Basic Information | |
---|---|
Family ID | F016273 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 248 |
Average Sequence Length | 47 residues |
Representative Sequence | MNQTEEAILISWRLQQWYEGMVLDARAMQDLQDAIEMLKTLAKQVQK |
Number of Associated Samples | 130 |
Number of Associated Scaffolds | 248 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 14.92 % |
% of genes near scaffold ends (potentially truncated) | 13.71 % |
% of genes from short scaffolds (< 2000 bps) | 67.34 % |
Associated GOLD sequencing projects | 118 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.51 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (58.871 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (25.000 % of family members) |
Environment Ontology (ENVO) | Unclassified (59.677 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (60.081 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.00% β-sheet: 0.00% Coil/Unstructured: 48.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 248 Family Scaffolds |
---|---|---|
PF00436 | SSB | 40.32 |
PF04404 | ERF | 7.66 |
PF10108 | DNA_pol_B_exo2 | 2.82 |
PF13392 | HNH_3 | 2.42 |
PF14090 | HTH_39 | 2.02 |
PF12705 | PDDEXK_1 | 2.02 |
PF14549 | P22_Cro | 1.61 |
PF09374 | PG_binding_3 | 1.61 |
PF03237 | Terminase_6N | 0.81 |
PF15943 | YdaS_antitoxin | 0.81 |
PF07102 | YbcO | 0.81 |
PF00149 | Metallophos | 0.40 |
PF05866 | RusA | 0.40 |
PF01242 | PTPS | 0.40 |
PF00583 | Acetyltransf_1 | 0.40 |
PF07120 | DUF1376 | 0.40 |
PF00145 | DNA_methylase | 0.40 |
PF05050 | Methyltransf_21 | 0.40 |
PF11351 | GTA_holin_3TM | 0.40 |
PF01973 | MptE-like | 0.40 |
PF00166 | Cpn10 | 0.40 |
PF11134 | Phage_stabilise | 0.40 |
PF16786 | RecA_dep_nuc | 0.40 |
PF01507 | PAPS_reduct | 0.40 |
PF01464 | SLT | 0.40 |
COG ID | Name | Functional Category | % Frequency in 248 Family Scaffolds |
---|---|---|---|
COG0629 | Single-stranded DNA-binding protein | Replication, recombination and repair [L] | 40.32 |
COG2965 | Primosomal replication protein N | Replication, recombination and repair [L] | 40.32 |
COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 0.40 |
COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 0.40 |
COG0720 | 6-pyruvoyl-tetrahydropterin synthase | Coenzyme transport and metabolism [H] | 0.40 |
COG3756 | Uncharacterized conserved protein YdaU, DUF1376 family | Function unknown [S] | 0.40 |
COG4570 | Holliday junction resolvase RusA (prophage-encoded endonuclease) | Replication, recombination and repair [L] | 0.40 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 91.53 % |
Unclassified | root | N/A | 8.47 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000405|LV_Brine_h2_0102DRAFT_1001658 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6242 | Open in IMG/M |
3300000558|Draft_11497218 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 697 | Open in IMG/M |
3300001605|Draft_10000421 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 58883 | Open in IMG/M |
3300001605|Draft_10111600 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1941 | Open in IMG/M |
3300001605|Draft_10529810 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 613 | Open in IMG/M |
3300002098|JGI24219J26650_1041288 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfurellales → unclassified Desulfurellales → Desulfurellales bacterium | 533 | Open in IMG/M |
3300002835|B570J40625_100002484 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 34401 | Open in IMG/M |
3300002835|B570J40625_100117956 | All Organisms → Viruses → Predicted Viral | 3175 | Open in IMG/M |
3300002930|Water_100248 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 12334 | Open in IMG/M |
3300003393|JGI25909J50240_1100201 | Not Available | 575 | Open in IMG/M |
3300004448|Ga0065861_1067679 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2888 | Open in IMG/M |
3300004460|Ga0066222_1159432 | All Organisms → cellular organisms → Bacteria | 925 | Open in IMG/M |
3300004460|Ga0066222_1159433 | All Organisms → Viruses → Predicted Viral | 1460 | Open in IMG/M |
3300004461|Ga0066223_1256553 | All Organisms → cellular organisms → Bacteria | 1099 | Open in IMG/M |
3300004481|Ga0069718_15908644 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 788 | Open in IMG/M |
3300004481|Ga0069718_15990962 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 945 | Open in IMG/M |
3300004693|Ga0065167_1009641 | All Organisms → cellular organisms → Bacteria | 1477 | Open in IMG/M |
3300004774|Ga0007794_10054801 | All Organisms → cellular organisms → Bacteria | 1189 | Open in IMG/M |
3300004805|Ga0007792_10031875 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1599 | Open in IMG/M |
3300005581|Ga0049081_10006550 | All Organisms → cellular organisms → Bacteria | 4405 | Open in IMG/M |
3300005581|Ga0049081_10049333 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1595 | Open in IMG/M |
3300005583|Ga0049085_10006099 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4783 | Open in IMG/M |
3300005584|Ga0049082_10197340 | Not Available | 690 | Open in IMG/M |
3300005584|Ga0049082_10284566 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
3300006484|Ga0070744_10000277 | All Organisms → cellular organisms → Bacteria | 14420 | Open in IMG/M |
3300006484|Ga0070744_10003637 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4639 | Open in IMG/M |
3300006484|Ga0070744_10013320 | All Organisms → cellular organisms → Bacteria | 2439 | Open in IMG/M |
3300006484|Ga0070744_10066113 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Achromobacter | 1052 | Open in IMG/M |
3300006484|Ga0070744_10084381 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 921 | Open in IMG/M |
3300006803|Ga0075467_10626867 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 549 | Open in IMG/M |
3300006805|Ga0075464_10764313 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
3300006920|Ga0070748_1167343 | All Organisms → cellular organisms → Bacteria | 813 | Open in IMG/M |
3300006920|Ga0070748_1304785 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae | 566 | Open in IMG/M |
3300007276|Ga0070747_1132469 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 904 | Open in IMG/M |
3300007538|Ga0099851_1186239 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
3300007559|Ga0102828_1033602 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1158 | Open in IMG/M |
3300007734|Ga0104986_1816 | All Organisms → Viruses | 34310 | Open in IMG/M |
3300008999|Ga0102816_1172622 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 673 | Open in IMG/M |
3300009026|Ga0102829_1247428 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 586 | Open in IMG/M |
3300009037|Ga0105093_10699116 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfurellales → unclassified Desulfurellales → Desulfurellales bacterium | 582 | Open in IMG/M |
3300009068|Ga0114973_10038895 | All Organisms → cellular organisms → Bacteria | 2844 | Open in IMG/M |
3300009068|Ga0114973_10618948 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 554 | Open in IMG/M |
3300009081|Ga0105098_10510961 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 614 | Open in IMG/M |
3300009081|Ga0105098_10666049 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 549 | Open in IMG/M |
3300009082|Ga0105099_10088697 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1683 | Open in IMG/M |
3300009082|Ga0105099_10712147 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 623 | Open in IMG/M |
3300009085|Ga0105103_10841224 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfurellales → unclassified Desulfurellales → Desulfurellales bacterium | 535 | Open in IMG/M |
3300009151|Ga0114962_10002554 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15107 | Open in IMG/M |
3300009151|Ga0114962_10142584 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1448 | Open in IMG/M |
