Basic Information | |
---|---|
Family ID | F016736 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 245 |
Average Sequence Length | 41 residues |
Representative Sequence | VLTLFPKGVYLIDQLGPTYKQLQTGVREKEKEETKGESVTKS |
Number of Associated Samples | 191 |
Number of Associated Scaffolds | 245 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.82 % |
% of genes near scaffold ends (potentially truncated) | 83.67 % |
% of genes from short scaffolds (< 2000 bps) | 62.04 % |
Associated GOLD sequencing projects | 174 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.27 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (85.714 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine (17.143 % of family members) |
Environment Ontology (ENVO) | Unclassified (74.286 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (88.980 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 40.00% β-sheet: 8.57% Coil/Unstructured: 51.43% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.27 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 245 Family Scaffolds |
---|---|---|
PF01734 | Patatin | 14.29 |
PF00857 | Isochorismatase | 11.43 |
PF01081 | Aldolase | 8.16 |
PF02538 | Hydantoinase_B | 6.53 |
PF00224 | PK | 6.53 |
PF02837 | Glyco_hydro_2_N | 5.71 |
PF02836 | Glyco_hydro_2_C | 4.90 |
PF01546 | Peptidase_M20 | 4.08 |
PF01274 | Malate_synthase | 4.08 |
PF00682 | HMGL-like | 3.27 |
PF00920 | ILVD_EDD | 3.27 |
PF02515 | CoA_transf_3 | 2.86 |
PF07045 | DUF1330 | 2.45 |
PF07687 | M20_dimer | 2.45 |
PF01914 | MarC | 2.45 |
PF00474 | SSF | 1.63 |
PF07715 | Plug | 1.22 |
PF01182 | Glucosamine_iso | 1.22 |
PF05378 | Hydant_A_N | 0.82 |
PF13377 | Peripla_BP_3 | 0.82 |
PF02887 | PK_C | 0.82 |
PF01019 | G_glu_transpept | 0.41 |
PF01722 | BolA | 0.41 |
PF07969 | Amidohydro_3 | 0.41 |
PF00498 | FHA | 0.41 |
PF00593 | TonB_dep_Rec | 0.41 |
PF02230 | Abhydrolase_2 | 0.41 |
PF05154 | TM2 | 0.41 |
PF01968 | Hydantoinase_A | 0.41 |
PF05751 | FixH | 0.41 |
COG ID | Name | Functional Category | % Frequency in 245 Family Scaffolds |
---|---|---|---|
COG1752 | Predicted acylesterase/phospholipase RssA, containd patatin domain | General function prediction only [R] | 14.29 |
COG3621 | Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR | General function prediction only [R] | 14.29 |
COG4667 | Predicted phospholipase, patatin/cPLA2 family | Lipid transport and metabolism [I] | 14.29 |
COG0146 | N-methylhydantoinase B/oxoprolinase/acetone carboxylase, alpha subunit | Amino acid transport and metabolism [E] | 13.06 |
COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 11.43 |
COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 11.43 |
COG3250 | Beta-galactosidase/beta-glucuronidase | Carbohydrate transport and metabolism [G] | 10.61 |
COG0800 | 2-keto-3-deoxy-6-phosphogluconate aldolase | Carbohydrate transport and metabolism [G] | 8.16 |
COG0469 | Pyruvate kinase | Carbohydrate transport and metabolism [G] | 7.35 |
COG0129 | Dihydroxyacid dehydratase/phosphogluconate dehydratase | Carbohydrate transport and metabolism [G] | 6.53 |
COG2225 | Malate synthase | Energy production and conversion [C] | 4.08 |
COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 2.86 |
COG2095 | Small neutral amino acid transporter SnatA, MarC family | Amino acid transport and metabolism [E] | 2.45 |
COG5470 | Uncharacterized conserved protein, DUF1330 family | Function unknown [S] | 2.45 |
COG0145 | N-methylhydantoinase A/oxoprolinase/acetone carboxylase, beta subunit | Amino acid transport and metabolism [E] | 1.63 |
COG0363 | 6-phosphogluconolactonase/Glucosamine-6-phosphate isomerase/deaminase | Carbohydrate transport and metabolism [G] | 1.22 |
COG2314 | Uncharacterized membrane protein YozV, TM2 domain, contains pTyr | General function prediction only [R] | 0.41 |
COG5456 | Nitrogen fixation protein FixH | Inorganic ion transport and metabolism [P] | 0.41 |
COG0405 | Gamma-glutamyltranspeptidase | Amino acid transport and metabolism [E] | 0.41 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 85.71 % |
Unclassified | root | N/A | 14.29 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000101|DelMOSum2010_c10079577 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster | 1460 | Open in IMG/M |
3300000115|DelMOSum2011_c10005252 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 7579 | Open in IMG/M |
3300000117|DelMOWin2010_c10026328 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales | 2917 | Open in IMG/M |
3300000137|LP_F_10_SI03_10DRAFT_c1017795 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1250 | Open in IMG/M |
