Basic Information | |
---|---|
Family ID | F016431 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 247 |
Average Sequence Length | 44 residues |
Representative Sequence | MRVVAVMLLLSAGIAAEAMSYSFVSKASGRLGGPIRFEFYRDS |
Number of Associated Samples | 189 |
Number of Associated Scaffolds | 247 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 17.08 % |
% of genes near scaffold ends (potentially truncated) | 96.76 % |
% of genes from short scaffolds (< 2000 bps) | 87.04 % |
Associated GOLD sequencing projects | 176 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.36 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (92.308 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (18.623 % of family members) |
Environment Ontology (ENVO) | Unclassified (34.413 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.749 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 26.76% β-sheet: 19.72% Coil/Unstructured: 53.52% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.36 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 247 Family Scaffolds |
---|---|---|
PF13302 | Acetyltransf_3 | 2.83 |
PF13430 | DUF4112 | 1.62 |
PF14534 | DUF4440 | 1.62 |
PF00583 | Acetyltransf_1 | 1.21 |
PF00903 | Glyoxalase | 1.21 |
PF03544 | TonB_C | 1.21 |
PF08309 | LVIVD | 1.21 |
PF00211 | Guanylate_cyc | 1.21 |
PF07883 | Cupin_2 | 1.21 |
PF01513 | NAD_kinase | 1.21 |
PF13495 | Phage_int_SAM_4 | 1.21 |
PF00106 | adh_short | 0.81 |
PF01541 | GIY-YIG | 0.81 |
PF00120 | Gln-synt_C | 0.81 |
PF13561 | adh_short_C2 | 0.81 |
PF00293 | NUDIX | 0.81 |
PF04055 | Radical_SAM | 0.81 |
PF12680 | SnoaL_2 | 0.81 |
PF08818 | DUF1801 | 0.81 |
PF02371 | Transposase_20 | 0.81 |
PF03136 | Pup_ligase | 0.81 |
PF02517 | Rce1-like | 0.81 |
PF12681 | Glyoxalase_2 | 0.81 |
PF03734 | YkuD | 0.81 |
PF05193 | Peptidase_M16_C | 0.40 |
PF00201 | UDPGT | 0.40 |
PF01734 | Patatin | 0.40 |
PF13489 | Methyltransf_23 | 0.40 |
PF11954 | DUF3471 | 0.40 |
PF05598 | DUF772 | 0.40 |
PF12127 | FloA | 0.40 |
PF03781 | FGE-sulfatase | 0.40 |
PF13589 | HATPase_c_3 | 0.40 |
PF00027 | cNMP_binding | 0.40 |
PF02566 | OsmC | 0.40 |
PF14559 | TPR_19 | 0.40 |
PF12706 | Lactamase_B_2 | 0.40 |
PF04978 | DUF664 | 0.40 |
PF08031 | BBE | 0.40 |
PF00144 | Beta-lactamase | 0.40 |
PF01521 | Fe-S_biosyn | 0.40 |
PF01551 | Peptidase_M23 | 0.40 |
PF13641 | Glyco_tranf_2_3 | 0.40 |
PF13899 | Thioredoxin_7 | 0.40 |
PF01255 | Prenyltransf | 0.40 |
PF13632 | Glyco_trans_2_3 | 0.40 |
PF01176 | eIF-1a | 0.40 |
PF00246 | Peptidase_M14 | 0.40 |
PF01344 | Kelch_1 | 0.40 |
PF01510 | Amidase_2 | 0.40 |
PF02518 | HATPase_c | 0.40 |
PF09851 | SHOCT | 0.40 |
PF01548 | DEDD_Tnp_IS110 | 0.40 |
PF14026 | DUF4242 | 0.40 |
PF12697 | Abhydrolase_6 | 0.40 |
PF09206 | ArabFuran-catal | 0.40 |
PF10431 | ClpB_D2-small | 0.40 |
PF01797 | Y1_Tnp | 0.40 |
PF13924 | Lipocalin_5 | 0.40 |
PF03466 | LysR_substrate | 0.40 |
COG ID | Name | Functional Category | % Frequency in 247 Family Scaffolds |
---|---|---|---|
COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 1.21 |
COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 1.21 |
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 1.21 |
COG5276 | Uncharacterized secreted protein, contains LVIVD repeats, choice-of-anchor domain | Function unknown [S] | 1.21 |
COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 0.81 |
COG1376 | Lipoprotein-anchoring transpeptidase ErfK/SrfK | Cell wall/membrane/envelope biogenesis [M] | 0.81 |
COG1819 | UDP:flavonoid glycosyltransferase YjiC, YdhE family | Carbohydrate transport and metabolism [G] | 0.81 |
COG3034 | Murein L,D-transpeptidase YafK | Cell wall/membrane/envelope biogenesis [M] | 0.81 |
COG4430 | Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family | Function unknown [S] | 0.81 |
COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 0.81 |
COG5646 | Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis) | Posttranslational modification, protein turnover, chaperones [O] | 0.81 |
COG5649 | Uncharacterized conserved protein, DUF1801 domain | Function unknown [S] | 0.81 |
COG0020 | Undecaprenyl pyrophosphate synthase | Lipid transport and metabolism [I] | 0.40 |
COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 0.40 |
COG0316 | Fe-S cluster assembly iron-binding protein IscA | Posttranslational modification, protein turnover, chaperones [O] | 0.40 |
COG0361 | Translation initiation factor IF-1 | Translation, ribosomal structure and biogenesis [J] | 0.40 |
COG1262 | Formylglycine-generating enzyme, required for sulfatase activity, contains SUMF1/FGE domain | Posttranslational modification, protein turnover, chaperones [O] | 0.40 |
COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.40 |
COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.40 |
COG1752 | Predicted acylesterase/phospholipase RssA, containd patatin domain | General function prediction only [R] | 0.40 |
COG1764 | Organic hydroperoxide reductase OsmC/OhrA | Defense mechanisms [V] | 0.40 |
COG1765 | Uncharacterized OsmC-related protein | General function prediction only [R] | 0.40 |
COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 0.40 |
COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.40 |
COG3621 | Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR | General function prediction only [R] | 0.40 |
COG4667 | Predicted phospholipase, patatin/cPLA2 family | Lipid transport and metabolism [I] | 0.40 |
COG4841 | Uncharacterized conserved protein YneR, related to HesB/YadR/YfhF family | Function unknown [S] | 0.40 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 92.31 % |
Unclassified | root | N/A | 7.69 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2088090014|GPIPI_16497801 | All Organisms → cellular organisms → Bacteria | 1038 | Open in IMG/M |
2170459003|FZ032L002I4VGJ | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
3300000596|KanNP_Total_noBrdU_T14TCDRAFT_1017287 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 781 | Open in IMG/M |
3300000881|JGI10215J12807_1169601 | Not Available | 532 | Open in IMG/M |
3300000890|JGI11643J12802_10034492 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1155 | Open in IMG/M |
3300000890|JGI11643J12802_10763414 | Not Available | 831 | Open in IMG/M |
3300000890|JGI11643J12802_11262330 | All Organisms → cellular organisms → Bacteria | 1027 | Open in IMG/M |
3300000956|JGI10216J12902_115270986 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
3300001139|JGI10220J13317_10848107 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1227 | Open in IMG/M |
3300001141|JGI12638J13249_103213 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
3300004081|Ga0063454_101879209 | Not Available | 526 | Open in IMG/M |
3300004479|Ga0062595_102018429 | Not Available | 558 | Open in IMG/M |
3300004480|Ga0062592_101779497 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
3300005166|Ga0066674_10506926 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
3300005167|Ga0066672_10748623 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium | 620 | Open in IMG/M |
3300005171|Ga0066677_10256101 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 994 | Open in IMG/M |
3300005175|Ga0066673_10310874 | All Organisms → cellular organisms → Bacteria | 919 | Open in IMG/M |
3300005175|Ga0066673_10627688 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
3300005175|Ga0066673_10706151 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
