NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F016188

Metagenome / Metatranscriptome Family F016188

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F016188
Family Type Metagenome / Metatranscriptome
Number of Sequences 249
Average Sequence Length 42 residues
Representative Sequence VLSTVAASGDQAIAFVILASIVIPLAALGWVCWFFWKHRHDE
Number of Associated Samples 184
Number of Associated Scaffolds 249

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 42.97 %
% of genes near scaffold ends (potentially truncated) 23.29 %
% of genes from short scaffolds (< 2000 bps) 83.94 %
Associated GOLD sequencing projects 172
AlphaFold2 3D model prediction Yes
3D model pTM-score0.57

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (77.510 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil
(20.080 % of family members)
Environment Ontology (ENVO) Unclassified
(30.924 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(59.036 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 51.43%    β-sheet: 0.00%    Coil/Unstructured: 48.57%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.57
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 249 Family Scaffolds
PF07969Amidohydro_3 5.22
PF07690MFS_1 4.02
PF03640Lipoprotein_15 3.61
PF13419HAD_2 3.21
PF00583Acetyltransf_1 2.81
PF03069FmdA_AmdA 2.81
PF00188CAP 2.41
PF01638HxlR 2.41
PF04191PEMT 2.41
PF01479S4 1.61
PF07883Cupin_2 1.61
PF03734YkuD 1.61
PF00756Esterase 1.20
PF13493DUF4118 1.20
PF00072Response_reg 1.20
PF01386Ribosomal_L25p 1.20
PF06224HTH_42 0.80
PF05378Hydant_A_N 0.80
PF00392GntR 0.80
PF08327AHSA1 0.80
PF08281Sigma70_r4_2 0.80
PF00042Globin 0.80
PF01402RHH_1 0.80
PF12730ABC2_membrane_4 0.80
PF13302Acetyltransf_3 0.80
PF04828GFA 0.80
PF00574CLP_protease 0.80
PF14693Ribosomal_TL5_C 0.80
PF03459TOBE 0.80
PF03992ABM 0.80
PF04140ICMT 0.80
PF02824TGS 0.80
PF01613Flavin_Reduct 0.80
PF03795YCII 0.40
PF09852DUF2079 0.40
PF01636APH 0.40
PF00211Guanylate_cyc 0.40
PF01471PG_binding_1 0.40
PF13668Ferritin_2 0.40
PF13673Acetyltransf_10 0.40
PF12681Glyoxalase_2 0.40
PF02403Seryl_tRNA_N 0.40
PF02518HATPase_c 0.40
PF01266DAO 0.40
PF01797Y1_Tnp 0.40
PF00561Abhydrolase_1 0.40
PF13474SnoaL_3 0.40
PF02621VitK2_biosynth 0.40
PF04542Sigma70_r2 0.40
PF01957NfeD 0.40
PF01926MMR_HSR1 0.40
PF14472DUF4429 0.40
PF00324AA_permease 0.40
PF14020DUF4236 0.40
PF13683rve_3 0.40
PF12697Abhydrolase_6 0.40
PF03006HlyIII 0.40
PF00730HhH-GPD 0.40
PF13616Rotamase_3 0.40
PF06525SoxE 0.40
PF00903Glyoxalase 0.40
PF01546Peptidase_M20 0.40
PF00909Ammonium_transp 0.40
PF02557VanY 0.40
PF01566Nramp 0.40
PF01883FeS_assembly_P 0.40
PF02362B3 0.40
PF00109ketoacyl-synt 0.40
PF13424TPR_12 0.40
PF00753Lactamase_B 0.40
PF13407Peripla_BP_4 0.40
PF16350FAO_M 0.40
PF03691UPF0167 0.40
PF00892EamA 0.40
PF003892-Hacid_dh 0.40
PF09413DUF2007 0.40
PF00877NLPC_P60 0.40
PF00296Bac_luciferase 0.40
PF07676PD40 0.40
PF10066DUF2304 0.40
PF13240zinc_ribbon_2 0.40
PF07366SnoaL 0.40

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 249 Family Scaffolds
COG4315Predicted lipoprotein with conserved Yx(FWY)xxD motif (function unknown)Function unknown [S] 3.61
COG2421Acetamidase/formamidaseEnergy production and conversion [C] 2.81
COG1733DNA-binding transcriptional regulator, HxlR familyTranscription [K] 2.41
COG2340Spore germination protein YkwD and related proteins with CAP (CSP/antigen 5/PR1) domainCell cycle control, cell division, chromosome partitioning [D] 2.41
COG0145N-methylhydantoinase A/oxoprolinase/acetone carboxylase, beta subunitAmino acid transport and metabolism [E] 1.61
COG0616Periplasmic serine protease, ClpP classPosttranslational modification, protein turnover, chaperones [O] 1.61
COG0740ATP-dependent protease ClpP, protease subunitPosttranslational modification, protein turnover, chaperones [O] 1.61
COG1376Lipoprotein-anchoring transpeptidase ErfK/SrfKCell wall/membrane/envelope biogenesis [M] 1.61
COG3034Murein L,D-transpeptidase YafKCell wall/membrane/envelope biogenesis [M] 1.61
COG1825Ribosomal protein L25 (general stress protein Ctc)Translation, ribosomal structure and biogenesis [J] 1.20
COG1017Hemoglobin-like flavoproteinEnergy production and conversion [C] 0.80
COG1030Membrane-bound serine protease NfeD, ClpP classPosttranslational modification, protein turnover, chaperones [O] 0.80
COG1853FMN reductase RutF, DIM6/NTAB familyEnergy production and conversion [C] 0.80
COG3214DNA glycosylase YcaQ, repair of DNA interstrand crosslinksReplication, recombination and repair [L] 0.80
COG3791Uncharacterized conserved proteinFunction unknown [S] 0.80
COG0004Ammonia channel protein AmtBInorganic ion transport and metabolism [P] 0.40
COG01223-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylaseReplication, recombination and repair [L] 0.40
COG0172Seryl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.40
COG0177Endonuclease IIIReplication, recombination and repair [L] 0.40
COG0531Serine transporter YbeC, amino acid:H+ symporter familyAmino acid transport and metabolism [E] 0.40
COG0568DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)Transcription [K] 0.40
COG0791Cell wall-associated hydrolase, NlpC_P60 familyCell wall/membrane/envelope biogenesis [M] 0.40
COG0833Amino acid permeaseAmino acid transport and metabolism [E] 0.40
COG1059Thermostable 8-oxoguanine DNA glycosylaseReplication, recombination and repair [L] 0.40
COG1113L-asparagine transporter or related permeaseAmino acid transport and metabolism [E] 0.40
COG1115Na+/alanine symporterAmino acid transport and metabolism [E] 0.40
COG1191DNA-directed RNA polymerase specialized sigma subunitTranscription [K] 0.40
COG1194Adenine-specific DNA glycosylase, acts on AG and A-oxoG pairsReplication, recombination and repair [L] 0.40
COG1272Predicted membrane channel-forming protein YqfA, hemolysin III familyIntracellular trafficking, secretion, and vesicular transport [U] 0.40
COG1427Chorismate dehydratase (menaquinone biosynthesis, futalosine pathway)Coenzyme transport and metabolism [H] 0.40
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 0.40
COG1876LD-carboxypeptidase LdcB, LAS superfamilyCell wall/membrane/envelope biogenesis [M] 0.40
COG1914Mn2+ or Fe2+ transporter, NRAMP familyInorganic ion transport and metabolism [P] 0.40
COG1943REP element-mobilizing transposase RayTMobilome: prophages, transposons [X] 0.40
COG2114Adenylate cyclase, class 3Signal transduction mechanisms [T] 0.40
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 0.40
COG2173D-alanyl-D-alanine dipeptidaseCell wall/membrane/envelope biogenesis [M] 0.40
COG22313-Methyladenine DNA glycosylase, HhH-GPD/Endo3 superfamilyReplication, recombination and repair [L] 0.40
COG2350YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHisSecondary metabolites biosynthesis, transport and catabolism [Q] 0.40
COG3196Colicin E2 tolerance protein CbrC, UPF0167 familyGeneral function prediction only [R] 0.40
COG4941Predicted RNA polymerase sigma factor, contains C-terminal TPR domainTranscription [K] 0.40


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms77.51 %
UnclassifiedrootN/A22.49 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459015|G14TP7Y02JIWTMAll Organisms → cellular organisms → Bacteria503Open in IMG/M
2170459018|G1P06HT02G9JD1All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium562Open in IMG/M
2209111006|2214941612Not Available539Open in IMG/M
3300000156|NODE_c0744245All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria19143Open in IMG/M
3300000956|JGI10216J12902_106252666Not Available828Open in IMG/M
3300000956|JGI10216J12902_109333402All Organisms → cellular organisms → Bacteria1041Open in IMG/M
3300000956|JGI10216J12902_123057468All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria610Open in IMG/M
3300001205|C688J13580_1022742Not Available765Open in IMG/M