3300009151|Ga0114962_10203994 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1153 | Open in IMG/M |
3300009151|Ga0114962_10300987 | All Organisms → cellular organisms → Bacteria | 895 | Open in IMG/M |
3300009151|Ga0114962_10555393 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
3300009152|Ga0114980_10665422 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 585 | Open in IMG/M |
3300009152|Ga0114980_10774803 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 534 | Open in IMG/M |
3300009154|Ga0114963_10048433 | All Organisms → cellular organisms → Bacteria | 2725 | Open in IMG/M |
3300009154|Ga0114963_10050266 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2666 | Open in IMG/M |
3300009155|Ga0114968_10009061 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7237 | Open in IMG/M |
3300009155|Ga0114968_10023295 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4234 | Open in IMG/M |
3300009155|Ga0114968_10072735 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2152 | Open in IMG/M |
3300009155|Ga0114968_10128342 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1524 | Open in IMG/M |
3300009155|Ga0114968_10306781 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 886 | Open in IMG/M |
3300009155|Ga0114968_10528870 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 630 | Open in IMG/M |
3300009159|Ga0114978_10004927 | Not Available | 10725 | Open in IMG/M |
3300009159|Ga0114978_10101426 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1900 | Open in IMG/M |
3300009159|Ga0114978_10451381 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 762 | Open in IMG/M |
3300009159|Ga0114978_10585001 | Not Available | 646 | Open in IMG/M |
3300009160|Ga0114981_10629032 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 569 | Open in IMG/M |
3300009161|Ga0114966_10670788 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 571 | Open in IMG/M |
3300009163|Ga0114970_10049015 | All Organisms → cellular organisms → Bacteria | 2735 | Open in IMG/M |
3300009163|Ga0114970_10737760 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 521 | Open in IMG/M |
3300009164|Ga0114975_10147418 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1347 | Open in IMG/M |
3300009164|Ga0114975_10475776 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
3300009165|Ga0105102_10006674 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4268 | Open in IMG/M |
3300009165|Ga0105102_10151007 | All Organisms → cellular organisms → Bacteria | 1132 | Open in IMG/M |
3300009165|Ga0105102_10345080 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
3300009170|Ga0105096_10161446 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1129 | Open in IMG/M |
3300009180|Ga0114979_10109480 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1704 | Open in IMG/M |
3300009180|Ga0114979_10381465 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
3300009181|Ga0114969_10042232 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3090 | Open in IMG/M |
3300009181|Ga0114969_10175762 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1329 | Open in IMG/M |
3300009183|Ga0114974_10329004 | All Organisms → cellular organisms → Bacteria | 891 | Open in IMG/M |
3300009183|Ga0114974_10740028 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
3300009184|Ga0114976_10337608 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 799 | Open in IMG/M |
3300009184|Ga0114976_10484913 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 639 | Open in IMG/M |
3300009184|Ga0114976_10672997 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 520 | Open in IMG/M |
3300009185|Ga0114971_10165607 | Not Available | 1324 | Open in IMG/M |
3300009185|Ga0114971_10326768 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 882 | Open in IMG/M |
3300009194|Ga0114983_1014555 | All Organisms → cellular organisms → Bacteria | 2194 | Open in IMG/M |
3300010158|Ga0114960_10373754 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 701 | Open in IMG/M |
3300010885|Ga0133913_10280638 | All Organisms → Viruses → Predicted Viral | 4418 | Open in IMG/M |
3300010885|Ga0133913_10964700 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2208 | Open in IMG/M |
3300010885|Ga0133913_11126136 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2019 | Open in IMG/M |
3300010885|Ga0133913_11650711 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1614 | Open in IMG/M |
3300010885|Ga0133913_11729438 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1570 | Open in IMG/M |
3300010885|Ga0133913_12358748 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1304 | Open in IMG/M |
3300010885|Ga0133913_12822993 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1169 | Open in IMG/M |
3300010885|Ga0133913_12940000 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1140 | Open in IMG/M |
3300011334|Ga0153697_1416 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 13113 | Open in IMG/M |
3300012012|Ga0153799_1061858 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 681 | Open in IMG/M |
3300012760|Ga0138273_1101069 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 518 | Open in IMG/M |
3300013004|Ga0164293_10320030 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1068 | Open in IMG/M |
3300013005|Ga0164292_10294068 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1113 | Open in IMG/M |
3300013005|Ga0164292_11059365 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 503 | Open in IMG/M |
3300013285|Ga0136642_1001263 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 11118 | Open in IMG/M |
3300014811|Ga0119960_1007429 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 979 | Open in IMG/M |
3300014811|Ga0119960_1071405 | Not Available | 610 | Open in IMG/M |
3300015050|Ga0181338_1001709 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3937 | Open in IMG/M |
3300015050|Ga0181338_1002623 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 3143 | Open in IMG/M |
3300015050|Ga0181338_1003836 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2593 | Open in IMG/M |
3300015050|Ga0181338_1005413 | All Organisms → cellular organisms → Bacteria | 2153 | Open in IMG/M |
3300015050|Ga0181338_1009856 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1574 | Open in IMG/M |
3300015050|Ga0181338_1012756 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1361 | Open in IMG/M |
3300015050|Ga0181338_1017887 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1120 | Open in IMG/M |
3300015050|Ga0181338_1037682 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 725 | Open in IMG/M |
3300017700|Ga0181339_1027182 | Not Available | 633 | Open in IMG/M |
3300017701|Ga0181364_1045948 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 689 | Open in IMG/M |
3300017716|Ga0181350_1004351 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4102 | Open in IMG/M |
3300017716|Ga0181350_1015636 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2148 | Open in IMG/M |
3300017716|Ga0181350_1019115 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1927 | Open in IMG/M |
3300017716|Ga0181350_1050941 | Not Available | 1100 | Open in IMG/M |
3300017716|Ga0181350_1155537 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 531 | Open in IMG/M |
3300017716|Ga0181350_1157656 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 527 | Open in IMG/M |
3300017722|Ga0181347_1140324 | Not Available | 665 | Open in IMG/M |
3300017723|Ga0181362_1116006 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 526 | Open in IMG/M |
3300017754|Ga0181344_1103603 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 825 | Open in IMG/M |
3300017754|Ga0181344_1236837 | Not Available | 507 | Open in IMG/M |