3300005178|Ga0066688_10084339 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1913 | Open in IMG/M |
3300005179|Ga0066684_10038191 | All Organisms → cellular organisms → Bacteria | 2675 | Open in IMG/M |
3300005180|Ga0066685_10321610 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1072 | Open in IMG/M |
3300005180|Ga0066685_10448930 | All Organisms → cellular organisms → Bacteria | 895 | Open in IMG/M |
3300005184|Ga0066671_10110662 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1541 | Open in IMG/M |
3300005186|Ga0066676_10623719 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
3300005290|Ga0065712_10706511 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
3300005329|Ga0070683_100969624 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 816 | Open in IMG/M |
3300005331|Ga0070670_100973910 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 771 | Open in IMG/M |
3300005332|Ga0066388_100804080 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1532 | Open in IMG/M |
3300005335|Ga0070666_11100644 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
3300005355|Ga0070671_100034578 | All Organisms → cellular organisms → Bacteria | 4183 | Open in IMG/M |
3300005439|Ga0070711_101268984 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium | 638 | Open in IMG/M |
3300005445|Ga0070708_101121444 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
3300005447|Ga0066689_10075563 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1878 | Open in IMG/M |
3300005450|Ga0066682_10899937 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 527 | Open in IMG/M |
3300005468|Ga0070707_102091962 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 533 | Open in IMG/M |
3300005536|Ga0070697_101300339 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 649 | Open in IMG/M |
3300005540|Ga0066697_10092437 | All Organisms → cellular organisms → Bacteria | 1756 | Open in IMG/M |
3300005540|Ga0066697_10676218 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 566 | Open in IMG/M |
3300005544|Ga0070686_100269299 | All Organisms → cellular organisms → Bacteria | 1252 | Open in IMG/M |
3300005546|Ga0070696_101624647 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
3300005549|Ga0070704_101020893 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
3300005560|Ga0066670_10306482 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 966 | Open in IMG/M |
3300005564|Ga0070664_101485006 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 641 | Open in IMG/M |
3300005574|Ga0066694_10239039 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
3300005575|Ga0066702_10639002 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
3300005576|Ga0066708_10095164 | All Organisms → cellular organisms → Bacteria | 1760 | Open in IMG/M |
3300005576|Ga0066708_10558918 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
3300005576|Ga0066708_10807234 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
3300005587|Ga0066654_10148622 | All Organisms → cellular organisms → Bacteria | 1187 | Open in IMG/M |
3300005598|Ga0066706_10608355 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 867 | Open in IMG/M |
3300005598|Ga0066706_10934013 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
3300005764|Ga0066903_100802862 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1683 | Open in IMG/M |
3300005764|Ga0066903_103530974 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
3300005764|Ga0066903_108736295 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 515 | Open in IMG/M |
3300006028|Ga0070717_10043024 | All Organisms → cellular organisms → Bacteria | 3685 | Open in IMG/M |
3300006032|Ga0066696_10087827 | All Organisms → cellular organisms → Bacteria | 1841 | Open in IMG/M |
3300006032|Ga0066696_10430777 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 862 | Open in IMG/M |
3300006032|Ga0066696_11015253 | Not Available | 527 | Open in IMG/M |
3300006046|Ga0066652_100043092 | All Organisms → cellular organisms → Bacteria | 3344 | Open in IMG/M |
3300006046|Ga0066652_100833234 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
3300006173|Ga0070716_101262914 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
3300006358|Ga0068871_101424492 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
3300006791|Ga0066653_10006481 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 3858 | Open in IMG/M |
3300006796|Ga0066665_10839104 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
3300007255|Ga0099791_10018979 | All Organisms → cellular organisms → Bacteria | 2943 | Open in IMG/M |
3300007255|Ga0099791_10098406 | All Organisms → cellular organisms → Bacteria | 1345 | Open in IMG/M |
3300007258|Ga0099793_10162211 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1062 | Open in IMG/M |
3300007258|Ga0099793_10199288 | All Organisms → cellular organisms → Bacteria | 960 | Open in IMG/M |
3300009012|Ga0066710_100139586 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 3346 | Open in IMG/M |
3300009012|Ga0066710_101722358 | All Organisms → cellular organisms → Bacteria | 952 | Open in IMG/M |
3300009100|Ga0075418_11777599 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
3300009101|Ga0105247_11674710 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 525 | Open in IMG/M |
3300009137|Ga0066709_101700832 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 895 | Open in IMG/M |
3300009137|Ga0066709_102027066 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
3300009137|Ga0066709_102584019 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
3300009137|Ga0066709_103915820 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → unclassified Geodermatophilaceae → Geodermatophilaceae bacterium | 541 | Open in IMG/M |
3300009156|Ga0111538_11298855 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 919 | Open in IMG/M |
3300009156|Ga0111538_11762214 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
3300010048|Ga0126373_10998460 | Not Available | 902 | Open in IMG/M |
3300010322|Ga0134084_10058954 | All Organisms → cellular organisms → Bacteria | 1148 | Open in IMG/M |
3300010323|Ga0134086_10318215 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 608 | Open in IMG/M |
3300010333|Ga0134080_10270812 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
3300010333|Ga0134080_10387953 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 644 | Open in IMG/M |
3300010335|Ga0134063_10383901 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
3300010358|Ga0126370_11027022 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
3300010358|Ga0126370_12627804 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
3300010371|Ga0134125_10928107 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 956 | Open in IMG/M |
3300010376|Ga0126381_100236330 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 2467 | Open in IMG/M |
3300010376|Ga0126381_100444424 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1817 | Open in IMG/M |
3300010397|Ga0134124_11878095 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
3300010400|Ga0134122_13125859 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
3300012198|Ga0137364_10048268 | All Organisms → cellular organisms → Bacteria | 2823 | Open in IMG/M |
3300012198|Ga0137364_10227582 | Not Available | 1373 | Open in IMG/M |
3300012199|Ga0137383_10016970 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 4989 | Open in IMG/M |
3300012199|Ga0137383_10757684 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 709 | Open in IMG/M |