3300001333|A21PFW6_1106785All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1191Open in IMG/M
3300001334|A2165W6_1033157All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium620Open in IMG/M
3300001664|P5cmW16_1081858All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium508Open in IMG/M
3300004156|Ga0062589_102268389All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium557Open in IMG/M
3300004157|Ga0062590_100208259All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1422Open in IMG/M
3300004479|Ga0062595_100014708All Organisms → cellular organisms → Bacteria → Terrabacteria group2738Open in IMG/M
3300004479|Ga0062595_100345151All Organisms → cellular organisms → Bacteria1033Open in IMG/M
3300005093|Ga0062594_102407590All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium575Open in IMG/M
3300005167|Ga0066672_10045999All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2479Open in IMG/M
3300005167|Ga0066672_10137351All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1524Open in IMG/M
3300005171|Ga0066677_10102374Not Available1518Open in IMG/M
3300005171|Ga0066677_10376998All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium812Open in IMG/M
3300005172|Ga0066683_10759607All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria568Open in IMG/M
3300005172|Ga0066683_10906502All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → unclassified Chromatiales → Chromatiales bacterium (ex Bugula neritina AB1)505Open in IMG/M
3300005174|Ga0066680_10660361All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium647Open in IMG/M
3300005176|Ga0066679_10012149All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. URHD00824307Open in IMG/M
3300005177|Ga0066690_10002467All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia7602Open in IMG/M
3300005177|Ga0066690_10357102Not Available991Open in IMG/M
3300005178|Ga0066688_10259666All Organisms → cellular organisms → Bacteria1114Open in IMG/M
3300005179|Ga0066684_10011399All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4321Open in IMG/M
3300005179|Ga0066684_10030808All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales2917Open in IMG/M
3300005179|Ga0066684_10036611All Organisms → cellular organisms → Bacteria2722Open in IMG/M
3300005181|Ga0066678_10503913All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia805Open in IMG/M
3300005181|Ga0066678_10703357All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria673Open in IMG/M
3300005184|Ga0066671_10001650All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria7364Open in IMG/M
3300005184|Ga0066671_10081173All Organisms → cellular organisms → Bacteria1746Open in IMG/M
3300005184|Ga0066671_10460934All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium815Open in IMG/M
3300005332|Ga0066388_100951312Not Available1430Open in IMG/M
3300005332|Ga0066388_103707290All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium780Open in IMG/M
3300005332|Ga0066388_105120212All Organisms → cellular organisms → Bacteria666Open in IMG/M
3300005336|Ga0070680_100979475All Organisms → cellular organisms → Bacteria → Terrabacteria group730Open in IMG/M
3300005337|Ga0070682_100005025All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria7351Open in IMG/M
3300005341|Ga0070691_10130174All Organisms → cellular organisms → Bacteria1275Open in IMG/M
3300005355|Ga0070671_100257522All Organisms → cellular organisms → Bacteria → Terrabacteria group1483Open in IMG/M
3300005434|Ga0070709_10333004All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1117Open in IMG/M
3300005434|Ga0070709_10838652Not Available723Open in IMG/M
3300005434|Ga0070709_11057035Not Available648Open in IMG/M
3300005436|Ga0070713_100278552All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1534Open in IMG/M
3300005436|Ga0070713_100304711All Organisms → cellular organisms → Bacteria → Terrabacteria group1467Open in IMG/M
3300005439|Ga0070711_100048544All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2904Open in IMG/M
3300005439|Ga0070711_100124697All Organisms → cellular organisms → Bacteria1910Open in IMG/M
3300005440|Ga0070705_100227791All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1294Open in IMG/M
3300005444|Ga0070694_101712043All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium535Open in IMG/M
3300005445|Ga0070708_100010241All Organisms → cellular organisms → Bacteria7590Open in IMG/M
3300005451|Ga0066681_10972721All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria507Open in IMG/M
3300005454|Ga0066687_10024908All Organisms → cellular organisms → Bacteria → Terrabacteria group2569Open in IMG/M
3300005458|Ga0070681_10325482All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1447Open in IMG/M
3300005459|Ga0068867_101946933Not Available555Open in IMG/M
3300005467|Ga0070706_100306356All Organisms → cellular organisms → Bacteria1482Open in IMG/M
3300005529|Ga0070741_10073490All Organisms → cellular organisms → Bacteria3830Open in IMG/M
3300005529|Ga0070741_10852732All Organisms → cellular organisms → Bacteria791Open in IMG/M
3300005540|Ga0066697_10471761All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria718Open in IMG/M
3300005542|Ga0070732_10400752All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium828Open in IMG/M
3300005552|Ga0066701_10028700All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. URHD00822868Open in IMG/M
3300005552|Ga0066701_10155134All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1381Open in IMG/M
3300005553|Ga0066695_10484947All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria761Open in IMG/M
3300005555|Ga0066692_10898310Not Available543Open in IMG/M
3300005560|Ga0066670_10737678All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium597Open in IMG/M
3300005561|Ga0066699_10403792All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi978Open in IMG/M
3300005568|Ga0066703_10675386Not Available596Open in IMG/M
3300005569|Ga0066705_10347268All Organisms → cellular organisms → Bacteria936Open in IMG/M
3300005576|Ga0066708_10161359All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1384Open in IMG/M
3300005576|Ga0066708_10459639All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium818Open in IMG/M
3300005586|Ga0066691_10485033Not Available739Open in IMG/M
3300005587|Ga0066654_10040388All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2006Open in IMG/M
3300005764|Ga0066903_100205278All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2957Open in IMG/M
3300005764|Ga0066903_100308672Not Available2512Open in IMG/M
3300005764|Ga0066903_100398211All Organisms → cellular organisms → Bacteria2263Open in IMG/M
3300005983|Ga0081540_1351619Not Available504Open in IMG/M
3300006028|Ga0070717_10292039All Organisms → cellular organisms → Bacteria1448Open in IMG/M
3300006031|Ga0066651_10289543All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium873Open in IMG/M
3300006032|Ga0066696_10889776All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium567Open in IMG/M
3300006046|Ga0066652_100503115All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1126Open in IMG/M
3300006046|Ga0066652_100626494All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1017Open in IMG/M
3300006173|Ga0070716_100766913All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium744Open in IMG/M
3300006581|Ga0074048_10036583All Organisms → cellular organisms → Bacteria1008Open in IMG/M
3300006755|Ga0079222_10101687All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1512Open in IMG/M
3300006791|Ga0066653_10427414All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria677Open in IMG/M
3300006794|Ga0066658_10601409Not Available599Open in IMG/M
3300006854|Ga0075425_101632929All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria726Open in IMG/M