3300017774|Ga0181358_1039551 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1816 | Open in IMG/M |
3300017774|Ga0181358_1121536 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 917 | Open in IMG/M |
3300017777|Ga0181357_1088790 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1179 | Open in IMG/M |
3300017777|Ga0181357_1223219 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 664 | Open in IMG/M |
3300017784|Ga0181348_1166150 | Not Available | 815 | Open in IMG/M |
3300017785|Ga0181355_1230633 | Not Available | 716 | Open in IMG/M |
3300017785|Ga0181355_1278745 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 634 | Open in IMG/M |
3300018420|Ga0181563_10779191 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 524 | Open in IMG/M |
3300019783|Ga0181361_109631 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 751 | Open in IMG/M |
3300019784|Ga0181359_1003523 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4812 | Open in IMG/M |
3300019784|Ga0181359_1012327 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3090 | Open in IMG/M |
3300019784|Ga0181359_1031386 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2053 | Open in IMG/M |
3300019784|Ga0181359_1103447 | All Organisms → Viruses → Predicted Viral | 1041 | Open in IMG/M |
3300019784|Ga0181359_1162965 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 754 | Open in IMG/M |
3300019784|Ga0181359_1206854 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 628 | Open in IMG/M |
3300019938|Ga0194032_1000166 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7488 | Open in IMG/M |
3300020157|Ga0194049_1201916 | Not Available | 541 | Open in IMG/M |
3300020172|Ga0211729_10123122 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 706 | Open in IMG/M |
3300020172|Ga0211729_11252466 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7130 | Open in IMG/M |
3300020205|Ga0211731_10454571 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1057 | Open in IMG/M |
3300020205|Ga0211731_10931003 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2131 | Open in IMG/M |
3300020205|Ga0211731_11229369 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4318 | Open in IMG/M |
3300020506|Ga0208091_1000329 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9460 | Open in IMG/M |
3300020534|Ga0208596_1036370 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 700 | Open in IMG/M |
3300021139|Ga0214166_1010519 | All Organisms → cellular organisms → Bacteria | 2638 | Open in IMG/M |
3300021354|Ga0194047_10032880 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2452 | Open in IMG/M |
3300021354|Ga0194047_10177458 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 857 | Open in IMG/M |
3300021519|Ga0194048_10000281 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 24135 | Open in IMG/M |
3300021519|Ga0194048_10161437 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 839 | Open in IMG/M |
3300021600|Ga0194059_1159978 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 685 | Open in IMG/M |
3300021961|Ga0222714_10100181 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1835 | Open in IMG/M |
3300021962|Ga0222713_10038018 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3793 | Open in IMG/M |
3300022063|Ga0212029_1065723 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 532 | Open in IMG/M |
3300022190|Ga0181354_1165270 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 683 | Open in IMG/M |
3300022407|Ga0181351_1152224 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae | 830 | Open in IMG/M |
3300022407|Ga0181351_1238541 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 576 | Open in IMG/M |
3300023184|Ga0214919_10001742 | Not Available | 35163 | Open in IMG/M |
3300023301|Ga0209414_1002209 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8898 | Open in IMG/M |
3300024346|Ga0244775_10001392 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 28252 | Open in IMG/M |
3300024346|Ga0244775_10001864 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 23722 | Open in IMG/M |
3300024346|Ga0244775_10131506 | All Organisms → cellular organisms → Bacteria | 2118 | Open in IMG/M |
3300024346|Ga0244775_10247541 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1486 | Open in IMG/M |
3300024346|Ga0244775_10622318 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 875 | Open in IMG/M |
3300025436|Ga0208103_1044124 | Not Available | 616 | Open in IMG/M |
3300025447|Ga0208102_1018100 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1227 | Open in IMG/M |
3300025595|Ga0208248_1018205 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1686 | Open in IMG/M |
3300025616|Ga0208613_1013973 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2068 | Open in IMG/M |
3300027365|Ga0209300_1024997 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1260 | Open in IMG/M |
3300027608|Ga0208974_1059054 | Not Available | 1085 | Open in IMG/M |
3300027627|Ga0208942_1023183 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1996 | Open in IMG/M |
3300027693|Ga0209704_1006063 | All Organisms → Viruses → Predicted Viral | 2739 | Open in IMG/M |
3300027693|Ga0209704_1181511 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 613 | Open in IMG/M |
3300027708|Ga0209188_1000794 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 28499 | Open in IMG/M |
3300027708|Ga0209188_1001697 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 17180 | Open in IMG/M |
3300027708|Ga0209188_1004485 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9204 | Open in IMG/M |
3300027721|Ga0209492_1009702 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3203 | Open in IMG/M |
3300027746|Ga0209597_1127074 | Not Available | 1116 | Open in IMG/M |
3300027749|Ga0209084_1135904 | All Organisms → Viruses → Predicted Viral | 1044 | Open in IMG/M |
3300027754|Ga0209596_1000718 | Not Available | 30398 | Open in IMG/M |
3300027754|Ga0209596_1010627 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6107 | Open in IMG/M |
3300027754|Ga0209596_1022114 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3779 | Open in IMG/M |
3300027754|Ga0209596_1086237 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1516 | Open in IMG/M |
3300027754|Ga0209596_1147496 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1051 | Open in IMG/M |
3300027754|Ga0209596_1367987 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 549 | Open in IMG/M |
3300027759|Ga0209296_1221274 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium | 796 | Open in IMG/M |
3300027759|Ga0209296_1312382 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 620 | Open in IMG/M |
3300027782|Ga0209500_10211082 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 870 | Open in IMG/M |
3300027797|Ga0209107_10011015 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5100 | Open in IMG/M |
3300027892|Ga0209550_10088508 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2352 | Open in IMG/M |
3300027892|Ga0209550_10633412 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 624 | Open in IMG/M |
3300028025|Ga0247723_1000286 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 33923 | Open in IMG/M |
3300028025|Ga0247723_1002094 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10948 | Open in IMG/M |
3300028025|Ga0247723_1024179 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2000 | Open in IMG/M |
3300028025|Ga0247723_1042151 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1352 | Open in IMG/M |
3300028025|Ga0247723_1086086 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Azonexaceae → Quatrionicoccus → Quatrionicoccus australiensis | 818 | Open in IMG/M |
3300031707|Ga0315291_10137366 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2578 | Open in IMG/M |
3300031707|Ga0315291_10623340 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 974 | Open in IMG/M |