3300012199|Ga0137383_11283342 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
3300012204|Ga0137374_10244345 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1510 | Open in IMG/M |
3300012206|Ga0137380_10700490 | All Organisms → cellular organisms → Bacteria | 879 | Open in IMG/M |
3300012207|Ga0137381_10545270 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1011 | Open in IMG/M |
3300012207|Ga0137381_11029767 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 709 | Open in IMG/M |
3300012208|Ga0137376_10323471 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1339 | Open in IMG/M |
3300012285|Ga0137370_10096343 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1661 | Open in IMG/M |
3300012285|Ga0137370_10222391 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1112 | Open in IMG/M |
3300012285|Ga0137370_10601620 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 679 | Open in IMG/M |
3300012349|Ga0137387_10237251 | All Organisms → cellular organisms → Bacteria | 1313 | Open in IMG/M |
3300012353|Ga0137367_10190164 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1490 | Open in IMG/M |
3300012354|Ga0137366_10133591 | All Organisms → cellular organisms → Bacteria | 1871 | Open in IMG/M |
3300012354|Ga0137366_10980664 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 589 | Open in IMG/M |
3300012355|Ga0137369_10111602 | Not Available | 2225 | Open in IMG/M |
3300012355|Ga0137369_10207132 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1511 | Open in IMG/M |
3300012357|Ga0137384_11202570 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
3300012359|Ga0137385_10527848 | All Organisms → cellular organisms → Bacteria | 997 | Open in IMG/M |
3300012582|Ga0137358_10968091 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
3300012905|Ga0157296_10348464 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
3300012911|Ga0157301_10181349 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
3300012917|Ga0137395_10981816 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
3300012922|Ga0137394_10693694 | All Organisms → cellular organisms → Bacteria | 857 | Open in IMG/M |
3300012929|Ga0137404_11674208 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
3300012930|Ga0137407_11003169 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 791 | Open in IMG/M |
3300012951|Ga0164300_10015991 | All Organisms → cellular organisms → Bacteria | 2494 | Open in IMG/M |
3300012951|Ga0164300_10104084 | All Organisms → cellular organisms → Bacteria | 1252 | Open in IMG/M |
3300012951|Ga0164300_10727948 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
3300012955|Ga0164298_10303167 | Not Available | 990 | Open in IMG/M |
3300012957|Ga0164303_10114441 | All Organisms → cellular organisms → Bacteria | 1363 | Open in IMG/M |
3300012958|Ga0164299_10367548 | All Organisms → cellular organisms → Bacteria | 912 | Open in IMG/M |
3300012960|Ga0164301_10547184 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
3300012961|Ga0164302_10644356 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
3300012961|Ga0164302_11765517 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
3300012975|Ga0134110_10330167 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 664 | Open in IMG/M |
3300012975|Ga0134110_10491917 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 557 | Open in IMG/M |
3300012984|Ga0164309_10333610 | All Organisms → cellular organisms → Bacteria | 1107 | Open in IMG/M |
3300012985|Ga0164308_11320870 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
3300012987|Ga0164307_10367447 | All Organisms → cellular organisms → Bacteria | 1050 | Open in IMG/M |
3300012987|Ga0164307_10943145 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
3300013296|Ga0157374_11415152 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 718 | Open in IMG/M |
3300013297|Ga0157378_10800272 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 968 | Open in IMG/M |
3300013297|Ga0157378_11334185 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
3300013306|Ga0163162_11010769 | All Organisms → cellular organisms → Bacteria | 940 | Open in IMG/M |
3300014745|Ga0157377_11342714 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
3300014969|Ga0157376_11775117 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 653 | Open in IMG/M |
3300015077|Ga0173483_10412226 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Labilitrichaceae → Labilithrix → Labilithrix luteola | 697 | Open in IMG/M |
3300015242|Ga0137412_10488054 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 944 | Open in IMG/M |
3300015374|Ga0132255_102758218 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 751 | Open in IMG/M |
3300015374|Ga0132255_103312392 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
3300015374|Ga0132255_105712279 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Sanguibacteraceae → Sanguibacter | 526 | Open in IMG/M |
3300016270|Ga0182036_10500090 | Not Available | 963 | Open in IMG/M |
3300016294|Ga0182041_11249343 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 678 | Open in IMG/M |
3300016371|Ga0182034_10075753 | All Organisms → cellular organisms → Bacteria | 2326 | Open in IMG/M |
3300018000|Ga0184604_10032466 | All Organisms → cellular organisms → Bacteria | 1337 | Open in IMG/M |
3300018051|Ga0184620_10130211 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 800 | Open in IMG/M |
3300018054|Ga0184621_10174605 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 772 | Open in IMG/M |
3300018061|Ga0184619_10003418 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 5826 | Open in IMG/M |
3300018061|Ga0184619_10198970 | All Organisms → cellular organisms → Bacteria | 921 | Open in IMG/M |
3300018061|Ga0184619_10465761 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
3300018072|Ga0184635_10326364 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
3300018078|Ga0184612_10176771 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1113 | Open in IMG/M |
3300018433|Ga0066667_10141851 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1680 | Open in IMG/M |
3300018433|Ga0066667_10399018 | All Organisms → cellular organisms → Bacteria | 1111 | Open in IMG/M |
3300018482|Ga0066669_10199314 | All Organisms → cellular organisms → Bacteria | 1531 | Open in IMG/M |
3300018482|Ga0066669_10300133 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1303 | Open in IMG/M |
3300018482|Ga0066669_11538512 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
3300019867|Ga0193704_1025396 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1202 | Open in IMG/M |
3300019873|Ga0193700_1032214 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 858 | Open in IMG/M |
3300019874|Ga0193744_1070515 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 666 | Open in IMG/M |
3300019877|Ga0193722_1024613 | All Organisms → cellular organisms → Bacteria | 1557 | Open in IMG/M |
3300019878|Ga0193715_1000466 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 9874 | Open in IMG/M |
3300019879|Ga0193723_1027361 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 1729 | Open in IMG/M |
3300019879|Ga0193723_1077957 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 952 | Open in IMG/M |
3300019879|Ga0193723_1167805 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
3300019882|Ga0193713_1015274 | Not Available | 2296 | Open in IMG/M |
3300019882|Ga0193713_1064673 | All Organisms → cellular organisms → Bacteria | 1040 | Open in IMG/M |