3300006954|Ga0079219_10034814All Organisms → cellular organisms → Bacteria2030Open in IMG/M
3300007258|Ga0099793_10555774All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria573Open in IMG/M
3300009012|Ga0066710_101483588All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1047Open in IMG/M
3300009012|Ga0066710_103773743All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium569Open in IMG/M
3300009012|Ga0066710_103842710Not Available563Open in IMG/M
3300009088|Ga0099830_10280801All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1325Open in IMG/M
3300009090|Ga0099827_10013594All Organisms → cellular organisms → Bacteria5382Open in IMG/M
3300009090|Ga0099827_10435960All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1122Open in IMG/M
3300009098|Ga0105245_10028846All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4898Open in IMG/M
3300009137|Ga0066709_100341804All Organisms → cellular organisms → Bacteria2052Open in IMG/M
3300009137|Ga0066709_100851892All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1325Open in IMG/M
3300009137|Ga0066709_101953037All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium815Open in IMG/M
3300009137|Ga0066709_103393119Not Available579Open in IMG/M
3300009137|Ga0066709_103861916Not Available544Open in IMG/M
3300009137|Ga0066709_104439039Not Available512Open in IMG/M
3300009137|Ga0066709_104451007Not Available512Open in IMG/M
3300009137|Ga0066709_104478153All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria510Open in IMG/M
3300009137|Ga0066709_104527728Not Available508Open in IMG/M
3300010326|Ga0134065_10492033Not Available509Open in IMG/M
3300010360|Ga0126372_13003133All Organisms → cellular organisms → Bacteria → Terrabacteria group523Open in IMG/M
3300010366|Ga0126379_10654446All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1141Open in IMG/M
3300010373|Ga0134128_12950908Not Available523Open in IMG/M
3300010396|Ga0134126_10759316Not Available1098Open in IMG/M
3300010396|Ga0134126_12389082Not Available575Open in IMG/M
3300011003|Ga0138514_100000736All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3740Open in IMG/M
3300011003|Ga0138514_100103021All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium620Open in IMG/M
3300011994|Ga0120157_1055378All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium842Open in IMG/M
3300011996|Ga0120156_1026893All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1075Open in IMG/M
3300012011|Ga0120152_1159922Not Available590Open in IMG/M
3300012014|Ga0120159_1037092All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1631Open in IMG/M
3300012096|Ga0137389_11756146All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium516Open in IMG/M
3300012198|Ga0137364_10059541All Organisms → cellular organisms → Bacteria2575Open in IMG/M
3300012198|Ga0137364_10317984All Organisms → cellular organisms → Bacteria1158Open in IMG/M
3300012199|Ga0137383_10924005All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria637Open in IMG/M
3300012200|Ga0137382_10085306All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp.2056Open in IMG/M
3300012200|Ga0137382_10757031All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria698Open in IMG/M
3300012201|Ga0137365_10196475All Organisms → cellular organisms → Bacteria1509Open in IMG/M
3300012202|Ga0137363_11806199All Organisms → cellular organisms → Bacteria504Open in IMG/M
3300012206|Ga0137380_11158845Not Available657Open in IMG/M
3300012206|Ga0137380_11309858Not Available609Open in IMG/M
3300012207|Ga0137381_10881606All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium774Open in IMG/M
3300012208|Ga0137376_10213683All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1670Open in IMG/M
3300012209|Ga0137379_10801246All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium847Open in IMG/M
3300012209|Ga0137379_11189633Not Available669Open in IMG/M
3300012211|Ga0137377_10994733All Organisms → cellular organisms → Bacteria → Terrabacteria group770Open in IMG/M
3300012211|Ga0137377_11533843All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium592Open in IMG/M
3300012349|Ga0137387_11070214All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium576Open in IMG/M
3300012350|Ga0137372_10323016All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1190Open in IMG/M
3300012350|Ga0137372_11052553All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium563Open in IMG/M
3300012356|Ga0137371_10502064All Organisms → cellular organisms → Bacteria936Open in IMG/M
3300012356|Ga0137371_11172414Not Available574Open in IMG/M
3300012362|Ga0137361_10977187All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium766Open in IMG/M
3300012469|Ga0150984_110261860Not Available1131Open in IMG/M
3300012507|Ga0157342_1014909All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria846Open in IMG/M
3300012582|Ga0137358_10982586Not Available547Open in IMG/M
3300012917|Ga0137395_10161705All Organisms → cellular organisms → Bacteria → Proteobacteria1539Open in IMG/M
3300012929|Ga0137404_11662263All Organisms → cellular organisms → Bacteria593Open in IMG/M
3300012955|Ga0164298_10615806All Organisms → cellular organisms → Bacteria → Terrabacteria group748Open in IMG/M
3300012955|Ga0164298_10762867All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium687Open in IMG/M
3300012958|Ga0164299_10055573All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1874Open in IMG/M
3300012960|Ga0164301_10060370All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales2003Open in IMG/M
3300012960|Ga0164301_10222221All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1220Open in IMG/M
3300012976|Ga0134076_10515860Not Available548Open in IMG/M
3300012985|Ga0164308_10192387Not Available1548Open in IMG/M
3300012985|Ga0164308_10503774All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Phycicoccus → unclassified Phycicoccus → Phycicoccus sp. Soil7481013Open in IMG/M
3300012989|Ga0164305_11140583Not Available672Open in IMG/M
3300013758|Ga0120147_1062682All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium641Open in IMG/M
3300013764|Ga0120111_1078707All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria792Open in IMG/M
3300013770|Ga0120123_1021579All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1300Open in IMG/M
3300013772|Ga0120158_10195182All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1064Open in IMG/M
3300013772|Ga0120158_10347500Not Available699Open in IMG/M
3300014326|Ga0157380_12790709Not Available555Open in IMG/M
3300014487|Ga0182000_10116256Not Available921Open in IMG/M
3300014829|Ga0120104_1064185All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria705Open in IMG/M
3300015357|Ga0134072_10154507All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium758Open in IMG/M
3300015357|Ga0134072_10167776All Organisms → cellular organisms → Bacteria → Terrabacteria group736Open in IMG/M
3300015371|Ga0132258_13845262All Organisms → cellular organisms → Bacteria1022Open in IMG/M
3300015372|Ga0132256_100008153All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia9003Open in IMG/M
3300015372|Ga0132256_100074677All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3224Open in IMG/M
3300015372|Ga0132256_101022906Not Available941Open in IMG/M
3300015374|Ga0132255_100609897All Organisms → cellular organisms → Bacteria1614Open in IMG/M
3300017959|Ga0187779_10011840All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4978Open in IMG/M
3300017966|Ga0187776_10026010All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3226Open in IMG/M
3300017974|Ga0187777_10008229All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium6595Open in IMG/M
3300018028|Ga0184608_10025600All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales2183Open in IMG/M
3300018060|Ga0187765_10718033Not Available658Open in IMG/M