3300000148|SI47jul10_100mDRAFT_c1001552 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5940 | Open in IMG/M |
3300000148|SI47jul10_100mDRAFT_c1004546 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales | 3220 | Open in IMG/M |
3300000148|SI47jul10_100mDRAFT_c1006400 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2595 | Open in IMG/M |
3300000192|SI60aug11_100mDRAFT_c1000145 | All Organisms → cellular organisms → Bacteria | 22437 | Open in IMG/M |
3300000192|SI60aug11_100mDRAFT_c1007913 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2727 | Open in IMG/M |
3300000192|SI60aug11_100mDRAFT_c1011921 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2073 | Open in IMG/M |
3300000223|LPjun09P410mDRAFT_1014571 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster | 669 | Open in IMG/M |
3300000239|SI36aug09_120mDRAFT_1034506 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1081 | Open in IMG/M |
3300000239|SI36aug09_120mDRAFT_1087468 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
3300000251|LPjun08P16500mDRAFT_1033253 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
3300000254|SI34jun09_100mDRAFT_1039876 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 839 | Open in IMG/M |
3300000257|LP_F_10_SI03_100DRAFT_1007421 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2462 | Open in IMG/M |
3300000265|LP_A_09_P04_10DRAFT_1004235 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales | 3757 | Open in IMG/M |
3300000265|LP_A_09_P04_10DRAFT_1023542 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1102 | Open in IMG/M |
3300000324|SI48aug10_100mDRAFT_1012296 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2045 | Open in IMG/M |
3300000929|NpDRAFT_10043468 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3818 | Open in IMG/M |
3300001346|JGI20151J14362_10024352 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales | 3098 | Open in IMG/M |
3300001347|JGI20156J14371_10009893 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales | 6012 | Open in IMG/M |
3300001347|JGI20156J14371_10025309 | All Organisms → cellular organisms → Bacteria | 3062 | Open in IMG/M |
3300001347|JGI20156J14371_10135022 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 715 | Open in IMG/M |
3300001348|JGI20154J14316_10046901 | All Organisms → cellular organisms → Bacteria | 1888 | Open in IMG/M |
3300001349|JGI20160J14292_10018041 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 4122 | Open in IMG/M |
3300001349|JGI20160J14292_10036816 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2409 | Open in IMG/M |
3300001351|JGI20153J14318_10039463 | All Organisms → cellular organisms → Bacteria | 1888 | Open in IMG/M |
3300001352|JGI20157J14317_10000300 | All Organisms → cellular organisms → Bacteria | 56341 | Open in IMG/M |
3300001352|JGI20157J14317_10029700 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2892 | Open in IMG/M |
3300001353|JGI20159J14440_10010903 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 4866 | Open in IMG/M |
3300001354|JGI20155J14468_10163333 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
3300001936|GOS2220_1017810 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1367 | Open in IMG/M |
3300001936|GOS2220_1019452 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1528 | Open in IMG/M |
3300001952|GOS2224_1004171 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1589 | Open in IMG/M |
3300001952|GOS2224_1049745 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2676 | Open in IMG/M |
3300002176|JGI24820J26691_1036105 | Not Available | 1043 | Open in IMG/M |
3300002230|M1t2FKB2103N_1789812 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster | 1823 | Open in IMG/M |
3300002913|JGI26060J43896_10119056 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster | 678 | Open in IMG/M |
3300002955|JGI26062J44793_1006419 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1513 | Open in IMG/M |
3300003269|JGI26112J46591_1022010 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster | 805 | Open in IMG/M |
3300003271|JGI26114J46594_1011827 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1539 | Open in IMG/M |
3300003346|JGI26081J50195_1011909 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2174 | Open in IMG/M |
3300003428|JGI26111J50215_1004817 | Not Available | 2150 | Open in IMG/M |
3300003474|NAP4_1077498 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 677 | Open in IMG/M |
3300003476|NAP2_1095696 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86E | 648 | Open in IMG/M |
3300003477|nap3_10004340 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2825 | Open in IMG/M |