3300019883|Ga0193725_1131552 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
3300019885|Ga0193747_1014014 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1948 | Open in IMG/M |
3300019886|Ga0193727_1015417 | All Organisms → cellular organisms → Bacteria | 2830 | Open in IMG/M |
3300019887|Ga0193729_1019034 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6 | 2993 | Open in IMG/M |
3300019887|Ga0193729_1217672 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 636 | Open in IMG/M |
3300020001|Ga0193731_1095826 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
3300020006|Ga0193735_1003914 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 4779 | Open in IMG/M |
3300020006|Ga0193735_1178112 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
3300020010|Ga0193749_1038112 | All Organisms → cellular organisms → Bacteria | 930 | Open in IMG/M |
3300020018|Ga0193721_1003228 | All Organisms → cellular organisms → Bacteria | 4248 | Open in IMG/M |
3300020062|Ga0193724_1050534 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 879 | Open in IMG/M |
3300021168|Ga0210406_10454754 | All Organisms → cellular organisms → Bacteria | 1018 | Open in IMG/M |
3300021344|Ga0193719_10364611 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
3300021344|Ga0193719_10398229 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
3300022534|Ga0224452_1214752 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
3300022694|Ga0222623_10228767 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 719 | Open in IMG/M |
3300022694|Ga0222623_10292324 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 626 | Open in IMG/M |
3300023058|Ga0193714_1037049 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Paenibacillaceae → Cohnella | 713 | Open in IMG/M |
3300025315|Ga0207697_10003506 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 7736 | Open in IMG/M |
3300025903|Ga0207680_10530380 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
3300025906|Ga0207699_10898386 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
3300025914|Ga0207671_10366524 | All Organisms → cellular organisms → Bacteria | 1144 | Open in IMG/M |
3300025915|Ga0207693_10450334 | All Organisms → cellular organisms → Bacteria | 1006 | Open in IMG/M |
3300025916|Ga0207663_10629256 | All Organisms → cellular organisms → Bacteria | 845 | Open in IMG/M |
3300025920|Ga0207649_11275630 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
3300025925|Ga0207650_10643066 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 894 | Open in IMG/M |
3300025926|Ga0207659_10160687 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1763 | Open in IMG/M |
3300025928|Ga0207700_10504140 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1071 | Open in IMG/M |
3300025930|Ga0207701_11417750 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 566 | Open in IMG/M |
3300025939|Ga0207665_10200653 | All Organisms → cellular organisms → Bacteria → FCB group → Fibrobacteres → Fibrobacteria → Fibrobacterales → Fibrobacteraceae → Fibrobacter → unclassified Fibrobacter → Fibrobacter sp. | 1453 | Open in IMG/M |
3300025940|Ga0207691_11107680 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 658 | Open in IMG/M |
3300025945|Ga0207679_12184858 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
3300025960|Ga0207651_11271026 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
3300026067|Ga0207678_11765875 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
3300026075|Ga0207708_10192305 | All Organisms → cellular organisms → Bacteria | 1625 | Open in IMG/M |
3300026088|Ga0207641_10069198 | All Organisms → cellular organisms → Bacteria | 3029 | Open in IMG/M |
3300026316|Ga0209155_1073646 | All Organisms → cellular organisms → Bacteria | 1287 | Open in IMG/M |
3300026331|Ga0209267_1288805 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
3300026374|Ga0257146_1038941 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 771 | Open in IMG/M |
3300026498|Ga0257156_1038817 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 971 | Open in IMG/M |
3300026523|Ga0209808_1047092 | All Organisms → cellular organisms → Bacteria | 1989 | Open in IMG/M |
3300026528|Ga0209378_1071802 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1590 | Open in IMG/M |
3300026538|Ga0209056_10003535 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria | 16627 | Open in IMG/M |
3300027453|Ga0207624_103531 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 808 | Open in IMG/M |
3300027748|Ga0209689_1395970 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
3300027821|Ga0209811_10270397 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
3300027889|Ga0209380_10773760 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
3300028721|Ga0307315_10218418 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
3300028814|Ga0307302_10236505 | All Organisms → cellular organisms → Bacteria | 894 | Open in IMG/M |
3300028824|Ga0307310_10524256 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
3300028878|Ga0307278_10169764 | All Organisms → cellular organisms → Bacteria | 975 | Open in IMG/M |
3300028881|Ga0307277_10377921 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 632 | Open in IMG/M |
3300030776|Ga0075396_1875735 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 699 | Open in IMG/M |
3300030916|Ga0075386_12173359 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 587 | Open in IMG/M |
3300031231|Ga0170824_108860261 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 983 | Open in IMG/M |
3300031231|Ga0170824_126823190 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1366 | Open in IMG/M |
3300031446|Ga0170820_10401163 | All Organisms → cellular organisms → Bacteria | 3909 | Open in IMG/M |
3300031446|Ga0170820_13755897 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 539 | Open in IMG/M |
3300031469|Ga0170819_16423681 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 582 | Open in IMG/M |
3300031820|Ga0307473_11545790 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
3300031938|Ga0308175_102669087 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
3300031954|Ga0306926_12649247 | Not Available | 546 | Open in IMG/M |
3300031962|Ga0307479_11018392 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 797 | Open in IMG/M |
3300032035|Ga0310911_10107660 | All Organisms → cellular organisms → Bacteria | 1535 | Open in IMG/M |
3300032180|Ga0307471_100654873 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus | 1213 | Open in IMG/M |
3300032205|Ga0307472_100053295 | All Organisms → cellular organisms → Bacteria | 2535 | Open in IMG/M |
3300032205|Ga0307472_101862552 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