3300031707|Ga0315291_10798710 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 822 | Open in IMG/M |
3300031746|Ga0315293_10214352 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1577 | Open in IMG/M |
3300031746|Ga0315293_10311023 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1261 | Open in IMG/M |
3300031746|Ga0315293_10611136 | Not Available | 824 | Open in IMG/M |
3300031746|Ga0315293_10896054 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 641 | Open in IMG/M |
3300031772|Ga0315288_10429344 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1328 | Open in IMG/M |
3300031952|Ga0315294_10236486 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1792 | Open in IMG/M |
3300031997|Ga0315278_10200756 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2052 | Open in IMG/M |
3300031997|Ga0315278_11868128 | Not Available | 565 | Open in IMG/M |
3300031999|Ga0315274_10010872 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 13086 | Open in IMG/M |
3300031999|Ga0315274_10209330 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2407 | Open in IMG/M |
3300031999|Ga0315274_10582038 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1242 | Open in IMG/M |
3300031999|Ga0315274_11357924 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 688 | Open in IMG/M |
3300031999|Ga0315274_12062510 | Not Available | 509 | Open in IMG/M |
3300032046|Ga0315289_10722428 | All Organisms → cellular organisms → Bacteria | 896 | Open in IMG/M |
3300032053|Ga0315284_10619675 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1287 | Open in IMG/M |
3300032053|Ga0315284_11017212 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 932 | Open in IMG/M |
3300032118|Ga0315277_10754431 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 927 | Open in IMG/M |
3300032118|Ga0315277_11327468 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 629 | Open in IMG/M |
3300032156|Ga0315295_11758650 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales | 589 | Open in IMG/M |
3300032156|Ga0315295_12293240 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 500 | Open in IMG/M |
3300032342|Ga0315286_10516618 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1242 | Open in IMG/M |
3300032397|Ga0315287_10116805 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3052 | Open in IMG/M |
3300033992|Ga0334992_0504187 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 524 | Open in IMG/M |
3300033993|Ga0334994_0013521 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5545 | Open in IMG/M |
3300033993|Ga0334994_0413161 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 649 | Open in IMG/M |
3300033994|Ga0334996_0037232 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3081 | Open in IMG/M |
3300034012|Ga0334986_0006642 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8669 | Open in IMG/M |
3300034018|Ga0334985_0001572 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 18167 | Open in IMG/M |
3300034061|Ga0334987_0036835 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4207 | Open in IMG/M |
3300034061|Ga0334987_0146153 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1737 | Open in IMG/M |
3300034061|Ga0334987_0200763 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1403 | Open in IMG/M |
3300034061|Ga0334987_0623028 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 633 | Open in IMG/M |
3300034062|Ga0334995_0038903 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4002 | Open in IMG/M |
3300034062|Ga0334995_0120739 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1944 | Open in IMG/M |
3300034062|Ga0334995_0195956 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1409 | Open in IMG/M |
3300034062|Ga0334995_0235971 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1243 | Open in IMG/M |
3300034062|Ga0334995_0735310 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 550 | Open in IMG/M |
3300034104|Ga0335031_0029136 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4025 | Open in IMG/M |
3300034104|Ga0335031_0104975 | All Organisms → Viruses → Predicted Viral | 1988 | Open in IMG/M |
3300034104|Ga0335031_0402298 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 860 | Open in IMG/M |
3300034106|Ga0335036_0003026 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 14542 | Open in IMG/M |
3300034106|Ga0335036_0024807 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4772 | Open in IMG/M |
3300034106|Ga0335036_0030217 | All Organisms → Viruses → Predicted Viral | 4268 | Open in IMG/M |
3300034356|Ga0335048_0392344 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 691 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 25.00% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 16.13% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 10.48% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 10.08% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 5.24% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 4.03% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.23% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 2.82% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 2.82% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 2.82% |
Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 2.42% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 2.02% |
Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 2.02% |
Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 1.61% |
Hydrocarbon Resource Environments | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments | 1.61% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.21% |
Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.81% |
Aquatic | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Aquatic | 0.81% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.81% |
Hypersaline | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline | 0.81% |
Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.81% |
Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic | 0.40% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 0.40% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.40% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.40% |
Estuary Water | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuary Water | 0.40% |
Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.40% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000405 | Hypersaline microbial communities from Lake Vida, Antarctica - sample: Brine Hole Two 0.1-0.2 micron | Environmental | Open in IMG/M |
3300000558 | Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - West In Pit SyncrudeMLSB2011 | Engineered | Open in IMG/M |
3300001605 | Tailings pond microbial communities from Northern Alberta - Syncrude Mildred Lake Settling Basin | Engineered | Open in IMG/M |
3300002098 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-B7 metagenome | Environmental | Open in IMG/M |
3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
3300002930 | Estuary water microbial communities from Pearl Estuary, Zhujiang, China | Environmental | Open in IMG/M |
3300003393 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD | Environmental | Open in IMG/M |
3300004448 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
3300004460 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
3300004461 | Marine viral communities from Newfoundland, Canada BC-2 | Environmental | Open in IMG/M |
3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
3300004693 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA7.5M (version 2) | Environmental | Open in IMG/M |
3300004774 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA5M | Environmental | Open in IMG/M |
3300004805 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA6M | Environmental | Open in IMG/M |