3300003478|JGI26238J51125_1006209 | All Organisms → cellular organisms → Bacteria | 3555 | Open in IMG/M |
3300003500|JGI26242J51144_1025837 | All Organisms → cellular organisms → Bacteria | 1060 | Open in IMG/M |
3300003540|FS896DNA_10625358 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1449 | Open in IMG/M |
3300003583|JGI26253J51717_1000073 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 35966 | Open in IMG/M |
3300003584|JGI26254J51713_1000734 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 12698 | Open in IMG/M |
3300003586|JGI26261J51718_1001391 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 10455 | Open in IMG/M |
3300003586|JGI26261J51718_1009613 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales | 2978 | Open in IMG/M |
3300003596|JGI26255J51710_1000663 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales | 13100 | Open in IMG/M |
3300003619|JGI26380J51729_10075001 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
3300003620|JGI26273J51734_10028316 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2021 | Open in IMG/M |
3300003620|JGI26273J51734_10081018 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster | 937 | Open in IMG/M |
3300004280|Ga0066606_10016167 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3392 | Open in IMG/M |
3300004369|Ga0065726_18341 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales | 10532 | Open in IMG/M |
3300005239|Ga0073579_1095410 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 21205 | Open in IMG/M |
3300005402|Ga0066855_10134001 | Not Available | 790 | Open in IMG/M |
3300005404|Ga0066856_10047111 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1883 | Open in IMG/M |
3300005404|Ga0066856_10088507 | Not Available | 1352 | Open in IMG/M |
3300005404|Ga0066856_10483212 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
3300005522|Ga0066861_10001134 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales | 9190 | Open in IMG/M |
3300005523|Ga0066865_10364033 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 549 | Open in IMG/M |
3300005606|Ga0066835_10039318 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1378 | Open in IMG/M |
3300005837|Ga0078893_10648160 | All Organisms → cellular organisms → Bacteria | 1946 | Open in IMG/M |
3300005941|Ga0070743_10022403 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2196 | Open in IMG/M |
3300006027|Ga0075462_10010928 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2932 | Open in IMG/M |
3300006027|Ga0075462_10018276 | Not Available | 2259 | Open in IMG/M |
3300006164|Ga0075441_10137873 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 923 | Open in IMG/M |
3300006165|Ga0075443_10017614 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2408 | Open in IMG/M |
3300006166|Ga0066836_10338983 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 902 | Open in IMG/M |
3300006190|Ga0075446_10028637 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1816 | Open in IMG/M |
3300006190|Ga0075446_10183005 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 589 | Open in IMG/M |
3300006191|Ga0075447_10076210 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1190 | Open in IMG/M |
3300006191|Ga0075447_10223821 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
3300006193|Ga0075445_10014316 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3473 | Open in IMG/M |
3300006352|Ga0075448_10049001 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1351 | Open in IMG/M |
3300006869|Ga0075477_10015637 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3549 | Open in IMG/M |
3300006870|Ga0075479_10046772 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1852 | Open in IMG/M |
3300006902|Ga0066372_10018293 | Not Available | 3186 | Open in IMG/M |
3300006947|Ga0075444_10051712 | All Organisms → cellular organisms → Bacteria | 1941 | Open in IMG/M |
3300006947|Ga0075444_10167795 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 908 | Open in IMG/M |
3300007234|Ga0075460_10279734 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
3300007236|Ga0075463_10004495 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4696 | Open in IMG/M |
3300007514|Ga0105020_1003764 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 18031 | Open in IMG/M |
3300007681|Ga0102824_1029657 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1460 | Open in IMG/M |
3300007681|Ga0102824_1078812 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster | 865 | Open in IMG/M |
3300007777|Ga0105711_1153359 | Not Available | 674 | Open in IMG/M |
3300007956|Ga0105741_1186870 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86E | 510 | Open in IMG/M |