3300032421|Ga0310812_10232633 | All Organisms → cellular organisms → Bacteria | 807 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 18.62% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 16.60% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 12.55% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.48% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.45% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.24% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.43% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.43% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.83% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.83% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.83% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.02% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.02% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.02% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.62% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.62% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.62% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.62% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.21% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.21% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.21% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.21% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.21% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.40% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.40% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.40% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.40% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.40% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.40% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.40% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.40% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.40% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.40% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.40% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.40% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.40% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.40% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.40% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2088090014 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
2170459003 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cm | Environmental | Open in IMG/M |
3300000596 | Amended soil microbial communities from Kansas Great Prairies, USA - Total DNA no BrdU F1.4TC | Environmental | Open in IMG/M |
3300000881 | Soil microbial communities from Great Prairies - Wisconsin Restored Prairie soil | Environmental | Open in IMG/M |
3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300001139 | Soil microbial communities from Great Prairies - Wisconsin, Switchgrass soil | Environmental | Open in IMG/M |
3300001141 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M2 | Environmental | Open in IMG/M |
3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012905 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2 | Environmental | Open in IMG/M |
3300012911 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2 | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300018000 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex | Environmental | Open in IMG/M |
3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019867 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m1 | Environmental | Open in IMG/M |
3300019873 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s1 | Environmental | Open in IMG/M |
3300019874 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1a1 | Environmental | Open in IMG/M |
3300019877 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1 | Environmental | Open in IMG/M |
3300019878 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m2 | Environmental | Open in IMG/M |
3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
3300019882 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2 | Environmental | Open in IMG/M |
3300019883 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2 | Environmental | Open in IMG/M |
3300019885 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2 | Environmental | Open in IMG/M |
3300019886 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2 | Environmental | Open in IMG/M |
3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
3300020001 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a2 | Environmental | Open in IMG/M |
3300020006 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2 | Environmental | Open in IMG/M |
3300020010 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1s2 | Environmental | Open in IMG/M |
3300020018 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2 | Environmental | Open in IMG/M |
3300020062 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a1 | Environmental | Open in IMG/M |
3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
3300022534 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1 | Environmental | Open in IMG/M |
3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
3300023058 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m1 | Environmental | Open in IMG/M |
3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026316 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes) | Environmental | Open in IMG/M |
3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
3300026374 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-A | Environmental | Open in IMG/M |
3300026498 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-49-A | Environmental | Open in IMG/M |
3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
3300027453 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-ROWE15-D (SPAdes) | Environmental | Open in IMG/M |
3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
3300028721 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355 | Environmental | Open in IMG/M |
3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
3300030776 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA10 Emin (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030916 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032421 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
GPIPI_00301470 | 2088090014 | Soil | MRVVAVMLLLSAGIAAEAMSYSFVSKASGRLGGPIRFEFYRDSTTR |
E4A_09451830 | 2170459003 | Grass Soil | MRVVAVMLLLSAGIAAEAMSYSFVSKASGRLGGPIRFV |
KanNP_Total_noBrdU_T14TCDRAFT_10172873 | 3300000596 | Soil | MLMRVVAVMLLLSVGIAAEAMSYSFVCKASGRLGGPIRFEFYGDSTRR |
JGI10215J12807_11696011 | 3300000881 | Soil | MRVVAVILLLSAGIAAEAMSYSFVSKASGRLGGPIRFEFYR |
JGI11643J12802_100344921 | 3300000890 | Soil | MRVVAVILLLSAFIAAEAMSYSFVSKASGRLGGPIR |
JGI11643J12802_107634142 | 3300000890 | Soil | MRVVAVILLLSAGIAAEAMSYSFVSKASGRLGGPIR |
JGI11643J12802_112623303 | 3300000890 | Soil | MLMRVVAVMLLLSAGIAAGAVSYSFVSKASGRLGGPIR |
JGI10216J12902_1152709862 | 3300000956 | Soil | MLLLSAGIASAAMSYSFVCKAKGRLGGPIRFEFYDD |
JGI10220J13317_108481072 | 3300001139 | Soil | MRVVAVILLLSAGIAAEAMSYSFVSKASGRLGGPIGFEFYRDSTTHPKTG |
JGI12638J13249_1032131 | 3300001141 | Forest Soil | MLMRVVAVMLLLTAGIAAEAMSYSFVSKASGRLGGPIRFEFYRDSTTRP |
Ga0063454_1018792092 | 3300004081 | Soil | MLMRVVAVMLLLCASVVAKPTSHSFVCKAGGRLGGSIRFEFYRDSGARP |
Ga0062595_1020184291 | 3300004479 | Soil | MRVVAVILLLSAGIAAEAMSYSFVSKASGRLGGPIRFEFYHDSTTRP |
Ga0062592_1017794971 | 3300004480 | Soil | MRIVVAMLLLCASIAAEAMSYSFVCKASGRLGRPIRFEFYGDSSTIPKTDIK |
Ga0066674_105069261 | 3300005166 | Soil | MLMRIVAVMLLLSAGIAAEAMSYSFVSKASGRLGGPIRFEFYRD |
Ga0066672_107486231 | 3300005167 | Soil | MLMRVVAVMLLLSAGIAVEAMSYSFVCKASGRLGGPIRFEFYGDSTTR |
Ga0066677_102561011 | 3300005171 | Soil | MLMRVVAFMLLLSAGIAAEAMSYSFVSKARGRLGGPIRFEFY |
Ga0066673_103108742 | 3300005175 | Soil | MLMRVVAVMLLLSAGIAAEAMSYSFVCKASGRLGGPIRFEFYRDSTTRPKTD |
Ga0066673_106276881 | 3300005175 | Soil | MLMRVVAVMLLLSAGIAAEAVSYSFVSKASGRLGGPIRFEFY |
Ga0066673_107061512 | 3300005175 | Soil | MRVVAVMLLLSAGIAAAAMSYSFVSKASGRLGGPIRFEFY |
Ga0066688_100843391 | 3300005178 | Soil | MRVVAVMLLLSAGIAAEAMSYSFVSKARGRLGGPIRFEFY |