3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
3300005583 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF | Environmental | Open in IMG/M |
3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
3300006803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA | Environmental | Open in IMG/M |
3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
3300007734 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015Jan | Environmental | Open in IMG/M |
3300008999 | Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.545 | Environmental | Open in IMG/M |
3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
3300009037 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
3300009082 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
3300009170 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
3300009185 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG | Environmental | Open in IMG/M |
3300009194 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 RT | Environmental | Open in IMG/M |
3300010158 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG | Environmental | Open in IMG/M |
3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
3300011334 | Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Daesung | Environmental | Open in IMG/M |
3300012012 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m | Environmental | Open in IMG/M |
3300012760 | Freshwater microbial communities from Lake Croche, Canada - C_130709_M_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
3300013285 | Freshwater microbial communities from Lower Cathedral Lake, Yosemite National Park, California, USA - 13028-31Y | Environmental | Open in IMG/M |
3300014811 | Aquatic viral communities from ballast water - Michigan State University - AB_ballast water | Environmental | Open in IMG/M |
3300015050 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017700 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.D.D | Environmental | Open in IMG/M |
3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300018420 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300019783 | Freshwater viral communities from Lake Michigan, USA - Sp13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300019938 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW8Nov16_MG | Environmental | Open in IMG/M |
3300020157 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L224-25m | Environmental | Open in IMG/M |
3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
3300020506 | Freshwater microbial communities from Lake Mendota, WI - 26OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020534 | Freshwater microbial communities from Lake Mendota, WI - 12JUL2011 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300021139 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 18AUG2009 epilimnion | Environmental | Open in IMG/M |
3300021354 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L221-5m | Environmental | Open in IMG/M |
3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
3300021600 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L626-11m | Environmental | Open in IMG/M |
3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
3300022063 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v2) | Environmental | Open in IMG/M |
3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
3300023301 | Hypersaline microbial communities from Lake Vida, Antarctica - Brine Hole Two >0.2 micron (SPAdes) | Environmental | Open in IMG/M |
3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
3300025436 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA7.5M (SPAdes) | Environmental | Open in IMG/M |
3300025447 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA17M (SPAdes) | Environmental | Open in IMG/M |
3300025595 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA5M (SPAdes) | Environmental | Open in IMG/M |
3300025616 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA6M (SPAdes) | Environmental | Open in IMG/M |
3300027365 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 RT (SPAdes) | Environmental | Open in IMG/M |
3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027627 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027693 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 (SPAdes) | Environmental | Open in IMG/M |
3300027708 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027721 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes) | Environmental | Open in IMG/M |
3300027746 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027749 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
3300031952 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40 | Environmental | Open in IMG/M |
3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
3300032046 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40 | Environmental | Open in IMG/M |
3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
3300032118 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15 | Environmental | Open in IMG/M |
3300032156 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0 | Environmental | Open in IMG/M |
3300032342 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0 | Environmental | Open in IMG/M |
3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
3300033992 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035 | Environmental | Open in IMG/M |
3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
3300033994 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046 | Environmental | Open in IMG/M |
3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
3300034018 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME04Jul2014-rr0021 | Environmental | Open in IMG/M |
3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
3300034356 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
LV_Brine_h2_0102DRAFT_10016589 | 3300000405 | Hypersaline | MNQTEEAILISWRLQQWYEGMVLDPRAMQDVQDAIEMLKLLAKQVQK* |
Draft_114972182 | 3300000558 | Hydrocarbon Resource Environments | MNKSEQAYLTAWRLQQWYEGMVLDQRAMQDLQDAIELLKQLAKQVQK* |
Draft_1000042112 | 3300001605 | Hydrocarbon Resource Environments | MYPYSFAEKKMNTQEQAFLISWRLQQWHEGMVLDSRAMQDVQDAIEMLKKLAKQVKN* |
Draft_101116002 | 3300001605 | Hydrocarbon Resource Environments | MNQSEEAYLKAWRLQQWYEGMVLDQRAMQDLQDAIEMLKKLAKQVQK* |
Draft_105298102 | 3300001605 | Hydrocarbon Resource Environments | MTKSEQAILISWRLQQWYEGMVLDQRAMQDLEDAIEMLKQLAKQVQK* |
JGI24219J26650_10412882 | 3300002098 | Lentic | MTQTEEAILISWRIQQWYEGMVLDPRAMQDLQDAIEMLKKLAKQVQK* |
B570J40625_1000024843 | 3300002835 | Freshwater | MTQTEEAILISWRLQQWYEGMVLDARAMQDLQDAIEMLKTLAKQVQK* |
B570J40625_1001179569 | 3300002835 | Freshwater | MTQSEEAILISWRLQQWYLGMVLDARAMQDLQDAIEMLKTLAKQVQK* |
Water_1002487 | 3300002930 | Estuary Water | MTQLEEAILISWRLQQWYEGMVLDARAMQDLQDAIEMLKQLAKQVQK* |
JGI25909J50240_11002011 | 3300003393 | Freshwater Lake | RHRCPVGGHDRRCPVLMTQTEEAILISWRLQQWYEGMVLDNRAVQDLQDAIEMLKTLAKQVQK* |
Ga0065861_10676795 | 3300004448 | Marine | MTQTEEAILISWRIQQWYEGMVLDARAMQDLQDAIEMLKTLAKQVNK* |
Ga0066222_11594322 | 3300004460 | Marine | MTQSEEAILISWRLQQWYEGMVLDARAMQDLQDAIEMLKQLAKVQK* |
Ga0066222_11594333 | 3300004460 | Marine | MNQTEQAILISWRLQQWHEGMVLDVRAMQDLQDAIEMLKKLAKQVQK* |
Ga0066223_12565532 | 3300004461 | Marine | MTQTEEAILISWRLQQWYIGMILDNRAMQDLQDAIEMLKTLAKQVNK* |
Ga0069718_159086441 | 3300004481 | Sediment | MTQTEEAILISWRLQQWYEGMVLDQRAMQDVQDAIEMLKKLSKQVNK* |
Ga0069718_159909623 | 3300004481 | Sediment | MNKTEEAILISWRLQQWYEGMVLDTRAMQDLQDAIEMLKTLAKQVQK* |
Ga0065167_10096413 | 3300004693 | Freshwater | MNQTEEAILISWRIQQWYENMVLDARAMQDLQDAIEMLKTLAKQVQK* |
Ga0007794_100548014 | 3300004774 | Freshwater | MNQTEQAILISWRLQQWYEGMVLDARAMQDLQDAIEMLKKLAKQVQK* |
Ga0007792_100318753 | 3300004805 | Freshwater | MNQTEEAILISWRLQQWYEGMVLDVRAMQDLQDAIEMLKKLAKQVQK* |
