3300015372 | Arabidopsis Rhizosphere | LSVIGLAAAGDQAIAGVIIASIVVPLAVLGVVLWFFWKHRHDD* |
Ga0132256_1000746776 | 3300015372 | Arabidopsis Rhizosphere | VLSLLAARGDQATALVVLASIVIPLAALGGLCWYFWRHRHDE* |
Ga0132256_1010229061 | 3300015372 | Arabidopsis Rhizosphere | VLSLLAARGDQATALVVLASIVVPLAVLGGVCWYFWRHRHDE* |
Ga0132255_1006098971 | 3300015374 | Arabidopsis Rhizosphere | VLSLLAARGDQATALVVLASIVIPLAILGGLCWYFWRPRHDD* |
Ga0187779_100118408 | 3300017959 | Tropical Peatland | MNVVAARGDEATAMVILASIVVPLAVLAGVCWWFWQHRHDE |
Ga0187776_100260102 | 3300017966 | Tropical Peatland | VWGVLASSGDQAIAAVVVASIVIPAVALGWLCWFFWKHRHDE |
Ga0187777_100082294 | 3300017974 | Tropical Peatland | MNVVAARGDEATAMVILASIVVPLAVLAGVCWWFWLHRHDE |
Ga0184608_100256003 | 3300018028 | Groundwater Sediment | VLSTIAASGDQAIAFVILGSIVIPLAALGWLCWFFWKHRHDE |
Ga0187765_107180332 | 3300018060 | Tropical Peatland | MNVVAARGDEATAMVILASIVVPLAVLAAVCWWFWLHRHDE |
Ga0184624_104394082 | 3300018073 | Groundwater Sediment | VLSVIAASGDQAIALVILGSIVIPVAALTWLCWFFWKHRHDD |
Ga0184625_101593462 | 3300018081 | Groundwater Sediment | VLSVIAASGDQAIALVILGSIVIPVAALVWLCWFFWKHRHDD |
Ga0066655_102060003 | 3300018431 | Grasslands Soil | MDVLAAAGDQATAFVILGSIVIPLAILTAVCWFFWKHRDDD |
Ga0066655_103713442 | 3300018431 | Grasslands Soil | VLSVVAFSGGQATAVVVLGSIVFPLLAVGWLCWFFWRHRHDE |
Ga0066655_106729822 | 3300018431 | Grasslands Soil | VRQAALDVLAAAGDQAIALVIVASIVIPLAILTALCWYFWKHRHDD |
Ga0066667_100980082 | 3300018433 | Grasslands Soil | MVDMLAANGDQATAFIILGSIIVPLAALAVVCWFFWTHRHDD |
Ga0066667_101994441 | 3300018433 | Grasslands Soil | AAVDQATTFVILGSIVIPLAILTVVCWFFWKHRHDD |
Ga0066667_103277932 | 3300018433 | Grasslands Soil | MLAARGDQATALVILASIVIPLVVLGGLCWFFWVHRRDE |
Ga0066662_100059745 | 3300018468 | Grasslands Soil | VRQAALDLLAAAGDRAIALVIVASIVIPLAILTALCWYFWKHRHDG |
Ga0066662_115430761 | 3300018468 | Grasslands Soil | MLAARGDQGTALVILASIVIPLVVLGGLCWFFWVHRRDE |
Ga0066662_115941992 | 3300018468 | Grasslands Soil | VYWLVSIALLVNVLAASGDRATAVVILGSIVIPLLAVAWLCWFFWRHRHDE |
Ga0066662_122011721 | 3300018468 | Grasslands Soil | VNTVVALTGGQATAVVILGSIVFPLLAVGGLCWFFWRHRHDE |
Ga0066662_127416901 | 3300018468 | Grasslands Soil | VGGGAICIVAAAGDQATAVVVVASIVVPLGILAAVCWFFWKHRHDD |
Ga0066669_105528152 | 3300018482 | Grasslands Soil | VRQAALDVLAAAGDQAIALVIVASIVIPLAILTALCWYFWKHRHDG |
Ga0066669_113250131 | 3300018482 | Grasslands Soil | VIVAAAGDQAIAGVVVASIVVPLGVLAAVCWFFWKHRADE |
Ga0184643_13787592 | 3300019255 | Groundwater Sediment | VLSLVAASGDRAIAIVILGSIVIPLAALGWLCWFFWKHRHDD |
Ga0193729_10175375 | 3300019887 | Soil | VLSTIAASGDQAIAFVILASIVIPLAALGWLCWFFWKHRHDE |
Ga0193751_10803283 | 3300019888 | Soil | LINALVASGGQATAIVILGSIVFPLLAVAWLCWFFWRHRHDE |
Ga0193751_11996142 | 3300019888 | Soil | MRFTAVLSTIAALGDQAIAFVILASIVIPLAALGWLCWFFWKHRHDE |