Ga0066684_100381914 | 3300005179 | Soil | MLMRVVAFMLLLSTGIAAEAMSYSFVSKARGRLGGPIRFE |
Ga0066685_103216103 | 3300005180 | Soil | MLMRVVAVMLLLSAGIAAEAVSYSFVSKASGRLGGPIRFEFYRDS |
Ga0066685_104489302 | 3300005180 | Soil | MRVVAVMLLLSAGIAAEAVSYSFVSKASGRLGGPIRFEFYRDS |
Ga0066671_101106621 | 3300005184 | Soil | MRVVAVMLLLSAGIAAEAMSYSFVSKARGRLGGPIRFEFYRDST |
Ga0066676_106237192 | 3300005186 | Soil | MRVVAVMLLLSAAIAAEAMSYSFVCKASGRLGGPIRFEFYHDSTTRPKTDIA |
Ga0065712_107065112 | 3300005290 | Miscanthus Rhizosphere | MLMRFVAVMLLLSAGIAAEAMSYSFVSKASGRLGGPIRFEFYR |
Ga0070683_1009696241 | 3300005329 | Corn Rhizosphere | MLSAGIAAEAMSHSFVSKANGRLGGPIRFEFYGDSTTRPKTD |
Ga0070670_1009739102 | 3300005331 | Switchgrass Rhizosphere | MLMRVVAVMLLLSAGIVGGAMSYSFVSKVSGQLGGPIRFA |
Ga0066388_1008040801 | 3300005332 | Tropical Forest Soil | MLMRVVAVMLLLSAGIAAEAMSYSFVCKASGRLGGPIRFE |
Ga0070666_111006442 | 3300005335 | Switchgrass Rhizosphere | MRVVAVMLLLSAGIAAEAVSYSFVSKASGRLGGPIRFEFYRDST |
Ga0070671_1000345781 | 3300005355 | Switchgrass Rhizosphere | MLMRVVAALLLLSAGIAAEAMSYSFVSKASGRLGGPIRFEFYRDS |
Ga0070667_1016783962 | 3300005367 | Switchgrass Rhizosphere | MRVVVVTLLLFAGIATEAMSDTFVIKASGRLGGPIRFEFFRASTARPKTDIK |
Ga0070713_1010766801 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MLMRVVVVMLLLSAGIAAEAMSYSFVSKASGRLGGPIRFEFYRDSTT |
Ga0070711_1012689842 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MLMRVVAVMLLLSAGIAAEAMSYSFVSKASGRLGGPIRFEFYRDS |
Ga0070708_1011214441 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MRIVAIMLLLSAGIAAEAVSNSFVCKASGRLGGPIRFEFYRD |
Ga0066689_100755634 | 3300005447 | Soil | MRVVAVMLLLSAGIAAEAISYSFVSKASGRLGGPIRFEFYRDST |
Ga0066682_108999372 | 3300005450 | Soil | MLMRVVAVMLLLSAGLAAEAMSYSFVSKASGRLGGPIRFEFYRDSTRRPKTDI |
Ga0070707_1020919622 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MRVVAVMLLLSAGIAAEAVSYSFVSKASGRLGGPIRFEFYRD |
Ga0070697_1013003391 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MRVVAVILLMFASAAAEARSHSFVSRARGRLGGPIRFEFYRDSTTRPKTDIKS |
Ga0066697_100924373 | 3300005540 | Soil | MLMRVVAVTLLLSAGLAAEAVSYSFVSKASGRLGGPIRFEFYRDSNTR |
Ga0066697_106762182 | 3300005540 | Soil | MLMRVVAVILLLSAGIAAEAVSYSFVSKASGRLGGPIRFEFY |
Ga0070686_1002692991 | 3300005544 | Switchgrass Rhizosphere | MLMRVIAVMLLLCAGIATEAMSYSFVSKVSGRLGRPIRFEFYYDSTTRQKT |
Ga0070696_1016246472 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MLMRVVAVMLLLSASIAAEAVSYSFVSKASGRLGGPIRFEFYRDST |
Ga0070704_1010208932 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MLTRVVAVMLLLFTGATAEAMSHSFVSRARGRLGGPIRFEFYRDS |
Ga0066670_103064821 | 3300005560 | Soil | MLMRVVAVMLLLSAGIAAEAVSYSFVCKASGRLGGPIRFEFYGDSTTRPK |
Ga0070664_1014850062 | 3300005564 | Corn Rhizosphere | MRICAVMLLLSAAIAAGAMSYSFVSKVSGRLGGRIRFEFYSDSTTH |
Ga0066694_102390391 | 3300005574 | Soil | MRIVAVMLLLSAGIAAEAMSYSFVSKASGRLGGPIRFEFYRD |
Ga0066702_106390021 | 3300005575 | Soil | MRVVAVMLLLSAGIAAEAVSYSFVSKASGRLGGPIRFEFY |
Ga0066708_100951641 | 3300005576 | Soil | MLMRVVAVMLLLSAGIAAEAMSYSFVCKASGRLGGPIRFEFY |
Ga0066708_105589181 | 3300005576 | Soil | MLMRVVAVMLLLSAGIAAEAVSYSFVCKASGRLGGPIRFEFYGDSTT |
Ga0066708_108072341 | 3300005576 | Soil | MRVVAVMLLLSAGIAAEAVSYSFVCKASGRLGGPIRFEFYGDSTT |
Ga0066654_101486223 | 3300005587 | Soil | MLMRVVAVMLLLSAGIAAEAMSYSFVCKASGRLGGPIR |
Ga0066706_106083551 | 3300005598 | Soil | MLMRVVAFMLLLSTGIAAEAMSYSFVSKARGRLGGPIRFEFYGESTTRPKTDI |
Ga0066706_109340131 | 3300005598 | Soil | MLMRVVAVMLLLSAGIAAEAMSYSFVCKASGRLGGPIRF |
Ga0066903_1008028621 | 3300005764 | Tropical Forest Soil | MRVVAVMLLLSAGIAAESMSYSFVSKASGRLGGPI |
Ga0066903_1035309741 | 3300005764 | Tropical Forest Soil | MLMRLFAVMLLLSAGIAAEAMSYSFVCKASGRLGG |
Ga0066903_1087362951 | 3300005764 | Tropical Forest Soil | MRVVAVMLLLSVGIAAEARPNSFLCKARGRLGGPIRFEFHRDATTRAKI |
Ga0070717_100430245 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MLMRVVAVMLLLSAGIAAEAMSYSFVSKASGRLGRPIRFEFYRDSTTRPKT |
Ga0066696_100878274 | 3300006032 | Soil | MLMRVVAVTLLLSAGLAAEAVSYSFVSKASGRLGGPI |
Ga0066696_104307771 | 3300006032 | Soil | MLMRVVAVMLLLSAGIAAEAMSYSFVSKARGRLGGPIRFEFY |
Ga0066696_110152532 | 3300006032 | Soil | MLMRVAIMLLLSAGIAAEAMSYSFVCKASGRLGGPIRF |
Ga0066652_1000430921 | 3300006046 | Soil | MLMRVVAVMLLLSAGIAAEAMSYSFVSKASGRLGG |
Ga0066652_1008332343 | 3300006046 | Soil | MRVAAVMLLLSAGIAAEAMSYSFVCKASGRLGGPIRFEFYH |
Ga0070716_1012629143 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MLMRFVAVMLLLSAGIAAEAMSYSFVSKASGRLGGP |
Ga0068871_1014244922 | 3300006358 | Miscanthus Rhizosphere | MRVVAAMLLLSAGIAAGAMSYSFISKASGRLGGPIRF |
Ga0066653_100064811 | 3300006791 | Soil | MRVVAVMLLLSAGIAAEAMSYSFVCKASGRLGGPI |
Ga0066665_108391041 | 3300006796 | Soil | MLMRVVAFMLLLSTGIAAEAMSYSFVSKARGRLGGPIRFEFYGESTTRPKTDIE |
Ga0075428_1020670131 | 3300006844 | Populus Rhizosphere | MLMRVVVVMLLLSAGIAAEAMSYSFVSKASGRLGGPIRF |
Ga0099791_100189792 | 3300007255 | Vadose Zone Soil | MRVVAVMLLLSAGIAAEAVSYSFVSKASGRLGGPVRFEF |
Ga0099791_100984063 | 3300007255 | Vadose Zone Soil | MRVVAVMLLLSAGIAAEAMSYSFVSKASGRLGGPIRFEFYRDSTRRPKTDIE |
Ga0099793_101622112 | 3300007258 | Vadose Zone Soil | MRVVAVMLLLFAGIAAEAMSYSFVSKASGRLGGPIRFEFYRDSTTRPKTDIE* |
Ga0099793_101992881 | 3300007258 | Vadose Zone Soil | MLLRVVAVMLLLSAGIAAEAMSYSFVCKASGRLGGPIRFEFYQDSTTRP |
Ga0066710_1001395864 | 3300009012 | Grasslands Soil | MLMRVVAVTLLLSAGLAAEAVSYSFVSKASGRLGGPIR |
Ga0066710_1017223581 | 3300009012 | Grasslands Soil | MRVVAVMLLLSAGIAVEAMSYSFVCKASGRLGGPIRFE |
Ga0075418_117775992 | 3300009100 | Populus Rhizosphere | MRVVAVMLLLSVGIAAEAMSYSFVSKANGRLGGPIR |
Ga0105247_116747101 | 3300009101 | Switchgrass Rhizosphere | MLMRVVAVMLLLSAGIAAEAMSYSFVSKASGRLGR |
Ga0066709_1017008321 | 3300009137 | Grasslands Soil | MRVVAVMLLVAAGIAAEAMSYSFVSKASGRLGGPILFEFYRDSTK |
Ga0066709_1020270661 | 3300009137 | Grasslands Soil | MLTRVVAVMLLLSAGIAAEAISYSFVSKASGRLGGPIRFEFYGDS |
Ga0066709_1025840192 | 3300009137 | Grasslands Soil | MRVVAVMLLLSAGIAAEAMSYSFVCKASGRLGGPIRFEFY |
Ga0066709_1039158201 | 3300009137 | Grasslands Soil | MGVVAVMLLLSAGMAAEAVSYSFVSKASGRLGGPIRFEFYRDSTTR |
Ga0111538_112988552 | 3300009156 | Populus Rhizosphere | MRIIAVMLLLSAGIAAEAMSYSFVCKASGRLGGPIRFEFYGDSTTRPKT |
Ga0111538_117622141 | 3300009156 | Populus Rhizosphere | MRVVAVMLLLSAGIAVEAMSYSFVSKASGQLGGPIRFEF |
Ga0126373_109984602 | 3300010048 | Tropical Forest Soil | MLMRIVAVMLLLSAGIAAEAVSYSFVCKASGRLGEPIRFEFYGDSTTRLKT |
Ga0134084_100589543 | 3300010322 | Grasslands Soil | MRVVAVMLLLSAGIAAEAMSYSFVSKASGRLGGPIRFEFY |
Ga0134086_103182152 | 3300010323 | Grasslands Soil | MLLLSAGIAAEAMSYSFVSKASGRLGGPIRFEFYRDSTTRP |
Ga0134080_102708121 | 3300010333 | Grasslands Soil | MRVVTVMLLLSAGIAAAAMSYSFICKASGRLGGPIRFEFYSDSTAR |
Ga0134080_103879532 | 3300010333 | Grasslands Soil | MRVVAVILLLSAGIAAEAVSYSFVSKASGRLGGPIRFEFYHDST |
Ga0134063_103839012 | 3300010335 | Grasslands Soil | MRVVAVMLLLSAGIAAEAMSYSFVCKASGRLGGLIRFEFYRDSIPHPKTD |
Ga0126370_110270222 | 3300010358 | Tropical Forest Soil | MLMRVVAVMLLLSAGIAAAAMSYSFVCKASGRLGGPIRFEFYGDS |
Ga0126370_126278042 | 3300010358 | Tropical Forest Soil | MRVVAVILLLAAGIAAEAMSYSFVCKASGRLGRPIRFAFYRDAT |
Ga0134125_109281071 | 3300010371 | Terrestrial Soil | MRVLAVILMLSAGIAAEAMSHSFVSKANGRLGGPIRFEFYGDSTTRPKT |
Ga0126381_1002363302 | 3300010376 | Tropical Forest Soil | MRVVAVMLLLSAGIAAGAMSYSFVSKVSGRLGGPIRFEFYGDSTTRLKTDIKS |
Ga0126381_1004444241 | 3300010376 | Tropical Forest Soil | MRVVAIMLLLSAGIAAEATSYSFVSKASGRLGGPIRFEFYRD |
Ga0134124_118780951 | 3300010397 | Terrestrial Soil | MLTRVVAVMLLLFTGATAEAMSHSFVSRARGRLGGPIRFEFY |
Ga0134122_131258591 | 3300010400 | Terrestrial Soil | MRVVAVILLLSAGIAAEAMSYSFVSKASGRLGGPIRFQFY |