Ga0049081_1000655014 | 3300005581 | Freshwater Lentic | MTQTEEAILISWRLQQWYEGMVLDARAMQDLQDAIEMLKQLAKQVQK* |
Ga0049081_100493333 | 3300005581 | Freshwater Lentic | MTQTEEAILISWRLQQWYQGMVLDQRAMQDLQDAIEMLKTLTKQVQK* |
Ga0049085_100060999 | 3300005583 | Freshwater Lentic | MNQTEEAILISWRLQQWYEGMVLDARAMQDLQDAIEMLKTFAKQVNK* |
Ga0049082_101973402 | 3300005584 | Freshwater Lentic | MTQTEEAILVSWRLQQWYEGMVLDPRAMQDLQDAIEMLKQLTKQVQK* |
Ga0049082_102845662 | 3300005584 | Freshwater Lentic | MNQTEEAILISWRLQQWYEGMVLDARAMQDLQDAIEMLKTLAKQVQK* |
Ga0070744_1000027725 | 3300006484 | Estuarine | MSQSEEAILISWRLQQWYEGMVLDARAMQDLQDAIEMLKTLAKQVQK* |
Ga0070744_100036379 | 3300006484 | Estuarine | MTQSEEAILISWRLQQWYEGMVLDARAMQDLQDAIEMLKTLAKQVQK* |
Ga0070744_100133207 | 3300006484 | Estuarine | MIYRFKELILSETEEAILISWRLRQWYEGMVLDPRAMQDLEDAIEMLKTLSKRGNK* |
Ga0070744_100661131 | 3300006484 | Estuarine | MTQSEEAILISWRIQQWYEGMVLDGRAMQDLQDAIEMLKTLAKQVQ |
Ga0070744_100843813 | 3300006484 | Estuarine | LNQTEEAILISWRLQQWYEGMVLDQRAMQDVQDAIEMLKTLAKQVNK* |
Ga0075467_106268672 | 3300006803 | Aqueous | MTQSEEAILISWRLQQWYENMVLDAKAMQDLQDAIEMLKQLAKQVQK* |
Ga0075464_107643132 | 3300006805 | Aqueous | MTQTEEAILISWRIQQWYEGMVLDARAMQDLQDAIEMLKKLAKQVQK* |
Ga0070748_11673432 | 3300006920 | Aqueous | MTQSEEAIFISWRLQQWYENMVLDARAMQDLQDAIEMLKQLAKQVQK* |
Ga0070748_13047852 | 3300006920 | Aqueous | MNQTEEAILISWRLQQWYEGMVLDARAMQDAQDAIEMLKTLAKQVQK* |
Ga0070747_11324691 | 3300007276 | Aqueous | MNQTEEAILISWRLQQWYEGMVLDARAMQDLQDAIEMLKTLTKQVQK* |
Ga0099851_11862391 | 3300007538 | Aqueous | MNKSEEIYLKAWRLQQWYEGMMLDARAMQDLQDAIEMLKQLAKQVHK* |
Ga0102828_10336023 | 3300007559 | Estuarine | MIYRFKELILSETEEAILISWRLRQWYEGMVLDPRAMQDLEDAIEMLKTLAKRVNK* |
Ga0104986_181633 | 3300007734 | Freshwater | MSQSEEAILISWRLQQWYEGMVLDARAMQDLQDAIEMLKQLAKVQK* |
Ga0102816_11726223 | 3300008999 | Estuarine | MTQSEEAILISWRLQQWYEGMVLDARAMQDLQDAIEMLKTLA |
Ga0102829_12474282 | 3300009026 | Estuarine | MNKTEEAILISWRLQQWYEGMVLDARAMQDLQDAIEMLKTLAKQVQK* |
Ga0105093_106991162 | 3300009037 | Freshwater Sediment | MRFKELILNQTEEAILISWRLQQWYEGMVLDQRAMQDVQDAIEMLRQLAKQVNK* |
Ga0114973_100388952 | 3300009068 | Freshwater Lake | MNQTEEAILISWRLQQWYEGMVLDARAVQDLQDAIEMLKQLAKQVQK* |
Ga0114973_106189482 | 3300009068 | Freshwater Lake | MNKTEETILISWRLQQWYEGMVLDARAMQDLQDAIEMLKQLAKVQK* |
Ga0105098_105109612 | 3300009081 | Freshwater Sediment | MTFRFKELILNQTEEAILISWRLQQWYEGMVLDQRAMQDVQDAIEMLKTLAKQVNK* |
Ga0105098_106660492 | 3300009081 | Freshwater Sediment | MNKTEEAILISWRLQQWYEGMVLDARAMQDLQDAIEMLKQLAKQVQK* |
Ga0105099_100886974 | 3300009082 | Freshwater Sediment | MRFKELILNQTEEAILISWRLQQWHEGMVLDQRAMQDVQDAIEMLKTLAKQVNK* |
Ga0105099_107121472 | 3300009082 | Freshwater Sediment | MTYRFKELILNQTEEAILISWRLQQWHEGMVLDQRAMQDVQDAINMLKQLAKQVNK* |
Ga0105103_108412242 | 3300009085 | Freshwater Sediment | MTQSEEAILISWRMQQWYESMVLDARAMQDLQDAIEMLKQLAKQVNK* |
Ga0114962_1000255420 | 3300009151 | Freshwater Lake | MTQTEEAILISWRIQQWYEGMVLDARAMQDLQDAIEMLKTLAKQVQK* |
Ga0114962_101425843 | 3300009151 | Freshwater Lake | MTITEEAILISWRLQQWYESMVLDARAMQDLQDAIEMLKTLAKQVQK* |
Ga0114962_102039943 | 3300009151 | Freshwater Lake | MTLTEEAILISWRLQQWYDGMVLDARAMQDLQDAIEMLKTLAKQVQK* |
Ga0114962_103009872 | 3300009151 | Freshwater Lake | MNQTEEAILISWRIQQWYEGMVLDARAMQDLQDAIEMLKTLAKQVNK* |
Ga0114962_105553932 | 3300009151 | Freshwater Lake | MNQTEEAILISWRLQQWYENMVLDARAMQDLQDAIEMLKQLAKQVQK* |
Ga0114980_106654221 | 3300009152 | Freshwater Lake | MTQTEEAILISWRLQQWYEGMVLDTRAMQDLQDAIEMLKQLAKQVQK* |
Ga0114980_107748032 | 3300009152 | Freshwater Lake | MTRRSNMNQTEQAILISWRLQQWYDGMVLDARAMQDLQDAIEMLKTLAKQVQK* |
Ga0114963_100484334 | 3300009154 | Freshwater Lake | MTQSEEAILISWRLQQWYENMVLDARAMQDLQDAIEMLKQLAKQVQK* |
Ga0114963_100502667 | 3300009154 | Freshwater Lake | MNQAEEAILISWRLQQWYEGMVLDARAMQDLQDAIEMLKQLAKVNK* |
Ga0114968_100090612 | 3300009155 | Freshwater Lake | MNQTEEAVLISWRLQQWYEGMVLDARAMQDLQDAIEMLKTLAKQVQK* |
Ga0114968_100232958 | 3300009155 | Freshwater Lake | MTQTEEAILISWRIQQWYEGMVLDARAMQDLQDAIEMLKQLAKQVQVK* |
Ga0114968_100727352 | 3300009155 | Freshwater Lake | MNQTEEAILISWRLQQWYEGMVLDQRAMQDLQDAIEMLKTLAKVQK* |
Ga0114968_101283423 | 3300009155 | Freshwater Lake | MTQTEEAILISWRLQQWYENMVLDARAMQDLKDAIEMLKTLAKQVNK* |
Ga0114968_103067812 | 3300009155 | Freshwater Lake | MTQSEEAILISWRIQQWYEGMVLDARSMQDLQDAIEMLKTLAKQVQK* |
Ga0114968_105288703 | 3300009155 | Freshwater Lake | MNQTEETILISWRLQQWYEGMVLDARAMQDLQDAIEMLKTLAKQVQK* |
Ga0114978_100049273 | 3300009159 | Freshwater Lake | MTQSEEAILISWRIQQWYEGMVLDARAMQDLQDAIEMLKTLAKQVQK* |
Ga0114978_101014263 | 3300009159 | Freshwater Lake | MNKTEEAILISWRLQQWYEGMVLDPRAMQDLQDAIEMLKQLAKQVK* |
Ga0114978_104513812 | 3300009159 | Freshwater Lake | MNKTEEAILISWRLQQWYEGMVLDPRAMQDLQEAIEMLKTLAKQVQK* |
Ga0114978_105850013 | 3300009159 | Freshwater Lake | MNQTEQAILISWRLQQWYEGMVLDARAMQDLQDSIEMLKKLAKQVQK* |
Ga0114981_106290322 | 3300009160 | Freshwater Lake | ILISWRLQQWYEGMVLDTRAMQDLQDAIEMLKQLAKKVQK* |
Ga0114966_106707882 | 3300009161 | Freshwater Lake | MTQTEEAILISWRIQQWYEGMVLDARAMQDVEDAIEMLKQLAKQVHK* |
Ga0114970_100490152 | 3300009163 | Freshwater Lake | MSLFKMSQSEEAILISWRLQQWYENMVLDARAMQDLQDAIEMLKQLAKQVQVK* |
Ga0114970_107377602 | 3300009163 | Freshwater Lake | MTQSEEAILISWRIQQWYEGMVLDARSMQDLQDAIKMLKTLAKQVQK* |
Ga0114975_101474183 | 3300009164 | Freshwater Lake | MTLTEEAILISWRLQQWYEGMVLDARAMQDLQDAIEMLKKLAKQVQK* |
Ga0114975_104757761 | 3300009164 | Freshwater Lake | RCAVLMNQTEEAILISWRLQQWYEGMVLDARAMQDLQDAIEMLKQLAKVQK* |
Ga0105102_100066745 | 3300009165 | Freshwater Sediment | MRFKELILNQTEEAILISWRLQQWYEGMVLDQRAMQDVQDAIEMLKTLAKQVNK* |
Ga0105102_101510071 | 3300009165 | Freshwater Sediment | AILISWRIQQWYEGMVLDSRAMQDLQDAIEMLKILAKQVQK* |
Ga0105102_103450802 | 3300009165 | Freshwater Sediment | MTQSEEAILISWRIQQWYEGMVLDNRAMQDLQDAIEMLKQLAKQVQK* |
Ga0105096_101614461 | 3300009170 | Freshwater Sediment | EEVILISWRIQQWYEGMDLDNRAMQELQDAIEMLKQLAKQVQK* |
Ga0114979_101094802 | 3300009180 | Freshwater Lake | MNQTEQAILISWRLQQWYDGMVLDARAMQDLQDAIEMLKTLAKQVQK* |
Ga0114979_103814653 | 3300009180 | Freshwater Lake | MTQTEEAILISWRIQQWYEGMVLDARAMQDLQDAIEMLKQLAKQVQK* |
Ga0114969_100422326 | 3300009181 | Freshwater Lake | MTQSEEAILISWRLQQWYPGMVLDARAMQDVEDAIEMLKTLAKQVQK* |
Ga0114969_101757622 | 3300009181 | Freshwater Lake | MTQTEEAILISWRLQQWYENMVLDARAMQDLQDAIEMLKTLAKQVQK* |
Ga0114974_103290042 | 3300009183 | Freshwater Lake | MTQTEEAILISWRLQQWYENMVLDARAMQDLQDAIEMLKTLAKQVNK* |
Ga0114974_107400281 | 3300009183 | Freshwater Lake | LMNQTEEAILISWRLQQWYKGMVLDARAMQDLQDAIEMLKQLAKVQK* |
Ga0114976_103376083 | 3300009184 | Freshwater Lake | MTQSEEAILISWRIQQWYEGMVFDARAMQDLQDAIEMLKTLAKQVQK* |
Ga0114976_104849132 | 3300009184 | Freshwater Lake | MTLIEEAILISWRLQQWYPDMVLDNRAMQNLQDAIEMLKTLAKQVKK* |
Ga0114976_106729972 | 3300009184 | Freshwater Lake | MTQTEEAILISWRLQQWYVGMVLDARAMQDLQDAIEMLKTLAKQVQK* |
Ga0114971_101656073 | 3300009185 | Freshwater Lake | MNKTEETILISWRLQQWYEGMVLDARAMQDLQDAIEMLKTLAKQVNK* |
Ga0114971_103267682 | 3300009185 | Freshwater Lake | MNQTEEAILISWRLQQWYEGMVLDARAMQDLQDAIEMLKQLAKVQK* |
Ga0114983_10145554 | 3300009194 | Deep Subsurface | MTQSEEAILISWRLQQWYSGMVLDARAMQDLQDAIEMLKTLAKQVNK* |
Ga0114960_103737543 | 3300010158 | Freshwater Lake | MNQTEQAILISWRLQQWYEGMVLDVRAMQDLQDAIEMLKKLAKQVQK* |
Ga0133913_102806388 | 3300010885 | Freshwater Lake | MSLFKMSQSEEAILISWRLQQWYENMVLDARAMQDLQDAIEMIKTLAKQVNK* |
Ga0133913_109647003 | 3300010885 | Freshwater Lake | MTQTEEAILISWRIQQWYEGMVLDARAMQDLQDAIEMLKTLAKQVKK* |
Ga0133913_111261363 | 3300010885 | Freshwater Lake | MTQTEEAILISWRLQQWYPDMVLDQRAMQDLQDAIEMLKTLAKQVQK* |
Ga0133913_116507112 | 3300010885 | Freshwater Lake | MNQTEEAILISWRIQQWYEGMVLDARAMQDLQDAIEMLKTLAKQVQK* |
Ga0133913_117294381 | 3300010885 | Freshwater Lake | NQTEEAILISWRLQQWYEGMVLDARAMQDLQDAIEMLKTFAKQVNK* |