3300018073|Ga0184624_10439408Not Available574Open in IMG/M
3300018081|Ga0184625_10159346All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1180Open in IMG/M
3300018431|Ga0066655_10206000All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1220Open in IMG/M
3300018431|Ga0066655_10371344Not Available941Open in IMG/M
3300018431|Ga0066655_10672982All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria700Open in IMG/M
3300018433|Ga0066667_10098008All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1942Open in IMG/M
3300018433|Ga0066667_10199444All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1469Open in IMG/M
3300018433|Ga0066667_10327793All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1205Open in IMG/M
3300018468|Ga0066662_10005974All Organisms → cellular organisms → Bacteria6016Open in IMG/M
3300018468|Ga0066662_11543076All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium692Open in IMG/M
3300018468|Ga0066662_11594199All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium681Open in IMG/M
3300018468|Ga0066662_12201172All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria578Open in IMG/M
3300018468|Ga0066662_12741690Not Available522Open in IMG/M
3300018482|Ga0066669_10552815Not Available1003Open in IMG/M
3300018482|Ga0066669_11325013All Organisms → cellular organisms → Bacteria → Terrabacteria group652Open in IMG/M
3300019255|Ga0184643_1378759All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia839Open in IMG/M
3300019887|Ga0193729_1017537All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium3137Open in IMG/M
3300019888|Ga0193751_1080328All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1304Open in IMG/M
3300019888|Ga0193751_1199614All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium671Open in IMG/M
3300020006|Ga0193735_1103498All Organisms → cellular organisms → Bacteria → Terrabacteria group791Open in IMG/M
3300022534|Ga0224452_1055360All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1182Open in IMG/M
3300022694|Ga0222623_10402666All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Microbacterium520Open in IMG/M
3300022756|Ga0222622_10422399All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria942Open in IMG/M
3300024182|Ga0247669_1014556All Organisms → cellular organisms → Bacteria → Terrabacteria group1398Open in IMG/M
3300024186|Ga0247688_1034991All Organisms → cellular organisms → Bacteria → Terrabacteria group777Open in IMG/M
3300024232|Ga0247664_1105597Not Available654Open in IMG/M
3300024245|Ga0247677_1035469Not Available721Open in IMG/M
3300025898|Ga0207692_10515712Not Available760Open in IMG/M
3300025903|Ga0207680_11207347Not Available539Open in IMG/M
3300025906|Ga0207699_11098418All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium589Open in IMG/M
3300025906|Ga0207699_11147345All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium575Open in IMG/M
3300025910|Ga0207684_10537327All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1001Open in IMG/M
3300025911|Ga0207654_10679536All Organisms → cellular organisms → Bacteria → Terrabacteria group739Open in IMG/M
3300025915|Ga0207693_10362466All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1134Open in IMG/M
3300025916|Ga0207663_10307012All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1188Open in IMG/M
3300025916|Ga0207663_10764110All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium768Open in IMG/M
3300025922|Ga0207646_10091108All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2729Open in IMG/M
3300025927|Ga0207687_10637948Not Available900Open in IMG/M
3300025930|Ga0207701_11421599All Organisms → cellular organisms → Bacteria565Open in IMG/M
3300025933|Ga0207706_10261634All Organisms → cellular organisms → Bacteria1510Open in IMG/M
3300025937|Ga0207669_10748259All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium807Open in IMG/M
3300025938|Ga0207704_11097051All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Microbacterium676Open in IMG/M
3300026067|Ga0207678_10067356All Organisms → cellular organisms → Bacteria3074Open in IMG/M
3300026312|Ga0209153_1001341All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria8598Open in IMG/M
3300026325|Ga0209152_10505329Not Available500Open in IMG/M
3300026330|Ga0209473_1052289All Organisms → cellular organisms → Bacteria1779Open in IMG/M
3300026524|Ga0209690_1154703All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium833Open in IMG/M
3300026538|Ga0209056_10308608All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1082Open in IMG/M
3300026548|Ga0209161_10427141All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria582Open in IMG/M
3300026552|Ga0209577_10243446All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1360Open in IMG/M
3300026552|Ga0209577_10250935Not Available1335Open in IMG/M
3300026552|Ga0209577_10761771All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia542Open in IMG/M
3300026899|Ga0209326_1019471Not Available540Open in IMG/M
3300027560|Ga0207981_1031488All Organisms → cellular organisms → Bacteria → Terrabacteria group963Open in IMG/M
3300027725|Ga0209178_1327056All Organisms → cellular organisms → Bacteria → Terrabacteria group569Open in IMG/M
3300027842|Ga0209580_10432142All Organisms → cellular organisms → Bacteria → Terrabacteria group656Open in IMG/M
3300027882|Ga0209590_10007777All Organisms → cellular organisms → Bacteria4835Open in IMG/M
3300028704|Ga0307321_1023111All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1103Open in IMG/M
3300028717|Ga0307298_10059082All Organisms → cellular organisms → Bacteria1058Open in IMG/M
3300028755|Ga0307316_10223929All Organisms → cellular organisms → Bacteria680Open in IMG/M
3300028787|Ga0307323_10332411All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia545Open in IMG/M
3300028807|Ga0307305_10073142All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1582Open in IMG/M
3300028819|Ga0307296_10366866All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium786Open in IMG/M
3300028878|Ga0307278_10038504All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2178Open in IMG/M
3300028884|Ga0307308_10493241Not Available587Open in IMG/M
3300031562|Ga0310886_10809091Not Available590Open in IMG/M
3300031720|Ga0307469_12502934All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia504Open in IMG/M
3300031944|Ga0310884_10053586All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1819Open in IMG/M
3300032013|Ga0310906_10542664Not Available793Open in IMG/M
3300032075|Ga0310890_11540167All Organisms → cellular organisms → Bacteria → Terrabacteria group549Open in IMG/M
3300032180|Ga0307471_101918747All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria741Open in IMG/M
3300032205|Ga0307472_101065296All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria762Open in IMG/M
3300032770|Ga0335085_10878171Not Available979Open in IMG/M
3300033500|Ga0326730_1075762All Organisms → cellular organisms → Bacteria → Terrabacteria group632Open in IMG/M