Ga0137364_100482688 | 3300012198 | Vadose Zone Soil | MRVVAVMLLLSAGIAAESVSYSFVSKASGRLGGPIRFEFYRDST |
Ga0137364_102275821 | 3300012198 | Vadose Zone Soil | MRVVAVTLLLSAGLAAEAVSYSFVSKASGRLGGPI |
Ga0137383_100169706 | 3300012199 | Vadose Zone Soil | MRVVAFMLLLSTGIAAEAMSYSFVSKARGRLGGPIRFEFYGEST |
Ga0137383_107576842 | 3300012199 | Vadose Zone Soil | MRVVAVMLLLAAGIAAAAMSYSFVSKASGRLGGPIRFEFY |
Ga0137383_112833421 | 3300012199 | Vadose Zone Soil | MRVVAVMLLLSAGIAAEAMSYSFVCKASGRLGGPIRFEFYRDSTTRPKTDIESFT |
Ga0137374_102443451 | 3300012204 | Vadose Zone Soil | MRVAAVMLLLSAGIAAEAMSYSFVSKASGRLGGPIRFEFYRDST |
Ga0137380_107004901 | 3300012206 | Vadose Zone Soil | MRVVAVMLLLSAGIAAEAMSYSFGCKASGRLGGPIRFEFYGD |
Ga0137381_105452701 | 3300012207 | Vadose Zone Soil | MRVVAFMLLLSTGIAAEAMSYSFVSKARGRLGGPIRFEFYRDSTTRPKTDIE |
Ga0137381_110297672 | 3300012207 | Vadose Zone Soil | MRVVAVMLLLSAGIAAEAMSYSFVSKVSGRLGGPI |
Ga0137376_103234713 | 3300012208 | Vadose Zone Soil | MRAVAVMLLLSAGIAAAAMSYSFVSKASGRLGGPIRFEFYHDSTKRPKTDI |
Ga0137370_100963433 | 3300012285 | Vadose Zone Soil | MRVVAVMLLLSAGIAAEAISYSFVSKASGRLGGPIRFEFYHDS |
Ga0137370_102223911 | 3300012285 | Vadose Zone Soil | MRVVAVMLLLSVCIAAEAVSYSFVCKASGRLGGPIRFEFYRDS |
Ga0137370_106016201 | 3300012285 | Vadose Zone Soil | MRVVAVMLLLSAGIAAAAMSYSFICKASGRLGGPIRFEFYSD |
Ga0137387_102372513 | 3300012349 | Vadose Zone Soil | MRVVAVMLLLSAGIAAEAVSYSFVSKASGRLGGPIRFDFYHDSTTRPKTD |
Ga0137367_101901641 | 3300012353 | Vadose Zone Soil | MRVAAVMLLLSAGIAAEAMSYSFVSKASGRLGGPIRFE |
Ga0137366_101335911 | 3300012354 | Vadose Zone Soil | MRVVAVTLLLSAGLAAEAVSYSFVSKASGRLGGPIR |
Ga0137366_109806641 | 3300012354 | Vadose Zone Soil | MLLLSAGIAAEAMSYSFVSKASGRLGGPIRFEFYRD |
Ga0137369_101116021 | 3300012355 | Vadose Zone Soil | MRVVAVMLLLSAGIAAEAVSYSFVSKASGRLGGPIRFEFYRDSTTRPKTDI |
Ga0137369_102071322 | 3300012355 | Vadose Zone Soil | MRVAAVMLLLSAGIAAEAMSYSFVSKASGRLGGPIRFEFYRDSTT |
Ga0137384_112025702 | 3300012357 | Vadose Zone Soil | MRVVAVVLLLSAGIAAEAMSYSFVSKASGRLGGPIRFEFYRDS |
Ga0137385_105278481 | 3300012359 | Vadose Zone Soil | MRVVAVTLLLSGGLAAEAVSYSFVSKASGRLGGPIRFEFYG |
Ga0137358_109680911 | 3300012582 | Vadose Zone Soil | MRVVALMLLLSAGIAAEAMSYSFVSKARGRLGGPIRFEFYRDSTT |
Ga0157296_103484641 | 3300012905 | Soil | MRVVVAMLLLSAGIAAEAMSYSFVCKASGRLGGPIRFEFYAESTTRPK |
Ga0157301_101813491 | 3300012911 | Soil | MRVVVAMLLLAAGIAAEAMSYSFVCKASGRLGGPIRFE |
Ga0137395_109818161 | 3300012917 | Vadose Zone Soil | MRVVAVMLLLSAGIAAGAISYSFVSKASGRLDGPIRFEFYGDSTKRPKTDIE |
Ga0137394_106936941 | 3300012922 | Vadose Zone Soil | MRVVAVMLLLAAGIAAEAMSYSFVSKASGRLGGPIRFEFYRDSTTVPKTDIE |
Ga0137404_116742081 | 3300012929 | Vadose Zone Soil | MRVVAAMLLLSAGIAAEAMSYSFVCKANGRLGGPIRFEFYGDSTTRPKTDI |
Ga0137407_110031692 | 3300012930 | Vadose Zone Soil | MRVVAFMLLLSAGIAAEAVSYSFVCKASGGLGGPIRFEFYRDSTTRPKTDIE |
Ga0164300_100159911 | 3300012951 | Soil | MLMRVVAVMLLLSAGIAAEAMSYSFVAKASGRLGGPIRFEFYHDSTTRPKT |
Ga0164300_101040841 | 3300012951 | Soil | MRVVAVILLLSAGIAAEAMSYSFVSKASGRLGGPIRFEF |
Ga0164300_107279482 | 3300012951 | Soil | MRVVAVMLLLCVGIAAETVSYSFVSKASGRLGGPIRFEFYGDSTT |
Ga0164298_103031673 | 3300012955 | Soil | MRVVAVMLLLSAGIAAEAMSYSFVCKASGRLGGPIRFEFYGDSTAHPKTDIK |
Ga0164303_101144411 | 3300012957 | Soil | MRVVAVILLLSAGIAAEAMSYSFVSKASGRLGGPIRFEFY |
Ga0164299_103675482 | 3300012958 | Soil | MRVVAVMLLLSAGIAAEAMSYSFVSKASGRLGGRIRFEFYGDSTTRP |
Ga0164301_105471842 | 3300012960 | Soil | MRVVAVILLLSAGIAAEAMSYSFASKASGRLGGPIRFEFYRDSSTRPKTDI |
Ga0164302_106443562 | 3300012961 | Soil | MRVVAVILLLSAGIAAEAMSYSFVSKASGRLGGPIRFEFYRDSTTR |
Ga0164302_117655171 | 3300012961 | Soil | MLMRVVAVMLLLFAGIAAGAMSYSFVSKASGRLGRPIRFEFY |
Ga0134110_103301672 | 3300012975 | Grasslands Soil | MRVVAVMLLLSAGIAAEAMSYSFVSKASGRLGGPIRFEFYHDS |
Ga0134110_104919171 | 3300012975 | Grasslands Soil | MRVVAVMLLLSAGIAAEAMSYSFVCKASGRLGGPIRFE |
Ga0164309_103336101 | 3300012984 | Soil | MLLLCVGIAAEAVSYSFVSKASGRLGGRIRFEFYGDSTTR |
Ga0164308_113208702 | 3300012985 | Soil | MLMRVVAVILLLSAGIAAEAMSYSFVSKASGRLGG |
Ga0164307_103674471 | 3300012987 | Soil | MRVVAVMLLLCVGIAAEAVSYSFVSKASGRLGGRIRFEFYGD |
Ga0164307_109431452 | 3300012987 | Soil | MLLLSAGIAAEAMSYSFVSKASGRLGGPIRFEFYGDSTTRPKTDIESF |
Ga0157374_114151522 | 3300013296 | Miscanthus Rhizosphere | MRVVAVMLLLSAGIVGGAMSYSFVSKVSGQLGGPIRFAFYRDST |
Ga0157374_127148781 | 3300013296 | Miscanthus Rhizosphere | MRVVAVMLLLSASIAAEAMSYSFVSKASGRLGGPIRFEFY |
Ga0157378_108002721 | 3300013297 | Miscanthus Rhizosphere | MRFVAVMLLLSAGIAAEAMSYSFVSKASGRLGGPIR |
Ga0157378_113341851 | 3300013297 | Miscanthus Rhizosphere | MRVVAVILLLSAGIAAEAMSYSFVSKASGRLGGPIRFEFYRDSTTHP |
Ga0163162_110107691 | 3300013306 | Switchgrass Rhizosphere | MRVVAVMLLLSASIAAEAMSYSFVSKASGRLGGPIRFEFYGDS |
Ga0157377_113427141 | 3300014745 | Miscanthus Rhizosphere | MRIVVAMLLLCASIAAEAMSYSFVCKASGRLGGPIRFQFYRDSTTHPKTDI |
Ga0157376_117751172 | 3300014969 | Miscanthus Rhizosphere | MRVVAAILLLSAGIAAEAMSYSFVCKASGRLGGPIRFEFYRDSTTR |
Ga0173483_104122262 | 3300015077 | Soil | MRVVAVMLLLSAGIAAEAMSYSFVSKASGRLGGPIRFEFYRDSTT |
Ga0137412_104880541 | 3300015242 | Vadose Zone Soil | MRIVAVMLLLAAGIAAEATSYSFVSKASGRLGGPIRFEFYRDSTTVPKT |
Ga0132255_1027582182 | 3300015374 | Arabidopsis Rhizosphere | MRVVAVILLLSAGIAAEAMSYSFVSKASGRLGGPIRFEFYRDSSRR |
Ga0132255_1033123921 | 3300015374 | Arabidopsis Rhizosphere | MRVVAAVLLLSAGIAAEAVSYSFVCKASGRLGGPIRFEFYRD |
Ga0132255_1057122792 | 3300015374 | Arabidopsis Rhizosphere | MRVVAVMLLLCAGIAAEAMSYSFVSKASGRLGGPIRF |
Ga0182036_105000901 | 3300016270 | Soil | MLMRVVAVMLLLSAGIAAEAMSYSFVCKASGRLGGPIRFEFYSGSATRPKTDIKS |
Ga0182041_112493432 | 3300016294 | Soil | MRVVPVILLLSAGIAAEAMSYSFVSKVSGRLGGPIHFEFYGKSSTRPK |
Ga0182034_100757531 | 3300016371 | Soil | MRIIAVMLLLSTGITAEAMSYSFVCKASGRLGGPIR |
Ga0184604_100324661 | 3300018000 | Groundwater Sediment | MLMRVVAVMLLLSAGIAAEAMSYSFVSKASGRLGGPIRFEFYRDSTKRPKTD |
Ga0184620_101302111 | 3300018051 | Groundwater Sediment | MRVVAVMLLLSAGIAAEAVSYSFVSKASGRLGGPIRFEFYRDSTTR |
Ga0184621_101746053 | 3300018054 | Groundwater Sediment | MRVVAVMLLLSAGIAAEAMSYSFVSKASGRLGGPIRFEFYRD |
Ga0184619_100034189 | 3300018061 | Groundwater Sediment | MRVVAVMLLLSAGIAAEAVSYSFVSKASGRLGGPIR |
Ga0184619_101989702 | 3300018061 | Groundwater Sediment | MRVVAVMLLLSAGIAAEAMSYSFVSKASGRLGGPIRFEFYRDSTTRPK |
Ga0184619_104657612 | 3300018061 | Groundwater Sediment | MLMRVVAVMLLLSAGIAAEAVSYSFVSKASGRLGGPIR |
Ga0184635_103263642 | 3300018072 | Groundwater Sediment | MRVVAVMLLLSAGIAAEAMSYSFVSKASGRLGGPIRFEFYRDST |
Ga0184612_101767712 | 3300018078 | Groundwater Sediment | MRVVAVMLLLFAGIAAEAMSYSFVSKASGRLGGPI |
Ga0066667_101418511 | 3300018433 | Grasslands Soil | MRVVAVMLLLSAGIAAEAMSYSFVSKARGRLGGPIRFE |
Ga0066667_103990181 | 3300018433 | Grasslands Soil | MLMRVVAVMLLLSAGIAAEAMSYSFVSKARGRLGGPIRFE |
Ga0066669_101993141 | 3300018482 | Grasslands Soil | MRVVAVMLLLSAGIAAEAMSYSFVSKASGRLGGPIR |
Ga0066669_103001331 | 3300018482 | Grasslands Soil | MRVVAVMLLLSAGIAAEAMSYSFVSKARGRLGGPIRFEF |
Ga0066669_115385122 | 3300018482 | Grasslands Soil | MRVVAVMLLLSAGIAAEAMSYSFVCKASGRLGGPIRFEFYRDSTTRPKTD |
Ga0193704_10253961 | 3300019867 | Soil | MRVVAVMLLLSAGIAAEAMSYSFVSKASGRLGGPIRF |
Ga0193700_10322142 | 3300019873 | Soil | MRVVAVMLLLSAGIAAEAVSYSFVSKASGRLGGPIRFEFYHDST |
Ga0193744_10705152 | 3300019874 | Soil | MRVVAVMLLLSAGIAAEAMSYSFVSKASGRLGGPIRFEFYRDSTTRPKT |
Ga0193722_10246132 | 3300019877 | Soil | MLMRFVAVMLLLSAGIAAEAMSYSFVSKASGRLGGPIRF |
Ga0193715_10004661 | 3300019878 | Soil | MLMRVVAVMLLLSAGIAAEAVSYSFVSKASGRLGG |