Ga0193735_11034982 | 3300020006 | Soil | VGVLSLLAAQGDGAIAVVIVASIVVPLVALGGLCWFFWNHRHDE |
Ga0224452_10553603 | 3300022534 | Groundwater Sediment | MLSTIAASGDQAIAFVILGSIVIPLAALGWLCWFFWKHRHDE |
Ga0222623_104026662 | 3300022694 | Groundwater Sediment | VLSVIAASGDQAIALVILGSIVIPVAALAWLCWFFWKHRH |
Ga0222622_104223992 | 3300022756 | Groundwater Sediment | VLSVIAASGDQAIALVILGSIVIPVAALAWLCWFFWKHRHDD |
Ga0247669_10145562 | 3300024182 | Soil | VIGLAAAGDQAIAGVIVASIVVPVAVLGVVLWFFWKHRHDD |
Ga0247688_10349911 | 3300024186 | Soil | SVIGLAAAGDQAIAGVIVASIVVPLAVLGVVLWFFWKHRHDD |
Ga0247664_11055972 | 3300024232 | Soil | VIGLAAAGDQAIAGVILASIVVPLALLGGVLWFFWKHRHDD |
Ga0247677_10354692 | 3300024245 | Soil | MGTAAIGLLAARGDQGIAVVLVASIVVPLAILTGVCWFFWKHRHDK |
Ga0207692_105157122 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | LLVICVAAAGDGAIAGVLVASIVVPLAVLGVVLWFFWKHRHDD |
Ga0207680_112073472 | 3300025903 | Switchgrass Rhizosphere | LFVIGLAAAGDQAIAGVIVASIVVPLAVLGVVLWFFWKHRHDE |
Ga0207699_110984182 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MLVSAAGDQATAFVILGSIVVPLAILTAVCWFFWKHRHDD |
Ga0207699_111473451 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | VRQATLDVLAAAGDQAIAVVIVASIVIPLAILTAFCWYFWKHRHDV |
Ga0207684_105373272 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | VLSTVAASGDQAIAFVILASIVIPLAALAWVCWFFWKHRHDE |
Ga0207654_106795361 | 3300025911 | Corn Rhizosphere | AGLLLVIGLAAAGDQAIAGVIVASIVVPLAVLGVVLWFFWKHRHDD |
Ga0207693_103624662 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | VLSLLAARGDQATALVVLASIVIPLAVLGGLCWYFWRHRHDD |
Ga0207663_103070123 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | VTSLGASWGLAAFSGGQATAVVILGSIVFPLLALGWLCWFFWR |
Ga0207663_107641101 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | VLSLLAARGDQATALVVLASIVIPLAVLGGVCWYFWRHRHDD |
Ga0207646_100911082 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | VLSTVAASGDQAIAFVILASIVIPLAALAWVCWLFWKHRHDE |
Ga0207687_106379482 | 3300025927 | Miscanthus Rhizosphere | VGFSSLLAASGDGAIAVVIVASIVVPLLALAGLCWFFWNHRHDE |
Ga0207701_114215992 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | ALLIVAASGDGAITVVILASIVVPLVVVGWLCWFFWKHRHDE |
Ga0207706_102616341 | 3300025933 | Corn Rhizosphere | VLSVIAASGDQAIAFVILGSIVIPVAALAWLCWFFWKHRHDD |
Ga0207669_107482592 | 3300025937 | Miscanthus Rhizosphere | RRGGATVLSVIAASGGQAIAFVILGSIVIPVAALAWLCWFFWKHRHDD |
Ga0207704_110970512 | 3300025938 | Miscanthus Rhizosphere | VLSVIAASGDQAIAFVILGSIVIPVAALAWLCWFFWKHRHD |
Ga0207678_100673566 | 3300026067 | Corn Rhizosphere | VIGLAAAGDQAIAGVIVASIVVPLAVLGVMLWFFWKHRHDD |
Ga0209153_10013417 | 3300026312 | Soil | VDVFEVLAARADQATAFVILGSIVVPLAVLAAVCLFFWGHRHDD |
Ga0209152_105053292 | 3300026325 | Soil | VGSAVLDLVAAAGDQATAVVVVASIVVPLGILAVVCWFFWKHRHDD |