3300034820|Ga0373959_0027420All Organisms → cellular organisms → Bacteria → Terrabacteria group1132Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil20.08%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil12.05%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil10.04%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere8.84%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil8.03%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost5.22%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.41%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.01%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.61%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.61%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.61%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.61%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.61%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.20%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.20%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.20%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.20%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.20%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.20%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.20%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.20%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.20%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere1.20%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.80%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil0.80%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.80%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.80%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.80%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.80%
Switchgrass, Maize And Mischanthus LitterEngineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter0.80%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.40%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.40%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.40%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.40%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.40%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.40%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.40%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.40%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.40%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.40%
Rhizosphere SoilHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil0.40%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.40%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.40%
Sugar Cane Bagasse Incubating BioreactorEngineered → Solid Waste → Grass → Composting → Bioreactor → Sugar Cane Bagasse Incubating Bioreactor0.40%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459015Litter degradation PV4EngineeredOpen in IMG/M
2170459018Litter degradation MG2EngineeredOpen in IMG/M
2209111006Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0Host-AssociatedOpen in IMG/M
3300000156Sugar cane bagasse incubating bioreactor microbial communities from Sao Carlos, Brazil, that are aerobic and semianaerobicEngineeredOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001205Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300001333Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A21-PF)- 6 month illuminaEnvironmentalOpen in IMG/M
3300001334Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A21-65cm)- 6 month illuminaEnvironmentalOpen in IMG/M
3300001664Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - 5cm_reassembledEnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005167Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121EnvironmentalOpen in IMG/M
3300005171Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126EnvironmentalOpen in IMG/M
3300005172Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132EnvironmentalOpen in IMG/M
3300005174Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129EnvironmentalOpen in IMG/M
3300005176Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128EnvironmentalOpen in IMG/M
3300005177Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139EnvironmentalOpen in IMG/M
3300005178Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137EnvironmentalOpen in IMG/M
3300005179Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133EnvironmentalOpen in IMG/M
3300005181Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127EnvironmentalOpen in IMG/M
3300005184Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005341Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaGEnvironmentalOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005451Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130EnvironmentalOpen in IMG/M
3300005454Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136EnvironmentalOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146EnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150EnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005568Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152EnvironmentalOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005576Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157EnvironmentalOpen in IMG/M
3300005586Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140EnvironmentalOpen in IMG/M
3300005587Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005983Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1Host-AssociatedOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006581Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006791Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102EnvironmentalOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007258Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300010326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300011003Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015EnvironmentalOpen in IMG/M
3300011994Permafrost microbial communities from Nunavut, Canada - A7_65cm_12MEnvironmentalOpen in IMG/M
3300011996Permafrost microbial communities from Nunavut, Canada - A39_65cm_12MEnvironmentalOpen in IMG/M
3300012011Permafrost microbial communities from Nunavut, Canada - A30_65cm_6MEnvironmentalOpen in IMG/M
3300012014Permafrost microbial communities from Nunavut, Canada - A10_80cm_6MEnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012507Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610Host-AssociatedOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012976Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013758Permafrost microbial communities from Nunavut, Canada - A24_65cm_12MEnvironmentalOpen in IMG/M
3300013764Permafrost microbial communities from Nunavut, Canada - A28_35cm_6MEnvironmentalOpen in IMG/M
3300013770Permafrost microbial communities from Nunavut, Canada - A15_5cm_18MEnvironmentalOpen in IMG/M
3300013772Permafrost microbial communities from Nunavut, Canada - A10_80_0.25MEnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014487Bulk soil microbial communities from Mexico - Magueyal (Ma) metaGEnvironmentalOpen in IMG/M
3300014829Permafrost microbial communities from Nunavut, Canada - A10_35cm_6MEnvironmentalOpen in IMG/M
3300015357Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300017966Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MGEnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1EnvironmentalOpen in IMG/M
3300018081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1EnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019255Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019887Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2EnvironmentalOpen in IMG/M
3300019888Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2EnvironmentalOpen in IMG/M
3300020006Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2EnvironmentalOpen in IMG/M
3300022534Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1EnvironmentalOpen in IMG/M
3300022694Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coexEnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300024182Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK10EnvironmentalOpen in IMG/M
3300024186Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK29EnvironmentalOpen in IMG/M
3300024232Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK05EnvironmentalOpen in IMG/M
3300024245Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK18EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026312Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes)EnvironmentalOpen in IMG/M