Ga0193723_10273613 | 3300019879 | Soil | MRVVAVMLLLSAGIAAEAMSYSFVSKASGRLGGPIRFEFYRDS |
Ga0193723_10779571 | 3300019879 | Soil | MRVVAAILLLSAGIAAEAMSYSFVSKASGRLGGPIRFE |
Ga0193723_11678051 | 3300019879 | Soil | MLMRFVAVMLLLSAGIAAEAMSYSFVSKASGRLGGPIRFEFYRDSTTRP |
Ga0193713_10152741 | 3300019882 | Soil | MLMRVVAVMLLLSAGIAAEAVSYSFVSKASGRLGGPI |
Ga0193713_10646732 | 3300019882 | Soil | MRVVAVMLLLSAGIAAEAVSYSFVCKASGRLGGPIRFEFYRDSTTRPK |
Ga0193725_11315522 | 3300019883 | Soil | MLMRVVAVMLLLSAGIAAEAMSYSFVSKASGRLGGPIRFQFYRDSTTLPK |
Ga0193747_10140143 | 3300019885 | Soil | MLMRVVAVMLLLSAGIAAEAVSYSFVSKASGRLGGPIRF |
Ga0193727_10154171 | 3300019886 | Soil | MLMRVVAVMLLLSAGIAAEAMSYSFVSKASGRLGGPI |
Ga0193729_10190341 | 3300019887 | Soil | MRVVAVMLLLSAGIAAEAVSYSFVSKASGRLGGPIRFEFYRDSTT |
Ga0193729_12176721 | 3300019887 | Soil | MRVVAVMLLLSAGIAAEAMSYSFVTKASGRLGGPIRFEFYRDSTTRPKT |
Ga0193731_10958261 | 3300020001 | Soil | MLMRVVAVMLLLSAGIAAEAMSYSFVSKASGRLGGPIRFEFYRDSTTRPKTDI |
Ga0193735_10039141 | 3300020006 | Soil | MLMRVVAVMLLLSAGIAAEAMSYSFVSKASGRLGGPIRFEFYHDSTARPKTDIKT |
Ga0193735_11781121 | 3300020006 | Soil | MRVFAVILLLSAGIAAEAMSYSFVSKASGRLGGPIRFEFYRDSTT |
Ga0193749_10381122 | 3300020010 | Soil | MLMRVVAVMLLLSASIAAEAVSYSFVSKASGRLGEPIRF |
Ga0193721_10032287 | 3300020018 | Soil | MRVVAVMLLLSAGIAAEAVSYSFVSKASGRLGGPI |
Ga0193724_10505341 | 3300020062 | Soil | MLMRVVAVMLLLSAGIAAEAVSYSFVSKASGRLGGPIRFEFYSDS |
Ga0210406_104547541 | 3300021168 | Soil | MRVVTVMLLLSAGIAAEAVSYSFVSKASGRLGGPIRFEFYHDSTT |
Ga0193719_103646112 | 3300021344 | Soil | MLMRVVAVMLLLFAGIAAEAMSYSFVSKASGRLGGPIRFEFYRDSTTRPKTDI |
Ga0193719_103982292 | 3300021344 | Soil | MRVVAVMLLLSAGIAAEAVSYSFVCKASGRLGGPIRFEFYGDSTTRPKTD |
Ga0224452_12147522 | 3300022534 | Groundwater Sediment | MRVVAVMLLLSAGIAAEAVSYSFVSKASGRLGGPIRF |
Ga0222623_102287673 | 3300022694 | Groundwater Sediment | MRVVAVMLLLSAGIAAEAMSYSFVSKASGRLGGPIRFEFYRDSTTRPKTDI |
Ga0222623_102923241 | 3300022694 | Groundwater Sediment | MLMRVVAVMLLLSAGIAAEAMSYSFVSKASGRLGGPIRFE |
Ga0193714_10370491 | 3300023058 | Soil | MLMRVVAVILLLSAGIAAGAMSYSFVSKASGRLGGPIHFEFYRDSTTRPTTDI |
Ga0207697_100035067 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | MLMRVVAVILLLSAGIAAEAMSYSFVSKASGRLGGPIRFEF |
Ga0207680_105303802 | 3300025903 | Switchgrass Rhizosphere | MLMRFVAVMLLLSAGIAAEAMSYSFVCKASGRLGGPIRFEFYRDSTTRPKTDIKS |
Ga0207699_108983862 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MRFVAVMLLLSAGIAAEAMSYSFVSKASGRLGGPIRFEFYRDSTTRP |
Ga0207671_103665241 | 3300025914 | Corn Rhizosphere | MLMRVLAAMLLLSAVIAAEAMSYSFVCKAKGRLGGPIRFE |
Ga0207693_100788071 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MRVVVVMLLLSAGIAAEARSYSFVSKASGRLGGPIRF |
Ga0207693_104503341 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MLMRVVAVMLLLSAGIAAEAVSYSFVCKASGRLGGPIRFEFYRDSTTRPKTDI |
Ga0207663_106292563 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MRVVAVILLLSAGIAAEAMSYSFVSKASGRLGGPIRF |
Ga0207649_112756301 | 3300025920 | Corn Rhizosphere | MRIVVAMLLLCASIAAEAMSYSFVCKASGRLGRPIRFEFYGDSSTIPKTD |
Ga0207650_106430661 | 3300025925 | Switchgrass Rhizosphere | MRVVAVMLLLSAGIVGGAMSYSFVSKVSGQLGGPIRFAFYRDSTPKTD |
Ga0207659_101606871 | 3300025926 | Miscanthus Rhizosphere | MRVVAITLLLVAVIAAEAMSYSFVCKASGRLGKPIRFEF |
Ga0207659_115923482 | 3300025926 | Miscanthus Rhizosphere | MRVVVVMLLLFAGTATEAMSDSFVIKASGRLGAPIRFEFFRASTARP |
Ga0207700_105041401 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MRVVAVMLLLSAGIAAEAVSYSFVSKASGRLGGPIRFEFYRDSTTRPKT |
Ga0207701_114177501 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MLMRVVAVMLLLCAGIAAEAMSYSFVSKASGRLGGPIRFQFYR |
Ga0207665_102006534 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MLMRFVAVMLLLSAGIAAEAMSYSFVSKASGRLGGPI |
Ga0207691_111076801 | 3300025940 | Miscanthus Rhizosphere | MRVVTVMLLLSAGIAAEAMSHSFVCKASGRLGGPIRFQFYRDSTTHPKTDIE |
Ga0207679_121848581 | 3300025945 | Corn Rhizosphere | MRVVVAMLLLSAGIAAEAMSYSFVCKASGRLGGPIRFEFYAEST |
Ga0207651_112710261 | 3300025960 | Switchgrass Rhizosphere | MLMRVVAVMLLLSAGIAGEAMSYSFVSKASGRLGGPIRFEFYRDSGR |
Ga0207678_117658752 | 3300026067 | Corn Rhizosphere | MRVVIVMLLLSAGIAAEAMSYSFVCKASGRLGRPIRFEFYGESTTRLKTDIKSF |
Ga0207708_101923053 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MRVLAAMLLLSAVIAAEAMSYSFVCKAKGRLGGPIHFEF |
Ga0207641_100691981 | 3300026088 | Switchgrass Rhizosphere | MRVLAAMLLLSAVIAAEAMSYSFVCKAKGRLGGPIRFEFYGDSTTS |
Ga0209155_10736461 | 3300026316 | Soil | MLMRVVAVMLLLSAGIAAEAVSYSFVCKASGRLGGPIRFEFYGDSTTRP |
Ga0209267_12888051 | 3300026331 | Soil | MRVVAVMLLLSAGIAAEAMSYSFVSKARGRLGGPIRFEFYGESTTRP |
Ga0257146_10389412 | 3300026374 | Soil | MRIVAVMLLLSAGIVAEAMSYSFVCKASGRLGGPIRFEFYRDS |
Ga0257156_10388171 | 3300026498 | Soil | MLMRVVAVMLLLSAGITAEAMSYSFVSKASGRLGGPIR |
Ga0209808_10470924 | 3300026523 | Soil | MLMRVVAVMLLLSAGIAAEAMSYSFVCKASGRLGGPI |
Ga0209378_10718021 | 3300026528 | Soil | MRVVAVMLLLSAGVAAEAMSYSFVSKARGRLGGPIRFEFYCDSTTR |
Ga0209056_1000353519 | 3300026538 | Soil | MRVVAVTLLLSAGLAAEAVSYSFVSKASGRLGGPIRFEFYGDSNTRP |
Ga0209474_106273932 | 3300026550 | Soil | MLMRVVVVMLLLSAGIAAEAMSYSFVTKASGRLGGPIRFEFYR |
Ga0207624_1035311 | 3300027453 | Soil | MRVVTVMLLLSAGIAAEAMSHSFVCKASGRLGGPIRFQFYRDSTTHPKTDIES |
Ga0209689_13959701 | 3300027748 | Soil | MLMRFVAVMLLLSAGIAAEAGSYSFLSKASGRLGGPIRFEFYGDST |
Ga0209811_102703972 | 3300027821 | Surface Soil | MRVVAVMLLLSAGIAAEAVSYSFVCKASGRLGGPIRFEFYR |
Ga0209380_107737601 | 3300027889 | Soil | MLKRVVAVMLLLSAGIAAEAMSYSFVSKASGRLGGPIRFEFYRES |
Ga0307315_102184181 | 3300028721 | Soil | MRVVAVMLLLSAGIAAEAMSYSFVSKASGRLGGPIRFEFYR |
Ga0307302_102365051 | 3300028814 | Soil | MLMRVVAVMLLLSAGIAAEAMSYSFVSKASGRLGGPIRF |
Ga0307310_105242561 | 3300028824 | Soil | MRVVAVMLLLSAGIAAEAVSYSFVSKASGRLGGPIRFEFYRDSTTHPKTDIES |
Ga0307278_101697641 | 3300028878 | Soil | MRVVAVMLLLSAGIAAEAMSYSFVSKASGRLGGPIRFE |
Ga0307277_103779212 | 3300028881 | Soil | MRVFAVILLLSAGIAAEAMSYSFVSKASGRLGGPIRFEF |
Ga0075396_18757351 | 3300030776 | Soil | MLMRVIAVMLLLSAGIAAEAVSYSFVSKASGRLGGPIRFEFY |
Ga0075386_121733592 | 3300030916 | Soil | MRVVAFMLLLSAGIAAEAMSYSFVCKASGRLGGPIRFEFYRDSTTRPKTD |
Ga0170824_1088602611 | 3300031231 | Forest Soil | MRVVAVMLLLSAGVAAEAVSYSFVSKASGRLGGPIRFEFY |
Ga0170824_1268231904 | 3300031231 | Forest Soil | MRVVAFMLLLSAGIAAEAMSYSFVCKASGRLGGPIRFEFYRDSTTRPKT |
Ga0170820_104011631 | 3300031446 | Forest Soil | MRVVAVMLLLSAGIAVEAMSYSFVSKASGRLGGPIRFEFYRDS |
Ga0170820_137558971 | 3300031446 | Forest Soil | MLMRVVAIMLLLFAGIAAEAVSYSFVSKASGRLGGPIRFE |
Ga0170819_164236811 | 3300031469 | Forest Soil | MLMRVVAIMLLLSAGIAAEAVSYSFVSKASGRLGGPIRFEFYRDSTTR |
Ga0307473_115457901 | 3300031820 | Hardwood Forest Soil | MLMRVVAVMLLLSAGIATEAMSYSFVCKASGQLGGPIRFVFYHESTT |
Ga0308175_1026690872 | 3300031938 | Soil | MRVIAFMLLMCAGIAAAAMSYSFVCKASGRLGGPIRFAFYGDATTVAKTDIKSF |
Ga0306926_126492472 | 3300031954 | Soil | MRVVAVMLLLSASIAAETMSYSFVCKASGRLGGPIRFEFYGDST |
Ga0307479_110183922 | 3300031962 | Hardwood Forest Soil | MRVVAVMLLLSAGIAAEAMSYSFVSKASGRLGGPIRFEFYRDSTTRPKADI |
Ga0310911_101076603 | 3300032035 | Soil | MRIIAVMLLLSTGITAEAMSYSFVCKASGRLGGPIRFEFYGDST |
Ga0307471_1006548731 | 3300032180 | Hardwood Forest Soil | MLLLFAGIAAEAMSYSFVSKASGRLGGPIRFEFYRDSTTRPKTDI |
Ga0307472_1000532951 | 3300032205 | Hardwood Forest Soil | MLMRVVAVMLLLSAGIAVEAMSYSFVCKASGRLGGAIRFEFYRDSSTSPKT |
Ga0307472_1018625521 | 3300032205 | Hardwood Forest Soil | MRVVAVMLLLSAGIAAEAMSYSFVSKASGRLGGPIRFEFYRDSTTRP |
Ga0310812_102326331 | 3300032421 | Soil | MRVVAVMLLLSAGIAAEAVSYSFVSKASGRLGGPIRFE |
⦗Top⦘ |