Ga0209473_10522893 | 3300026330 | Soil | MLAARGDQATALVILASIVIPLVVLGGLCLFFWVHRRDE |
Ga0209690_11547032 | 3300026524 | Soil | MVNVLAANGDQATAFIVLASIVVPLAVLVVVCWFFWTHRHDD |
Ga0209056_103086082 | 3300026538 | Soil | MLAANGDQATAFIILGSIIVPLAALAVVCWFFWTHRHDD |
Ga0209161_104271411 | 3300026548 | Soil | ARAPRALAMLAARGDQATALVILASIVIPLVVLGCLCWFFWVHRRDE |
Ga0209577_102434461 | 3300026552 | Soil | VLSVVAFSGGQATAVVVLGSIVFPLLAVGWLCWFFWR |
Ga0209577_102509352 | 3300026552 | Soil | LHASGNGATAVVIVGSIVIPLLTVAWLCWFFWRHRHDE |
Ga0209577_107617711 | 3300026552 | Soil | MGYAAIGLLAARGDQGIAVVLVASIVVPLAILTGVCWFFWKHRHDE |
Ga0209326_10194713 | 3300026899 | Forest Soil | VIGLAAAGDQAIAGVIVASIVVPLAVLGVVLWFFWKHR |
Ga0207981_10314883 | 3300027560 | Soil | VLSVIAAPGDQAIALVILASIVIPAVVLAWLCWLFWKHRHDD |
Ga0209178_13270562 | 3300027725 | Agricultural Soil | LDLAGLSAVIAAAGDGAIAGVIVGSIVVPLAILGLVLWFFWKHRHDD |
Ga0209580_104321423 | 3300027842 | Surface Soil | VLSLLAASGDQATAYVILASIVIPLAVLGGVCWFFWKHRHDE |
Ga0209590_100077774 | 3300027882 | Vadose Zone Soil | VIFVLAANGDQATALVILASIVIPLAVLAAVCWFFWTHRHDE |
Ga0307321_10231113 | 3300028704 | Soil | TIAASGDQAIAFVILGSIVIPLAALGWLCWFFWKHRHDD |
Ga0307298_100590821 | 3300028717 | Soil | LIVAASGDGAITAVVLASMVVPLVVVGWLCWFFWKHRHDE |
Ga0307316_102239292 | 3300028755 | Soil | IVAASGDGAITAVVLASIVVPLVVVGWLCWFFWKHRHDE |
Ga0307323_103324111 | 3300028787 | Soil | VLSVIAASGDQAIALVILGSIVIPVAALAWLCWFF |
Ga0307305_100731423 | 3300028807 | Soil | MVDVLAANGDQATAFIVLASIVVPLAVLVVVCWFFWTHRHDD |
Ga0307296_103668661 | 3300028819 | Soil | GSHATVLSVIAASGDQAIALVILGSIVIPVAALAWLCWFFWKHRHDD |
Ga0307278_100385041 | 3300028878 | Soil | MVDVLAANGDQATGFIVLASIVVPLAVLVVVCWYFWTHRHDD |
Ga0307308_104932411 | 3300028884 | Soil | LAAQGDGAIAVVIVASIVVPLVALGGLCWFFWNHRHDE |
Ga0310886_108090913 | 3300031562 | Soil | LLVIGLAAAGDQAIAGVIVASIVVPLAVLGVVLWFFWKHRHDD |
Ga0307469_125029342 | 3300031720 | Hardwood Forest Soil | MGNAPIGLLAARGDQGIAVVLVASIVVPLAILTGVCWFFWKHRHDE |
Ga0310884_100535863 | 3300031944 | Soil | LLVIGLAAAGDQAIAGVIVTSIVVPLAVLGVVLWFFWKHRHDD |
Ga0310906_105426642 | 3300032013 | Soil | VIGLAAAGDQAIAGVIVASIVVPLALLGVVLWFFWKHRHDD |
Ga0310890_115401672 | 3300032075 | Soil | VIRLAAAGDQAIAGVIVASIVVPLAVLGVVLWFFWKHRHDD |
Ga0307471_1019187472 | 3300032180 | Hardwood Forest Soil | VTDQATSFVILGSIVVPLALLGLICWYFWKHRHDD |
Ga0307472_1010652961 | 3300032205 | Hardwood Forest Soil | MSLLAARGDQATALVILASIVIPLAALGSVCWYFWRHRHDE |
Ga0335085_108781711 | 3300032770 | Soil | MWGVLANSGDQAIEAVIVASIVVPAIVLGWLCWFFWKHRHDE |
Ga0326730_10757621 | 3300033500 | Peat Soil | VLSVIAASGDQAITLVILGSIVIPAVVLAWLCWFFWKHRHDD |
Ga0373959_0027420_486_617 | 3300034820 | Rhizosphere Soil | MLVIGLAAAGDQAIAGVIVASIVVPLAVLGVVLWFFWKHRHDD |
⦗Top⦘ |