3300026325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes)EnvironmentalOpen in IMG/M
3300026330Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes)EnvironmentalOpen in IMG/M
3300026524Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes)EnvironmentalOpen in IMG/M
3300026538Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)EnvironmentalOpen in IMG/M
3300026548Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes)EnvironmentalOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300026899Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027560Soil and rhizosphere microbial communities from Laval, Canada - mgLPC (SPAdes)EnvironmentalOpen in IMG/M
3300027725Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes)EnvironmentalOpen in IMG/M
3300027842Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300028704Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_379EnvironmentalOpen in IMG/M
3300028717Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158EnvironmentalOpen in IMG/M
3300028755Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356EnvironmentalOpen in IMG/M
3300028787Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381EnvironmentalOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300028878Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300031562Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031944Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1EnvironmentalOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300033500Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF7AN SIP fractionEnvironmentalOpen in IMG/M
3300034820Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
4PV_044547802170459015Switchgrass, Maize And Mischanthus LitterVIVAASGDGAMTAVILASIVVPLVVVGWLCWFFWKHRHDE
2MG_000783602170459018Switchgrass, Maize And Mischanthus LitterLLDLVRQAALDVLAATGDQAIALVIVASIVIPLAILTALCWYFWKH
22140053152209111006Arabidopsis RhizosphereVLSLLAARGDQATALVVLASIVIPLTVLGGVCWYFWRHRHDE
NODE_0744245143300000156Sugar Cane Bagasse Incubating BioreactorVLAAQGDNAIAAVIVVSIVVPLAAVGWLCWFFWKHRHDE*
JGI10216J12902_10625266623300000956SoilLQRTGHDFPVEVFATGDQATSFVILGSIIIPLAILTALCWFFWKHRHDE*
JGI10216J12902_10933340223300000956SoilMSVVAASGDEAIAVVIIASIVVPLGALGWLCWFFWKHRHDQ*
JGI10216J12902_12305746823300000956SoilMSLLAAQGDQAIAVVIVASIVVPLGALGWLCWFFWKHRHDE*
C688J13580_102274213300001205SoilVSSLVVAAGDGAVVVILASIVVPMVALAGLCWVFWKHRHDE*
A21PFW6_110678523300001333PermafrostMVDMLAANGDQATAFIILGSIVVPLALLAVVCWFFWAHRHDD*
A2165W6_103315723300001334PermafrostVDQATALVILASIVIPVAILIVVCWFFWRHRHDD*
P5cmW16_108185823300001664PermafrostVDQATALVILASIVVPVAILIFVCWFFWKHRHDE*
Ga0062589_10226838923300004156SoilMLVSAAGDQATAFVILGSIVVPLAILTAVCWFFWKHRHDD*
Ga0062590_10020825933300004157SoilMLVSAAGDQATAFVILGSIVVPLAILTAVCWFFWKHRRDD*
Ga0062595_10001470833300004479SoilMEVLAARGDQATAFVILGSIVVPLAVLAAVCWFFWKHRHDD*
Ga0062595_10034515123300004479SoilVWGLAAFSGGQATAVVILGSIVFPLLALGWLCWFFWRHRHDD*
Ga0062594_10240759023300005093SoilVLSLLAARGDQATALVVLASIVIPLAVLGGLCWYFWRHRHDD*
Ga0066672_1004599923300005167SoilVGSAVLDLVAAAGDQATAVVVVASIVVPLGILAVVCWFFWKHRHDD*
Ga0066672_1013735123300005167SoilMLAARGDQATALVILASIVIPLVVLGGLCWFFWVHRRDE*
Ga0066677_1010237423300005171SoilTVVALTGGQATAVVILGSIVFPLLAVGGLCWFFWRHRHDE*
Ga0066677_1037699813300005171SoilMGYAAIGLLAARGDQGIAVVLVASIVVPLAILTGVCWFFWKHRHDE*
Ga0066683_1075960713300005172SoilAAVLSTIAASGDQAIAFVILGSIVIPVAALGWLCWFFWKHRHDE*
Ga0066683_1090650223300005172SoilMDVLAAAGDQATAFVILGSIVIPLAILTAVCWFFWKHRDDD*
Ga0066680_1066036123300005174SoilVIFLLAAHGDQATALVILASIVVPLVVLGAVCWFFWTHRHDQ*
Ga0066679_1001214923300005176SoilVQLASGLVNTVVALTGGQATAVVILGSIVFPLLAVGGLCWFFWRHRHDE*
Ga0066690_1000246723300005177SoilVRQAALDLLAAAGDRAIALVIVASIVIPLAILTALCWYFWKHRHDG*
Ga0066690_1035710213300005177SoilVGGGAICIVAAAGDQATAVVVVASIVVPLGILAAVCWFFWKHRHDD*
Ga0066688_1025966623300005178SoilMLAARGDQATALVILASIVIPLVVLGCLCWFFWVHRRDE*
Ga0066684_1001139973300005179SoilMLAARGDQATALVILASIVIPLVVLGGLCLFFWVHRRDE*
Ga0066684_1003080853300005179SoilVVAAAGDQAIAVVVVASIVVPLAVLAAVCWFFWKHRADE*
Ga0066684_1003661133300005179SoilVRQAALDVLAAAGDQAIALVIVASIVIPLAILTALCWYFWKHRHDG*
Ga0066678_1050391323300005181SoilVLSLVAASGDRAIAIVILGSIVIPLAALGWLCWFFWKHRHDD*
Ga0066678_1070335723300005181SoilMVGLGSLVASSGGQAIAIVILASIVIPAVALGWLCWFFWKHRHDQ*
Ga0066671_1000165023300005184SoilVDVFEVLAARADQATAFVILGSIVVPLAVLAAVCLFFWRHRHDD*
Ga0066671_1008117323300005184SoilVRQAALDVLAAAGDQAIALVVVASIVIPLAILAALCWYFWKHRHDG*
Ga0066671_1046093413300005184SoilMGTAAIGLLAARGDQGIAVVLVASIVVPLAILTGVCWFFWKHRHDE*
Ga0066388_10095131233300005332Tropical Forest SoilMPSLLAARGDQATALVILASIVIPLAVLGGVCWYFWRHRNDE*
Ga0066388_10370729033300005332Tropical Forest SoilVPPLLAAHGDQAIALVILASIVIPLAALGGVSWYFWRHRHDE*
Ga0066388_10512021223300005332Tropical Forest SoilVFSLLAASGDRATELVILGSIVIPLIALGWLCWFFWVHRHDD*
Ga0070680_10097947513300005336Corn RhizosphereIGLAAAGDQAIAGVIVASIVVPLAVLGVVLWFFWKHRHDD*
Ga0070682_10000502553300005337Corn RhizosphereLLVIGLAAAGDQAIAGVIVASIVVPLAVLGVVLWFFWKHRHDD*
Ga0070691_1013017433300005341Corn, Switchgrass And Miscanthus RhizosphereREPALLIVAASGDGAIAVVILASMVVPLVVVGWLCWFFWKHRHDE*
Ga0070671_10025752213300005355Switchgrass RhizosphereAGRSSVIGLAAAGDQAIAGVIVASIVVPLALLGGVLWFFWKHRHDD*
Ga0070709_1033300423300005434Corn, Switchgrass And Miscanthus RhizosphereVLAAAGDQAIALGIVASIVIPLAILTALCWYFWKHRHDG*
Ga0070709_1083865223300005434Corn, Switchgrass And Miscanthus RhizosphereVIGLAAAGDQAIAGVIVASIVVPLALLGVVLWFFWKHRHDD*
Ga0070709_1105703513300005434Corn, Switchgrass And Miscanthus RhizosphereTPKRQRAAVLSTVAASGDQAIAFVILASIVIPLAALGWVCWFFWKHRHDE*
Ga0070713_10027855233300005436Corn, Switchgrass And Miscanthus RhizosphereVLSTVAASGDQAIAFVILASIVIPLAALGWVCWFFWKHRHDE*
Ga0070713_10030471133300005436Corn, Switchgrass And Miscanthus RhizosphereVIGLAAAGDQAIAGVIVASIVVPLAVLGVVLWFFWKHRHDD*
Ga0070711_10004854453300005439Corn, Switchgrass And Miscanthus RhizosphereVLSLLAARGDQATALVVLASIVIPLAVLGGVCWYFWRHRHDE*
Ga0070711_10012469753300005439Corn, Switchgrass And Miscanthus RhizosphereLLVICLAAAGDGAIAGVLVASIVVPLAVLGVVLWFFWKHRHDD*
Ga0070705_10022779123300005440Corn, Switchgrass And Miscanthus RhizosphereVLSVIAASGDQAIAFVILGSIVIPVAALAWLCWFFWKHRHDD*
Ga0070694_10171204313300005444Corn, Switchgrass And Miscanthus RhizosphereLLDLVRQAALDVLAAAGDQAIALVIVASIVIPLAILTALCWYFWKHRHDG*
Ga0070708_100010241133300005445Corn, Switchgrass And Miscanthus RhizosphereVLSTVAASGDQAIAFVILASIVIPLAALAWVCWLFWKHRHDE*
Ga0066681_1097272123300005451SoilLQLACGCAVLSVVAFSGGQATAVVVLGSIVFPLLAVGWLCWFFWRHRHDE*
Ga0066687_1002490823300005454SoilVDVFEVLAARADQATAFVILGSIVVPLAVLAAVCLFFWGHRHDD*
Ga0070681_1032548233300005458Corn RhizosphereVWGLAAFSGGQATAVVILVSIVFPLLALGWLCWFFWRHRHDD*
Ga0068867_10194693323300005459Miscanthus RhizosphereVGFSSLLAASGDGAIAVVIVASIVVPLLALAGLCWFFWNHRHDE*
Ga0070706_10030635633300005467Corn, Switchgrass And Miscanthus RhizosphereVLSTVAASGDQAIAFVILASIVIPLAALAWVCWFFWKHRHDE*
Ga0070741_1007349043300005529Surface SoilVALLLAAQDNGAVAIIVLGSIVVPLAGTAFLCWIFWRHRHDD*
Ga0070741_1085273223300005529Surface SoilVDLLLAAQDNGAVAIIVLGSIVVPLAGTAVLCWIFWRHRHDD*
Ga0066697_1047176123300005540SoilLQLAWGCAVFSVVAFSGGQATAVVVLGSIVFPLLAVGWLCWFFWRHRHDE*
Ga0070732_1040075233300005542Surface SoilVLSLLAASGDQATAYVILASIVIPLAVLGGVCWFFWKHRHDE*
Ga0066701_1002870033300005552SoilVDQATTFVILGSIVIPLAILTVVCWFFWKHRHDA*
Ga0066701_1015513423300005552SoilMVNVLAANGDQATAFIVLASIVVPLAVLVVVCWFFWTHRHDD*
Ga0066695_1048494723300005553SoilVVALGSLVASGGQAIAIVILASIVIPAVALGWLCWFFWKHRHD
Ga0066692_1089831023300005555SoilVLSTIADSGDQAIAFVILASIVIPLAVLGWLCWFFWKHRHDE*
Ga0066670_1073767823300005560SoilVYWLVSIALLVNVLAASGDRATAVVILGSIVIPLLAVAWLCWFFW
Ga0066699_1040379223300005561SoilAARVFALLAARGDQATALVILASIVIPLAILAAVSWYFWAHRHDE*
Ga0066703_1067538623300005568SoilNTVVALTGGQATAVVILGSIVFPLLAVGGLCWFFWRHRHDE*
Ga0066705_1034726813300005569SoilMLAARGDQATALVILASIVIPLVVLGCLCWFFWVHRRDE
Ga0066708_1016135923300005576SoilMVDMLAANGDQATAFIILGSIIVPLAALAVVCWFFWTHRHDD*