Ga0133913_123587483 | 3300010885 | Freshwater Lake | MNKTEEAILISWRLQQWYEGMVLDNRAMQDLQDAIEMLKTLAKQVNK* |
Ga0133913_128229933 | 3300010885 | Freshwater Lake | MNQTEEAILISWRLQQWYKGMVLDARAMQDLQDAIEMLKQLAKVQK* |
Ga0133913_129400002 | 3300010885 | Freshwater Lake | MNQTEEAILISWRLQQWYEGMVLDQRSMQDLQDAIEMLKTLAKQVTK* |
Ga0153697_14168 | 3300011334 | Freshwater | MSQSEEAILISWRLQQWYENMVLDARAMQDLQDAIEMLKQLAKQVQK* |
Ga0153799_10618582 | 3300012012 | Freshwater | MNKTEEAILISWRLQQWHEGMVLDNRAMQDLQDAIEMLKQLAKQVNK* |
Ga0138273_11010691 | 3300012760 | Freshwater Lake | QAILISWRLQQWHEGMVLDVRAMQDLQDAIEMLKKLAKQVQK* |
Ga0164293_103200303 | 3300013004 | Freshwater | MNKTEKAILISWRLQQWYEGMVLDPRAMQDLQDAIEMLKTLAKQVQK* |
Ga0164292_102940683 | 3300013005 | Freshwater | MNKTEEAILISWRLQQWYEGMVLDSRAMQDVQDAIEMLKTLAKQVNK* |
Ga0164292_110593651 | 3300013005 | Freshwater | KTEEAILISWRLQQWYEGMVLDPRAMQDLQDAIEMLKQLAKQVNK* |
Ga0136642_100126315 | 3300013285 | Freshwater | MNQAEEAILISWRLQQWYEGMVLDNRAMQDLQDAIEMFKTLAKQVQK* |
Ga0119960_10074293 | 3300014811 | Aquatic | MSQSEEAILISWRLQQWYEGMVLDARAMQDLQDAIEMLKQLAKKVQK* |
Ga0119960_10714052 | 3300014811 | Aquatic | MTFRFKELILNQTEEAILISWRLQQWYEGMVLDQRAMQDVQDAIEMLKTLANR* |
Ga0181338_10017098 | 3300015050 | Freshwater Lake | MTQTEEAILISWRLQQWYAGMVLDPKAMQDLQDAIEMLKQLAKVQK* |
Ga0181338_10026232 | 3300015050 | Freshwater Lake | MTQTEEAILISWRLQQWYEGMVLDTRAMQDLQDAIEMLKQLAKKVQK* |
Ga0181338_10038363 | 3300015050 | Freshwater Lake | MNKTEEAILISWRLQQWYEGMVLDPRAMQDLQDAIEMLKKLAKQVNK* |
Ga0181338_10054133 | 3300015050 | Freshwater Lake | MNKTEEAILISWRLQQWHEGMVLDNRAMQDLQDAIEMLKQLAKQVQK* |
Ga0181338_10098564 | 3300015050 | Freshwater Lake | MTQTEEAILISWRLQQWYAGMVLDPRAMQDLQDAIEMLKTLAKQVQK* |
Ga0181338_10127563 | 3300015050 | Freshwater Lake | MTQTEEAILISWRLQQWYEGMVLDNRAMQDLQDAIEMLKQLAKQVNK* |
Ga0181338_10178873 | 3300015050 | Freshwater Lake | MTQTEEAILISWRLQQWYAGMVLDPRAMQDLQDAIEMLKTLAKQVSK* |
Ga0181338_10376822 | 3300015050 | Freshwater Lake | MTQTEEAILVSWRLQQWYEGMVLDARAMQDLQDAIEMLKQLAKQVQK* |
Ga0181339_10271823 | 3300017700 | Freshwater Lake | MNQAEEAILISWRLQQWYENMVLDARAMQDLQDAIEMLKQLAKQVQK |
Ga0181364_10459482 | 3300017701 | Freshwater Lake | MNKTEEAILISWRLQQWYEGMVLDARAMQDLQDAIEMLKQLAKQVQK |
Ga0181350_10043513 | 3300017716 | Freshwater Lake | MNKTEEAILISWRLQQWHEGMVLDNRAMQDLQDAIEMLKQLAKQVQK |
Ga0181350_10156363 | 3300017716 | Freshwater Lake | MNKTEEAILISWRLAQWYEGMVLDPRAMQDLQDAIEMLKKLAKQVNK |
Ga0181350_10191155 | 3300017716 | Freshwater Lake | MTQTEEAILISWRLQQWYEGMVLDQRAMQDLQDAIEMLKTSAKQVQK |
Ga0181350_10509412 | 3300017716 | Freshwater Lake | MTQSEEAVLISWRLQQWYEGMVLDARAVQDLQDAIEMLKQLAKVQK |
Ga0181350_11555371 | 3300017716 | Freshwater Lake | MNQTEEAILISWRLQQWYEGMVLDAKAVQDLQDAIEMLKQLAKQVQK |
Ga0181350_11576561 | 3300017716 | Freshwater Lake | MTQTEEAILVSWRLQQWYEGMVLDPRAMQDLQDAIEMLKQLTKQVQK |
Ga0181347_11403241 | 3300017722 | Freshwater Lake | MTQTEEAILVSWRLQQWYEGMVLDARAMQDLQDAIEMLKTLAKQVQK |
Ga0181362_11160062 | 3300017723 | Freshwater Lake | MTQTEEAILISWRIQQWYEGMVLDARAMQDLQDASEMLKQLAKQVQK |
Ga0181344_11036032 | 3300017754 | Freshwater Lake | MTQTEEAILISWRIQQWYEGMVLDARAMQDLQDAIEMLKTLAKQVQVK |
Ga0181344_12368372 | 3300017754 | Freshwater Lake | GHDRRCPVLMTQTEEAILISWRLQQWYPGMVLDQRAMQDLQDAIEMLKTLAKQVQK |
Ga0181358_10395514 | 3300017774 | Freshwater Lake | MSLFRMSQSEEAILISWRLQQWYEGMVLDQRAMQDLQDAIEMLKQLAKVHK |
Ga0181358_11215364 | 3300017774 | Freshwater Lake | MTQTEKAILISWRLQQWYEGMVLDARAMQDLQDAIEMLKQLAKQVQK |
Ga0181357_10887903 | 3300017777 | Freshwater Lake | MTQTEEAILISWRLQQWYEGMVLDARAMQDLQDAIEMLKQLAKVQK |
Ga0181357_12232192 | 3300017777 | Freshwater Lake | MNQTEEAILISWRLQQWYEGMVLDAKAVQDLQDAIEMLKQLAKVHK |
Ga0181348_11661503 | 3300017784 | Freshwater Lake | MTQTEEAIVVSWRLQQWYEGMVLDPRAMQDLQDAIEMLKQLAK |
Ga0181355_12306332 | 3300017785 | Freshwater Lake | MNQTEEAILISWRLQQWYEGMVLDAKAVQDLQDAIEMLKKLAKQVQK |
Ga0181355_12787451 | 3300017785 | Freshwater Lake | AILISWRLQQWYEGMVLDQRAMQDLQDAIEMLKQLAKVHK |
Ga0181563_107791912 | 3300018420 | Salt Marsh | LNQTEEAILIAWRLQQWYEGMVLDARAMQDVQDAIEMLKTLAKQVNK |
Ga0181361_1096311 | 3300019783 | Freshwater Lake | MTQTEEAILISWRLQQWYAGMVLDPKAMQDLQDAIEMLKQLAKVQK |
Ga0181359_10035237 | 3300019784 | Freshwater Lake | MTQTEEAILISWRLQQWYEGMVLDNRAVQDLQDAIEMLKTLAKQVQK |
Ga0181359_10123274 | 3300019784 | Freshwater Lake | MTQTEEAILISWRLQQWYEGMVLDTRAMQDLQDAIEMLKQLAKKVQK |
Ga0181359_10313864 | 3300019784 | Freshwater Lake | MTQTEEAILVSWRLQQWYEGMVLDARAMQDLQDAIEMLKQLAKQVQK |
Ga0181359_11034473 | 3300019784 | Freshwater Lake | MTQTEEAILISWRIQQWYEGMVLDARAMQDLQDAIEMLKQLAKQVKK |
Ga0181359_11629652 | 3300019784 | Freshwater Lake | MTQTEEAILISWRLQQWYEGMVLDARAMQDLQDAIEMLKQLAKQVQK |
Ga0181359_12068541 | 3300019784 | Freshwater Lake | MNKTEEAILISWRLQQWYEGMVLDARAVQDLQDAIEMLKTLAKQVSK |
Ga0194032_10001662 | 3300019938 | Freshwater | MNQAEEAILISWRLQQWYEGMVLDPRAMQDLQDAIEMLKKLTKKVTK |
Ga0194049_12019161 | 3300020157 | Anoxic Zone Freshwater | ARRCAFLMNQTEEAILISWRLQQWYEGMVLDARAMQDLQDAIEMLKTLAKQVQK |
Ga0211729_101231223 | 3300020172 | Freshwater | MTQTEEAILISWRIQQWYEGMVLDARAMQDLQDAIEMLKQLAKQVQK |
Ga0211729_112524662 | 3300020172 | Freshwater | MNQTEEAILISWRLQQWYEGMVLDNRAMQDVQDAIEMLKKLSKQVNK |
Ga0211731_104545713 | 3300020205 | Freshwater | MNQTEEAILISWRLQQWYEGMVLDARAMQDLQDAIEMLKTLTKQVNK |
Ga0211731_109310032 | 3300020205 | Freshwater | MSLFRMSQSEEAILISWRIQQWYEGMVLDARAMQDLQDAIEMLKQLAKQVQK |
Ga0211731_112293693 | 3300020205 | Freshwater | MNQTEEAILISWRLQQWYEGMVLDQRAMQDLQNAIEMLKQLAKQVNK |
Ga0208091_100032926 | 3300020506 | Freshwater | ILISWRLQQWYEGMVLDARAMQDLQDAIEMLKTLAKQVQK |
Ga0208596_10363703 | 3300020534 | Freshwater | RLQQWYEGMVLDPRAMQDLQDAIEMLKQLAKQVNK |
Ga0214166_10105199 | 3300021139 | Freshwater | MFRFKELILNQTEEAILISWRLQQLFEGMVLDARAMQDVQDAIEMLKTLAKQVQK |
Ga0194047_100328807 | 3300021354 | Anoxic Zone Freshwater | MNQTEQAILISWRLQQWHEGMILDVRAMQDLQDAIEMLKKLAKQVQK |
Ga0194047_101774584 | 3300021354 | Anoxic Zone Freshwater | MNQSEEAILISWRLQQWYEGMVLDARAMQDLQDAIEMLKTLAKQVQK |
Ga0194048_1000028110 | 3300021519 | Anoxic Zone Freshwater | MTQSEEAILISWRLQQWYEGMVLDARAMQDVEDAIEMLKTLAKQVQK |
Ga0194048_101614373 | 3300021519 | Anoxic Zone Freshwater | MTQSEEAILISWRIQQWYEGMVLDSRAMQDVEDAIEMLKTLAKQVQK |
Ga0194059_11599781 | 3300021600 | Anoxic Zone Freshwater | RYARRSTFLMKQSEEAILISWRLQQWYEGMVLDARAMQDLQDAIEMLKTLAKQVHK |
Ga0222714_101001816 | 3300021961 | Estuarine Water | AILISWRLQQWYEGMVLDARAMQDVQDAIEMLKTLAKQVNK |
Ga0222713_100380183 | 3300021962 | Estuarine Water | MNQTEEAILISWRLQQWYEGMVLDARAMQDVQDAIEMLKTLAKQVNK |
Ga0212029_10657232 | 3300022063 | Aqueous | MNKSEEIYLKAWRLQQWYEGMMLDARAMQDLQDAIEMLKQLAKQVHK |
Ga0181354_11652702 | 3300022190 | Freshwater Lake | MTQTEEAILISWRLQQWYAGMVLDPRAMQDLQDAIEMLKTLAKQVQK |
Ga0181351_11522242 | 3300022407 | Freshwater Lake | MNQTEEAILISWRLQQWYEGMVLDARAMQDLQDAIEMLKTLAKQVQK |
Ga0181351_12385412 | 3300022407 | Freshwater Lake | MSLFRMSQSEEAILISWRLQQWYEGMVLDQRAMQDLQDAIEMLKTLAKVQK |
Ga0214919_1000174223 | 3300023184 | Freshwater | MNQTEQAILISWRLQQWYEGMVLDPRAMQDLQDAIEMLKTLAKQVNK |
Ga0209414_100220911 | 3300023301 | Hypersaline | MNQTEEAILISWRLQQWYEGMVLDPRAMQDVQDAIEMLKLLAKQVQK |
Ga0244775_1000139226 | 3300024346 | Estuarine | MSQSEEAILISWRLQQWYEGMVLDARAMQDLQDAIEMLKTLAKQVQK |
Ga0244775_1000186425 | 3300024346 | Estuarine | MTQSEEAILISWRLQQWYEGMVLDARAMQDLQDAIEMLKTLAKQVQK |
Ga0244775_101315064 | 3300024346 | Estuarine | MIYRFKELILSETEEAILISWRLRQWYEGMVLDPRAMQDLEDAIEMLKTLAKRVNK |
Ga0244775_102475413 | 3300024346 | Estuarine | MTQTEEAILISWRIQQWYEGMVLDARAMQDLQDAIEMLKTLAKVQVK |
Ga0244775_106223181 | 3300024346 | Estuarine | LNQTEEAILISWRLQQWYEGMVLDQRAMQDVQDAIEMLKTLAKQVNK |
Ga0208103_10441243 | 3300025436 | Freshwater | AILISWRIQQWYENMVLDARAMQDLQDAIEMLKTLAKQVQK |
Ga0208102_10181002 | 3300025447 | Freshwater | MNQTEEAILISWRIQQWYENMVLDARAMQDLQDAIEMLKTLAKQVQK |