Ga0066708_1045963923300005576SoilVDQATTFVILGSIVIPLAILTVVCWFFWKHRHDD*
Ga0066691_1048503313300005586SoilAWRSLVVNVVAFSGGEATAVILLGSIVFPLLAVAWLCWFFWRHRHDE*
Ga0066654_1004038833300005587SoilMSVLAASGNGAKAVVILGSIVIPLLTVAWLCWFFWRHRHDE*
Ga0066903_10020527843300005764Tropical Forest SoilVIGLAAAGDQAIAAVVVASIVVPLAILGVVLWFFWKHRHDD*
Ga0066903_10030867243300005764Tropical Forest SoilVPPLLAAHGDQAIALVILASIVIPLAVLGGVSWYFWRHRHDE*
Ga0066903_10039821113300005764Tropical Forest SoilVLSVLAARGDQATALVIFASIVIPLAVLGGVCWYFWRHRHDD*
Ga0081540_135161923300005983Tabebuia Heterophylla RhizosphereVSSLLAAPGDQATAIVVLASIVVPLAVLGGLCWYFWRHRHDD*
Ga0070717_1029203923300006028Corn, Switchgrass And Miscanthus RhizosphereVICLAAAGDGAIAGVLVASIVVPLAVLGVVLWFFWKHRHDD*
Ga0066651_1028954323300006031SoilMDVLAAAGDQATAFVILGSIVIPLAILTAVGWFFWKHRDDD*
Ga0066696_1088977613300006032SoilVLSVVAFSGGQATAVVVLGSIVFPLLAVGWLCWFFWRHRHDE*
Ga0066652_10050311513300006046SoilVLSTVAASGDQAIAFVILGSIVIPLAALGWLCWFFWKHRHDE*
Ga0066652_10062649433300006046SoilMVDSASLAASSGGQAIAIVIVASIVIPGVALGWLCWYFWKHRHDE*
Ga0070716_10076691323300006173Corn, Switchgrass And Miscanthus RhizosphereKRQRAAVLSTVAASGDQAIAFVILASIVIPLAALGWVCWFFWKHRHDE*
Ga0074048_1003658323300006581SoilMFASGDQAIALVVLASIVIPAAALAWLCWFFWKHRHDD*
Ga0079222_1010168723300006755Agricultural SoilLAGLSAVIAAAGDGAIAGVIVGSIVVPLAILGLVLWFFWKHRHDD*
Ga0066653_1042741423300006791SoilMVDSASLAASSGGQAIAIVIVASIVIPGVALGGLCWYFWKHRHDE*
Ga0066658_1060140913300006794SoilVLTVVAVSGGTATALVILGSIVFPLLAVGWLCWFFWRHRHDE*
Ga0075425_10163292923300006854Populus RhizosphereVTDQATSFVILGSIVVPLALLGLICWYFWKHRHDD*
Ga0079219_1003481413300006954Agricultural SoilVISLAAAGDQAIAGVIVASIVVPLALLGVVLWFFWKHRHDD*
Ga0099793_1055577423300007258Vadose Zone SoilVDQATTFLILGSIVIPLAILTVVCWFFWKHRHDD*
Ga0066710_10148358823300009012Grasslands SoilVRAAIGVVAAAGDQATAFVIVASIVVPLAILSGVCWFFWKHRHDD
Ga0066710_10377374323300009012Grasslands SoilVVAAVVDQATGFVILGSIVIPLAILTAVCWFFWKHRHDD
Ga0066710_10384271023300009012Grasslands SoilVNVVAFSGGEATAVILLGSIVFPLLAVAWLCWFFWRHRHDE
Ga0099830_1028080123300009088Vadose Zone SoilVDQATALVILASIVIPLAILIVVCWFFWKHRRDD*
Ga0099827_1001359443300009090Vadose Zone SoilVIFVLAANGDQATALVILASIVIPLAVLAAVCWFFWTHRHDE*
Ga0099827_1043596023300009090Vadose Zone SoilVVSLLAARGDQATALVILASIVIPLAALAAVCWFFWTRRHDQ*
Ga0105245_1002884613300009098Miscanthus RhizosphereVLSVIAASGDQAIAFVILGSIVIPVAALAWLCWFFWKHRH
Ga0066709_10034180413300009137Grasslands SoilVNTVVALTGGQATAVVILGSIVFPLLAVGGLCWFFWRHRHDE*
Ga0066709_10085189213300009137Grasslands SoilVCLVGVQYRRVSLLAARGDQATALVIVGSIVVPLVILAVVCWIFWTHRHDD*
Ga0066709_10195303713300009137Grasslands SoilMMVDMLAANGDRATAFIVLGSIVIPLAVLAVVCWFFWTHRHDD*
Ga0066709_10339311913300009137Grasslands SoilVVSAAGDQATAFVILGSIVIPLAILTAVCWFFWKH
Ga0066709_10386191623300009137Grasslands SoilVNVVAFSGGEATAVILLGSIVFPLLAVAWLCWFFWRHR
Ga0066709_10443903913300009137Grasslands SoilMVDMLAANGDQATAFIILGSIVVPLAVLAVVCCFFWTHRHDD*
Ga0066709_10445100713300009137Grasslands SoilMADMLAANGDQATAFIILGSIVVPLAVLAVVCWFFWTHRYGD*
Ga0066709_10447815313300009137Grasslands SoilEGPVNATDVVILLSIVVPLLALGVVCWIFWQHRHDE*
Ga0066709_10452772823300009137Grasslands SoilVRAAIGVVAAAGDQVTAFVIVASIVVPLAILSGVCWFFWKHRHDD*
Ga0134065_1049203313300010326Grasslands SoilVFSVVAFSGGQATAVVVLGSIVFPLLAVGWLCWFFWRHRHDE*
Ga0126372_1300313323300010360Tropical Forest SoilSLAAAGDQAIAGVVVASIVVPLLVLGIVLWFFWKHRHDD*
Ga0126379_1065444623300010366Tropical Forest SoilMGPTALNLLAAAGAQAVSFVILGSIVIPLAILAAVCWFFWKHRHDD*
Ga0134128_1295090823300010373Terrestrial SoilVAASGDQAIAFVILASIVVPLAALGWGCWFFWKHRHDE*
Ga0134126_1075931613300010396Terrestrial SoilAVSGGTATAVVILGSIVVPLLAVGWLCWFFWRHRHDE*
Ga0134126_1238908213300010396Terrestrial SoilVLSVIAASGGQAIAFVILGSIVIPVAALAWLCWFFLKHRHDD*
Ga0138514_10000073643300011003SoilMVDVLAANGDQATAFIVLASIVVPLAVLVVVCWFFWTHRHDD*
Ga0138514_10010302123300011003SoilLSVAASGDQAIAVVIVASIVIPLAVLGWLSWFFWKHRHDD*
Ga0120157_105537823300011994PermafrostVDQATALVILASIVIPVAILIFVCWFFWKHRHDD*
Ga0120156_102689323300011996PermafrostVDQATALVILASIVIPVTILVAVCWFFWKHRHDD*
Ga0120152_115992223300012011PermafrostVTTLAAVSGGTATAVVILGSIVFPLLAVGWLCWFFWRHRHDE*
Ga0120159_103709213300012014PermafrostLINALVASGGQATAIVILGSIVFPLLAVAWLCWFFWRHRHDE*
Ga0137389_1175614623300012096Vadose Zone SoilAGVDRATAFVILGSIVIPLAILTAVCWFFWKHRHDD*
Ga0137364_1005954113300012198Vadose Zone SoilVLSTIAASGDQAIAFVILGSIVIPVAALGWLCWFFWKHRHDE
Ga0137364_1031798423300012198Vadose Zone SoilMTLAAVSGGTATAVVILGSIVFPLLAVGGLCWFFWRHRHDE*
Ga0137383_1092400523300012199Vadose Zone SoilVDQATTFVILCSIVIPLAILTVVCWFFWKHRHDA*
Ga0137382_1008530623300012200Vadose Zone SoilMTLAAVSGGTATAVVILGSIVFPLVAVGWLCWFFWRHRHDE*
Ga0137382_1075703123300012200Vadose Zone SoilLQLAWGCAVLSVVAFSGGQATAVVVLGSIVFPLLAVGWLCWFFWRHRHDE*
Ga0137365_1019647533300012201Vadose Zone SoilVVSAAGDQATAFVILGSIVIPLAILTAVCWFFWKHRHDD*
Ga0137363_1180619913300012202Vadose Zone SoilVLSTIADSGDQAIAFVILASIVIPLAALGWLCWFFWKHRHDE*
Ga0137380_1115884523300012206Vadose Zone SoilMEDMLAANGDQATAFIILGSIVVPLAVLAVVCWFFWT
Ga0137380_1130985823300012206Vadose Zone SoilVLWLVAPPGDQATALVILASIVIPLVALGWLCWFFWTRRHDE*
Ga0137381_1088160613300012207Vadose Zone SoilVVAAAVDQATAFVILGSIVIPVLILTAVCWFFWKHRHDD*
Ga0137376_1021368323300012208Vadose Zone SoilVDQGTALVILGSIVIPVAIVIVVCWFFWKHRHDD*
Ga0137379_1080124613300012209Vadose Zone SoilRVIFVLAANGDQATALVILASIVVPLVVLGAVCWFFWTRRHDD*
Ga0137379_1118963313300012209Vadose Zone SoilMTSWSELRMLSPPAGDKALAFVIVGSIVIPLAILAAVCWFFWKHRHDD*
Ga0137377_1099473323300012211Vadose Zone SoilCEAVNIMEVLAARGDQATAFVILGSIVVPLAVLAAVCWFFWKHRHDD*
Ga0137377_1153384313300012211Vadose Zone SoilVDQATALVILGSIVIPLAILTVVCWFFWKHRHDD*
Ga0137387_1107021423300012349Vadose Zone SoilVIFLLAAHGDQATALVILASIVVPLLVLGAVCWFFWTHRHDQ*
Ga0137372_1032301613300012350Vadose Zone SoilLSLAASGDQAIAVVIVASIVIPLAALGWLSWFFWKHRHDD*
Ga0137372_1105255313300012350Vadose Zone SoilMVEMLAANGDQAPAFIILGSIVVPLAVLALVCWFFWTHRHDD*
Ga0137371_1050206423300012356Vadose Zone SoilVLSTIAASGDQAIAFVILGSIMIPVAALGWLCWFFWKHRHDE*
Ga0137371_1117241413300012356Vadose Zone SoilVLSLVAASGDRAIAIVILGSIVIPLEALGWLCWFFWKHRHDD*
Ga0137361_1097718723300012362Vadose Zone SoilVLTTIADSGDQAIAFVILASIVIPLAALGWLCWFFWKHRHDE*
Ga0150984_11026186023300012469Avena Fatua RhizosphereVSSLVVAAGDGAVAVVILASIVVPMVALAGLCWVFWKHRHDE*
Ga0157342_101490933300012507Arabidopsis RhizosphereVIGLAAAGDQAIAGVIIASIVVPLAVLGVVLWFFWKHRHDD*
Ga0137358_1098258623300012582Vadose Zone SoilMTLAAVSGGTATAVVILGSIVFPLVAVGWLCWFFWRHRH
Ga0137395_1016170533300012917Vadose Zone SoilAAAGDRATAFVIFGSIVIPLAILTAVCWFFWKHRHDD*
Ga0137404_1166226323300012929Vadose Zone SoilMTLAVVSGGTATAVVILGSIVFPLLAVGWLCWFFWRHRHDE*
Ga0164298_1061580623300012955SoilMGLAAAGDQAIAGVIVASIVVPLAVLGVVLWFFWKHRHDD*
Ga0164298_1076286723300012955SoilVGVLSFVAAQGDGAIAVVIVASIVVPLVALAGLCWFFWNHRHDE*
Ga0164299_1005557323300012958SoilVLSFVAAQGDGAIAVVIVASIVVPLVALAGLCWFFWNHRHDE*
Ga0164301_1006037023300012960SoilVWGLAAFSGGQATAVVILGSIVFPSLALGWLCWFFWRHRHDD*
Ga0164301_1022222143300012960SoilLLVIGLAAAGDQAIAGVIVASIVVPLAVLGVVLWFFWKH
Ga0134076_1051586013300012976Grasslands SoilIDTLAQTDHATSFVILGSIVVPLALLALICWYFWKHRHDD*
Ga0164308_1019238733300012985SoilVGVLSLVAAQGDGAIAVVIVASIVVPLVALAGLCWFFWNHRHDE*
Ga0164308_1050377433300012985SoilVVTLAAVSGGTATAVVILGSIVVPLLAVGWLCWFFWRHRHDE*
Ga0164305_1114058323300012989SoilVERAIRFTAVLSTIAASGDQAIAFVILASIVIPLAALGWLCWFFWKHRHDE*
Ga0120147_106268223300013758PermafrostVDQATALVILASIVIPVAILIVVCWFFWRHRHDE*
Ga0120111_107870723300013764PermafrostVDQATAFVILRSIVIPLAILTVLCWFFWKHRHDE*
Ga0120123_102157923300013770PermafrostVDQATALVILASIVVPVAILIFVCWFFWKHRHDD*
Ga0120158_1019518223300013772PermafrostMVDMFAANGGQATAFIILGSIVVPLALLAVVCWFFWIHRHDD*
Ga0120158_1034750013300013772PermafrostQLACAPHVMTIAAVSGGTATAVVILGSIVVPLLAVGWLCWFFWRHRHDE*
Ga0157380_1279070933300014326Switchgrass RhizosphereMLSLAAAGDEAIAGVIVASIVVPLAVLGVVLWFFWKHRHDD*