Ga0208248_10182053 | 3300025595 | Freshwater | MNQTEQAILISWRLQQWYEGMVLDARAMQDLQDAIEMLKKLAKQVQK |
Ga0208613_10139735 | 3300025616 | Freshwater | MNQTEEAILISWRLQQWYEGMVLDVRAMQDLQDAIEMLKKLAKQVQK |
Ga0209300_10249973 | 3300027365 | Deep Subsurface | MTQSEEAILISWRLQQWYSGMVLDARAMQDLQDAIEMLKTLAKQVNK |
Ga0208974_10590543 | 3300027608 | Freshwater Lentic | MTQTEEAILISWRLQQWYQGMVLDQRAMQDLQDAIEMLKTLTKQVQK |
Ga0208942_10231833 | 3300027627 | Freshwater Lentic | MNQTEEAILISWRLQQWYEGMVLDARAMQDLQDAIEMLKTFAKQVNK |
Ga0209704_10060633 | 3300027693 | Freshwater Sediment | MRFKELILNQTEEAILISWRLQQWYEGMVLDQRAMQDVQDAIEMLKTLAKQVNK |
Ga0209704_11815112 | 3300027693 | Freshwater Sediment | MTQSEEAILISWRIQQWYEGMVLDNRAMQDLQDAIEMLKQLAKQVQK |
Ga0209188_100079422 | 3300027708 | Freshwater Lake | MTQTEEAILISWRIQQWYEGMVLDARAMQDLQDAIEMLKTLAKQVQK |
Ga0209188_100169719 | 3300027708 | Freshwater Lake | MNQTEQAILISWRLQQWHEGMVLDVRAMQDLQDAIEMLKKLAKQVQK |
Ga0209188_100448514 | 3300027708 | Freshwater Lake | MNQAEEAILISWRLQQWYEGMVLDARAMQDLQDAIEMLKQLAKVNK |
Ga0209492_10097026 | 3300027721 | Freshwater Sediment | MTQSEEAILISWRIQQWYEGMVLDARAMQDLQDAIEMLKTLAKQVQK |
Ga0209597_11270742 | 3300027746 | Freshwater Lake | MNKTEETILISWRLQQWYEGMVLDARAMQDLQDAIEMLKTLAKQVNK |
Ga0209084_11359042 | 3300027749 | Freshwater Lake | MNQTEEAILISWRIQQWYEGMVLDARTMQDLQDAIEMLKTLAKQVNK |
Ga0209596_10007183 | 3300027754 | Freshwater Lake | MTQTEEAILISWRIQQWYEGMVLDARAMQDLQDAIEMLKQLAKQVQVK |
Ga0209596_10106272 | 3300027754 | Freshwater Lake | MNQTEEAILISWRLQQWYEGMVLDARAVQDLQDAIEMLKQLAKQVQK |
Ga0209596_10221147 | 3300027754 | Freshwater Lake | MNQTEEAVLISWRLQQWYEGMVLDARAMQDLQDAIEMLKTLAKQVQK |
Ga0209596_10862372 | 3300027754 | Freshwater Lake | MTQTEEAILISWRLQQWYENMVLDARAMQDLKDAIEMLKTLAKQVNK |
Ga0209596_11474962 | 3300027754 | Freshwater Lake | MNQTEETILISWRLQQWYEGMVLDARAMQDLQDAIEMLKTLAKQVQK |
Ga0209596_13679872 | 3300027754 | Freshwater Lake | MTQSEEAILISWRLQQWYPGMVLDARAMQDVEDAIEMLKTLAKQVQK |
Ga0209296_12212741 | 3300027759 | Freshwater Lake | MNKTEEAILISWRLQQWYEGMVLDPRAMQDLQEAIEMLKTLAKQVQK |
Ga0209296_13123822 | 3300027759 | Freshwater Lake | MTQTEEAILISWRLQQWYENMVLDARAMQDLQDAIEMLKTLAKQVNK |
Ga0209500_102110823 | 3300027782 | Freshwater Lake | MNKTEEAILISWRLQQWYEGMVLDPRAMQDLQDAIEMLKQLAKQVK |
Ga0209107_1001101510 | 3300027797 | Freshwater And Sediment | MNKTEEAILISWRLQQWHEGMVLDNRAMQDLQDAIEMLKQLAKQVK |
Ga0209550_100885081 | 3300027892 | Freshwater Lake | AILISWRLQQWYEGMVLDTRAMQDLQDAIEMLKQLAKKVQK |
Ga0209550_106334123 | 3300027892 | Freshwater Lake | ISWRIQQWYEGMVLDARAMQDLQDAIEMLKQLAKQVKK |
Ga0247723_100028629 | 3300028025 | Deep Subsurface Sediment | MTQTEEAILISWRLQQWYEGMVLDTRAMQDLQDAIEMLKTLAKQVKK |
Ga0247723_100209423 | 3300028025 | Deep Subsurface Sediment | MTILCLSDMNQAEEAILISWRIQQWYEGMVLDARAMQDLQDAIEMLKQLAKQVTK |
Ga0247723_10241793 | 3300028025 | Deep Subsurface Sediment | MNQSEEAILISWRLQQWYPGMVLDNRAMQDLQDAIDMLKTLAKQVQK |
Ga0247723_10421512 | 3300028025 | Deep Subsurface Sediment | MNKTEEAILISWRLQQWHEGMVLDNRAMQDLQDAIEMLKQLAKQVNK |
Ga0247723_10860863 | 3300028025 | Deep Subsurface Sediment | MNQTEEAILISWRLQQWFEGMALDARAMQDVQDAIEMLKTLAKQVSK |
Ga0315291_101373664 | 3300031707 | Sediment | MNQSEEAILISWRLQQWYEGMVLDARAMQDLQDAIEMLKTLAKQVNK |
Ga0315291_106233401 | 3300031707 | Sediment | ISWRLQQWYEGMVLDARAMQDLQDAIEMLKQLAKVQK |
Ga0315291_107987101 | 3300031707 | Sediment | MNQTEEAILISWRIQQWYAGMVLDARAMQDLQDAIEMLKTLAKQV |
Ga0315293_102143524 | 3300031746 | Sediment | MNQTEEAILISWRLQQWHEGMVLDARAMQDLQDAIEMLKTLAKQVQK |
Ga0315293_103110233 | 3300031746 | Sediment | MNQTEEAILISWRIQQWYEGMVLDARAMQDLQDAIEMLKTLAKQVNK |
Ga0315293_106111361 | 3300031746 | Sediment | MNKTEEAILISWRLQQWYEGMVLDARAMQDLQDAIEMLKQLAKVHK |
Ga0315293_108960542 | 3300031746 | Sediment | MNQTEEAILISWRLQQWYEGMVLDARAMQDLQDAIEMLKTLAKVQK |
Ga0315288_104293443 | 3300031772 | Sediment | MNQTEEAVLISWRLQQWYEGMILDARAMQDLQDAIEMLKTLAKQVNK |
Ga0315294_102364864 | 3300031952 | Sediment | MNQTEEAVLISWRLQQWYEGMVLDVRAMQDLQDAIEMLKTLAKVQK |
Ga0315278_102007565 | 3300031997 | Sediment | WRLQQWYEGMILDARAMQDLQDAIEMLKTLAKQVQK |
Ga0315278_118681281 | 3300031997 | Sediment | MNQTEEAILISWRIQQWYEGMVLDARAMQDLQDAIEMLKTLA |
Ga0315274_1001087227 | 3300031999 | Sediment | MTQSEEAILISWRLQQWYEGMVLDARAMQDLQDAIEMLKTLAKVQK |
Ga0315274_102093303 | 3300031999 | Sediment | MNQTEEAILISWRIQQWYEGMVLDARAMQDLQDAIEMLKTLAKVQK |
Ga0315274_105820383 | 3300031999 | Sediment | MNQTEEAILISWRLQQWYEGMVLDVRAMQDLQDAIEMLKQLAKVQK |
Ga0315274_113579243 | 3300031999 | Sediment | MNQTEEAILISWRLQQWYEGMVLDARVMQDLQDAIEMLKTLAKVQK |
Ga0315274_120625101 | 3300031999 | Sediment | MNQTEEAILISWRLQQWYECMVLDARAMQDLQDAIEMLKTLAKQVQK |
Ga0315289_107224282 | 3300032046 | Sediment | MNQTEEAILISWRLQQWYEGMVLDARAMQDLQDAIEMLKQLAKVHK |
Ga0315284_106196752 | 3300032053 | Sediment | MNQTEEAILISWRLQQWYEGMILDARAMQDLQDAIEMLKTLAKQVQK |
Ga0315284_110172122 | 3300032053 | Sediment | MYKTEEAILISWRLQQWYEGMVLDARAMQDLQDAIEMLKQLAKVQK |
Ga0315277_107544313 | 3300032118 | Sediment | MNQTEEAILISWRLQQWYEGMILDARAMQDLQDAIETLKTL |
Ga0315277_113274682 | 3300032118 | Sediment | MNQSEEAILISWRLQQWYEGMVLDARAMQDLQDAIEMLKTL |
Ga0315295_117586501 | 3300032156 | Sediment | AILISWRIQQWYEGMVLDARAMQDLQDAIEMLKQLAKVHK |
Ga0315295_122932401 | 3300032156 | Sediment | MNQTEEAILISWRLQQWYEGMVLDVRAMQDLHDAIEMLKTLAKVQK |
Ga0315286_105166183 | 3300032342 | Sediment | MNQTEEAILISWRLQQWYEGMVLDARAVQDLQDAIEMLKQLAKVHK |
Ga0315287_101168052 | 3300032397 | Sediment | MNQTEEAILISWRIQQWYEGMILDARAMQDLQDAIEMLKTLAKQVQK |
Ga0334992_0504187_411_524 | 3300033992 | Freshwater | SWRLQQWYEGMVLDPRAMQDLQDAIEMLKTLAKQVNK |
Ga0334994_0013521_1783_1926 | 3300033993 | Freshwater | MTQSEEAILISWRLQQWYLGMVLDARAMQDLQDAIEMLKTLAKQVQK |
Ga0334994_0413161_519_647 | 3300033993 | Freshwater | EAILISWRLQQWYEGMVLDPRAMQDLQDAIEMLKQLAKQVNK |
Ga0334996_0037232_860_1024 | 3300033994 | Freshwater | MRFKELILSQTEEAILISWRLQQWYEGMVLDQRAMQDVQDAIEMLKTLAKQVNK |
Ga0334986_0006642_1007_1150 | 3300034012 | Freshwater | MNQTEEAILISWRLQQWYEGMVLDARAMQDLQDAIEMLKQLAKQVQK |
Ga0334985_0001572_16457_16600 | 3300034018 | Freshwater | MNKTEEAILISWRLQQWYEGMVLDKRAMQDVQEAIEMLKTLAKQVNK |
Ga0334987_0036835_4015_4158 | 3300034061 | Freshwater | MSQSEEAILISWRIQQWYEGMVLDARAMQDLQDAIEMLKQLAKQVQK |
Ga0334987_0146153_281_427 | 3300034061 | Freshwater | MTQTEEAILISWRLQQWYEGMVLDARAMQDLQDAIEMLKTLAKQVQVK |
Ga0334987_0200763_1125_1268 | 3300034061 | Freshwater | MNQTEEAILISWRLQQWYEGMVLDQRAMQDVQDAIEMLKTLAKQVSK |
Ga0334987_0623028_72_215 | 3300034061 | Freshwater | MNKTEEAILISWRLQQWYEGMVLDSRAMQDLQDAIEMLKQLAKQVNK |
Ga0334995_0038903_2311_2454 | 3300034062 | Freshwater | MTQTEEAILISWRIQQWYLGMVIDQRAMQDLQDAIEMLKTLAKQVQK |
Ga0334995_0120739_1827_1943 | 3300034062 | Freshwater | ISWRLQQWYENMVLDARAMQDLQNAIEMLKQLAKQVQK |
Ga0334995_0195956_1139_1282 | 3300034062 | Freshwater | MNQTEEAILISWRLQQWYEGMVLDPRAMQDLQDAIEMLKTLTKKVTK |
Ga0334995_0235971_1123_1242 | 3300034062 | Freshwater | LISWRLQQWYESMVLDARAMQDLQDAIEMLKTLAKQVQK |
Ga0334995_0735310_183_326 | 3300034062 | Freshwater | MTQTEEAILISWRLQQWYEGMVLDARAMQDLQDAIEMLKTLAKQVNK |
Ga0335031_0029136_1147_1317 | 3300034104 | Freshwater | MTYRFRELILNQTEEAILISWRLQQWYQGMVLDQRAMQDVQDAIEMLKTLAKQVSK |
Ga0335031_0104975_1313_1456 | 3300034104 | Freshwater | MNQTEEAILISWRLQQWYEGMVLDQRAMQDVQEAIEMLKTLAKQVNK |
Ga0335031_0402298_150_320 | 3300034104 | Freshwater | MTYRFKELILSQTEEAILISWRLQQWYEGMVLDQRAMQDVQDAINMLRQLAKQVNK |
Ga0335036_0003026_13641_13784 | 3300034106 | Freshwater | MTQSEQAILISWRLQQWYEGMVLDNRAMQDLQDAIEMLKTLAKQVQK |
Ga0335036_0024807_344_487 | 3300034106 | Freshwater | MTQTEEAILISWRIQQWYEGMVLDARALQDLQDAIEMLKTLAKQVQK |
Ga0335036_0030217_2549_2692 | 3300034106 | Freshwater | MTQSEEAILISWRLQQWYPGMVLDARAMQDLQDAIEMLKTLAKQVQK |
Ga0335048_0392344_175_318 | 3300034356 | Freshwater | MNKTEEAILISWRLQQWYEGMVLDPRAMQDLQDAIEMLKQLAKQVQK |
⦗Top⦘ |