Ga0182000_1011625633300014487SoilMGTAATGLLAARGDQGIAVVLVASIVVPLAILTGVCWFFWKHRHDD*
Ga0120104_106418523300014829PermafrostVDQATAFVILGSILIPLAILTAVCWFFWKHRHDE*
Ga0134072_1015450723300015357Grasslands SoilVLAAGGDQATTFIVLGSIVVPLVLLAVVCWFFWTHRHDD*
Ga0134072_1016777613300015357Grasslands SoilVVAAAGDQAIAVVVVASIVVPLAVLAAVCWFFWKHRADD*
Ga0132258_1384526233300015371Arabidopsis RhizosphereMSLLAARGDQATELVILGSIVVPLAILGVVCWYFWRHRHDE*
Ga0132256_10000815373300015372Arabidopsis RhizosphereLSVIGLAAAGDQAIAGVIIASIVVPLAVLGVVLWFFWKHRHDD*
Ga0132256_10007467763300015372Arabidopsis RhizosphereVLSLLAARGDQATALVVLASIVIPLAALGGLCWYFWRHRHDE*
Ga0132256_10102290613300015372Arabidopsis RhizosphereVLSLLAARGDQATALVVLASIVVPLAVLGGVCWYFWRHRHDE*
Ga0132255_10060989713300015374Arabidopsis RhizosphereVLSLLAARGDQATALVVLASIVIPLAILGGLCWYFWRPRHDD*
Ga0187779_1001184083300017959Tropical PeatlandMNVVAARGDEATAMVILASIVVPLAVLAGVCWWFWQHRHDE
Ga0187776_1002601023300017966Tropical PeatlandVWGVLASSGDQAIAAVVVASIVIPAVALGWLCWFFWKHRHDE
Ga0187777_1000822943300017974Tropical PeatlandMNVVAARGDEATAMVILASIVVPLAVLAGVCWWFWLHRHDE
Ga0184608_1002560033300018028Groundwater SedimentVLSTIAASGDQAIAFVILGSIVIPLAALGWLCWFFWKHRHDE
Ga0187765_1071803323300018060Tropical PeatlandMNVVAARGDEATAMVILASIVVPLAVLAAVCWWFWLHRHDE
Ga0184624_1043940823300018073Groundwater SedimentVLSVIAASGDQAIALVILGSIVIPVAALTWLCWFFWKHRHDD
Ga0184625_1015934623300018081Groundwater SedimentVLSVIAASGDQAIALVILGSIVIPVAALVWLCWFFWKHRHDD
Ga0066655_1020600033300018431Grasslands SoilMDVLAAAGDQATAFVILGSIVIPLAILTAVCWFFWKHRDDD
Ga0066655_1037134423300018431Grasslands SoilVLSVVAFSGGQATAVVVLGSIVFPLLAVGWLCWFFWRHRHDE
Ga0066655_1067298223300018431Grasslands SoilVRQAALDVLAAAGDQAIALVIVASIVIPLAILTALCWYFWKHRHDD
Ga0066667_1009800823300018433Grasslands SoilMVDMLAANGDQATAFIILGSIIVPLAALAVVCWFFWTHRHDD
Ga0066667_1019944413300018433Grasslands SoilAAVDQATTFVILGSIVIPLAILTVVCWFFWKHRHDD
Ga0066667_1032779323300018433Grasslands SoilMLAARGDQATALVILASIVIPLVVLGGLCWFFWVHRRDE
Ga0066662_1000597453300018468Grasslands SoilVRQAALDLLAAAGDRAIALVIVASIVIPLAILTALCWYFWKHRHDG
Ga0066662_1154307613300018468Grasslands SoilMLAARGDQGTALVILASIVIPLVVLGGLCWFFWVHRRDE
Ga0066662_1159419923300018468Grasslands SoilVYWLVSIALLVNVLAASGDRATAVVILGSIVIPLLAVAWLCWFFWRHRHDE
Ga0066662_1220117213300018468Grasslands SoilVNTVVALTGGQATAVVILGSIVFPLLAVGGLCWFFWRHRHDE
Ga0066662_1274169013300018468Grasslands SoilVGGGAICIVAAAGDQATAVVVVASIVVPLGILAAVCWFFWKHRHDD
Ga0066669_1055281523300018482Grasslands SoilVRQAALDVLAAAGDQAIALVIVASIVIPLAILTALCWYFWKHRHDG
Ga0066669_1132501313300018482Grasslands SoilVIVAAAGDQAIAGVVVASIVVPLGVLAAVCWFFWKHRADE
Ga0184643_137875923300019255Groundwater SedimentVLSLVAASGDRAIAIVILGSIVIPLAALGWLCWFFWKHRHDD
Ga0193729_101753753300019887SoilVLSTIAASGDQAIAFVILASIVIPLAALGWLCWFFWKHRHDE
Ga0193751_108032833300019888SoilLINALVASGGQATAIVILGSIVFPLLAVAWLCWFFWRHRHDE
Ga0193751_119961423300019888SoilMRFTAVLSTIAALGDQAIAFVILASIVIPLAALGWLCWFFWKHRHDE
Ga0193735_110349823300020006SoilVGVLSLLAAQGDGAIAVVIVASIVVPLVALGGLCWFFWNHRHDE
Ga0224452_105536033300022534Groundwater SedimentMLSTIAASGDQAIAFVILGSIVIPLAALGWLCWFFWKHRHDE
Ga0222623_1040266623300022694Groundwater SedimentVLSVIAASGDQAIALVILGSIVIPVAALAWLCWFFWKHRH
Ga0222622_1042239923300022756Groundwater SedimentVLSVIAASGDQAIALVILGSIVIPVAALAWLCWFFWKHRHDD
Ga0247669_101455623300024182SoilVIGLAAAGDQAIAGVIVASIVVPVAVLGVVLWFFWKHRHDD
Ga0247688_103499113300024186SoilSVIGLAAAGDQAIAGVIVASIVVPLAVLGVVLWFFWKHRHDD
Ga0247664_110559723300024232SoilVIGLAAAGDQAIAGVILASIVVPLALLGGVLWFFWKHRHDD
Ga0247677_103546923300024245SoilMGTAAIGLLAARGDQGIAVVLVASIVVPLAILTGVCWFFWKHRHDK
Ga0207692_1051571223300025898Corn, Switchgrass And Miscanthus RhizosphereLLVICVAAAGDGAIAGVLVASIVVPLAVLGVVLWFFWKHRHDD
Ga0207680_1120734723300025903Switchgrass RhizosphereLFVIGLAAAGDQAIAGVIVASIVVPLAVLGVVLWFFWKHRHDE
Ga0207699_1109841823300025906Corn, Switchgrass And Miscanthus RhizosphereMLVSAAGDQATAFVILGSIVVPLAILTAVCWFFWKHRHDD
Ga0207699_1114734513300025906Corn, Switchgrass And Miscanthus RhizosphereVRQATLDVLAAAGDQAIAVVIVASIVIPLAILTAFCWYFWKHRHDV
Ga0207684_1053732723300025910Corn, Switchgrass And Miscanthus RhizosphereVLSTVAASGDQAIAFVILASIVIPLAALAWVCWFFWKHRHDE
Ga0207654_1067953613300025911Corn RhizosphereAGLLLVIGLAAAGDQAIAGVIVASIVVPLAVLGVVLWFFWKHRHDD
Ga0207693_1036246623300025915Corn, Switchgrass And Miscanthus RhizosphereVLSLLAARGDQATALVVLASIVIPLAVLGGLCWYFWRHRHDD
Ga0207663_1030701233300025916Corn, Switchgrass And Miscanthus RhizosphereVTSLGASWGLAAFSGGQATAVVILGSIVFPLLALGWLCWFFWR
Ga0207663_1076411013300025916Corn, Switchgrass And Miscanthus RhizosphereVLSLLAARGDQATALVVLASIVIPLAVLGGVCWYFWRHRHDD
Ga0207646_1009110823300025922Corn, Switchgrass And Miscanthus RhizosphereVLSTVAASGDQAIAFVILASIVIPLAALAWVCWLFWKHRHDE
Ga0207687_1063794823300025927Miscanthus RhizosphereVGFSSLLAASGDGAIAVVIVASIVVPLLALAGLCWFFWNHRHDE
Ga0207701_1142159923300025930Corn, Switchgrass And Miscanthus RhizosphereALLIVAASGDGAITVVILASIVVPLVVVGWLCWFFWKHRHDE
Ga0207706_1026163413300025933Corn RhizosphereVLSVIAASGDQAIAFVILGSIVIPVAALAWLCWFFWKHRHDD
Ga0207669_1074825923300025937Miscanthus RhizosphereRRGGATVLSVIAASGGQAIAFVILGSIVIPVAALAWLCWFFWKHRHDD
Ga0207704_1109705123300025938Miscanthus RhizosphereVLSVIAASGDQAIAFVILGSIVIPVAALAWLCWFFWKHRHD
Ga0207678_1006735663300026067Corn RhizosphereVIGLAAAGDQAIAGVIVASIVVPLAVLGVMLWFFWKHRHDD
Ga0209153_100134173300026312SoilVDVFEVLAARADQATAFVILGSIVVPLAVLAAVCLFFWGHRHDD
Ga0209152_1050532923300026325SoilVGSAVLDLVAAAGDQATAVVVVASIVVPLGILAVVCWFFWKHRHDD
Ga0209473_105228933300026330SoilMLAARGDQATALVILASIVIPLVVLGGLCLFFWVHRRDE
Ga0209690_115470323300026524SoilMVNVLAANGDQATAFIVLASIVVPLAVLVVVCWFFWTHRHDD
Ga0209056_1030860823300026538SoilMLAANGDQATAFIILGSIIVPLAALAVVCWFFWTHRHDD
Ga0209161_1042714113300026548SoilARAPRALAMLAARGDQATALVILASIVIPLVVLGCLCWFFWVHRRDE
Ga0209577_1024344613300026552SoilVLSVVAFSGGQATAVVVLGSIVFPLLAVGWLCWFFWR
Ga0209577_1025093523300026552SoilLHASGNGATAVVIVGSIVIPLLTVAWLCWFFWRHRHDE
Ga0209577_1076177113300026552SoilMGYAAIGLLAARGDQGIAVVLVASIVVPLAILTGVCWFFWKHRHDE
Ga0209326_101947133300026899Forest SoilVIGLAAAGDQAIAGVIVASIVVPLAVLGVVLWFFWKHR
Ga0207981_103148833300027560SoilVLSVIAAPGDQAIALVILASIVIPAVVLAWLCWLFWKHRHDD
Ga0209178_132705623300027725Agricultural SoilLDLAGLSAVIAAAGDGAIAGVIVGSIVVPLAILGLVLWFFWKHRHDD
Ga0209580_1043214233300027842Surface SoilVLSLLAASGDQATAYVILASIVIPLAVLGGVCWFFWKHRHDE
Ga0209590_1000777743300027882Vadose Zone SoilVIFVLAANGDQATALVILASIVIPLAVLAAVCWFFWTHRHDE
Ga0307321_102311133300028704SoilTIAASGDQAIAFVILGSIVIPLAALGWLCWFFWKHRHDD
Ga0307298_1005908213300028717SoilLIVAASGDGAITAVVLASMVVPLVVVGWLCWFFWKHRHDE
Ga0307316_1022392923300028755SoilIVAASGDGAITAVVLASIVVPLVVVGWLCWFFWKHRHDE
Ga0307323_1033241113300028787SoilVLSVIAASGDQAIALVILGSIVIPVAALAWLCWFF
Ga0307305_1007314233300028807SoilMVDVLAANGDQATAFIVLASIVVPLAVLVVVCWFFWTHRHDD
Ga0307296_1036686613300028819SoilGSHATVLSVIAASGDQAIALVILGSIVIPVAALAWLCWFFWKHRHDD
Ga0307278_1003850413300028878SoilMVDVLAANGDQATGFIVLASIVVPLAVLVVVCWYFWTHRHDD
Ga0307308_1049324113300028884SoilLAAQGDGAIAVVIVASIVVPLVALGGLCWFFWNHRHDE
Ga0310886_1080909133300031562SoilLLVIGLAAAGDQAIAGVIVASIVVPLAVLGVVLWFFWKHRHDD
Ga0307469_1250293423300031720Hardwood Forest SoilMGNAPIGLLAARGDQGIAVVLVASIVVPLAILTGVCWFFWKHRHDE
Ga0310884_1005358633300031944SoilLLVIGLAAAGDQAIAGVIVTSIVVPLAVLGVVLWFFWKHRHDD
Ga0310906_1054266423300032013SoilVIGLAAAGDQAIAGVIVASIVVPLALLGVVLWFFWKHRHDD
Ga0310890_1154016723300032075SoilVIRLAAAGDQAIAGVIVASIVVPLAVLGVVLWFFWKHRHDD
Ga0307471_10191874723300032180Hardwood Forest SoilVTDQATSFVILGSIVVPLALLGLICWYFWKHRHDD
Ga0307472_10106529613300032205Hardwood Forest SoilMSLLAARGDQATALVILASIVIPLAALGSVCWYFWRHRHDE
Ga0335085_1087817113300032770SoilMWGVLANSGDQAIEAVIVASIVVPAIVLGWLCWFFWKHRHDE
Ga0326730_107576213300033500Peat SoilVLSVIAASGDQAITLVILGSIVIPAVVLAWLCWFFWKHRHDD
Ga0373959_0027420_486_6173300034820Rhizosphere SoilMLVIGLAAAGDQAIAGVIVASIVVPLAVLGVVLWFFWKHRHDD


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.