3300008012|Ga0075480_10487461 | Not Available | 595 | Open in IMG/M |
3300008253|Ga0105349_10198100 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster | 838 | Open in IMG/M |
3300008253|Ga0105349_10367377 | Not Available | 599 | Open in IMG/M |
3300008253|Ga0105349_10406353 | Not Available | 568 | Open in IMG/M |
3300008961|Ga0102887_1040958 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1556 | Open in IMG/M |
3300009000|Ga0102960_1119414 | Not Available | 955 | Open in IMG/M |
3300009001|Ga0102963_1004905 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales | 5858 | Open in IMG/M |
3300009052|Ga0102886_1016527 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2528 | Open in IMG/M |
3300009054|Ga0102826_1062569 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster | 899 | Open in IMG/M |
3300009071|Ga0115566_10052576 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2759 | Open in IMG/M |
3300009077|Ga0115552_1109986 | All Organisms → cellular organisms → Bacteria | 1184 | Open in IMG/M |
3300009080|Ga0102815_10038372 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2638 | Open in IMG/M |
3300009080|Ga0102815_10141158 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1322 | Open in IMG/M |
3300009172|Ga0114995_10042989 | All Organisms → cellular organisms → Bacteria | 2603 | Open in IMG/M |
3300009409|Ga0114993_10378250 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales | 1067 | Open in IMG/M |
3300009425|Ga0114997_10153930 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1356 | Open in IMG/M |
3300009434|Ga0115562_1097520 | Not Available | 1171 | Open in IMG/M |
3300009437|Ga0115556_1073262 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1350 | Open in IMG/M |
3300009437|Ga0115556_1205881 | Not Available | 708 | Open in IMG/M |
3300009438|Ga0115559_1034962 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster | 2290 | Open in IMG/M |
3300009472|Ga0115554_1045508 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2015 | Open in IMG/M |
3300009497|Ga0115569_10017618 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 4473 | Open in IMG/M |
3300009508|Ga0115567_10135238 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales | 1656 | Open in IMG/M |
3300009703|Ga0114933_10708044 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 645 | Open in IMG/M |
3300009703|Ga0114933_10761063 | Not Available | 619 | Open in IMG/M |
3300012928|Ga0163110_10815941 | Not Available | 734 | Open in IMG/M |
3300012954|Ga0163111_12116983 | Not Available | 568 | Open in IMG/M |
3300017782|Ga0181380_1063595 | All Organisms → cellular organisms → Bacteria | 1306 | Open in IMG/M |
3300018415|Ga0181559_10198100 | All Organisms → cellular organisms → Bacteria | 1154 | Open in IMG/M |
3300019459|Ga0181562_10016185 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 4935 | Open in IMG/M |
3300020051|Ga0181555_1005817 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 9059 | Open in IMG/M |
3300020053|Ga0181595_10019085 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 4607 | Open in IMG/M |
3300020175|Ga0206124_10216446 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
3300020175|Ga0206124_10291110 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster | 624 | Open in IMG/M |
3300020177|Ga0181596_10067586 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1971 | Open in IMG/M |
3300020178|Ga0181599_1026540 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3247 | Open in IMG/M |
3300020178|Ga0181599_1039210 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2470 | Open in IMG/M |
3300020182|Ga0206129_10125152 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales | 1276 | Open in IMG/M |
3300020188|Ga0181605_10031340 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3215 | Open in IMG/M |
3300020281|Ga0211483_10313801 | Not Available | 519 | Open in IMG/M |
3300020294|Ga0211520_1020468 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1067 | Open in IMG/M |
3300020309|Ga0211681_1000763 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Halieaceae | 10518 | Open in IMG/M |
3300020339|Ga0211605_1026492 | All Organisms → cellular organisms → Bacteria | 1249 | Open in IMG/M |
3300020374|Ga0211477_10059027 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1492 | Open in IMG/M |
3300020379|Ga0211652_10034394 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86E | 1520 | Open in IMG/M |
3300020385|Ga0211677_10414947 | Not Available | 520 | Open in IMG/M |
3300020388|Ga0211678_10038353 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2320 | Open in IMG/M |
3300020388|Ga0211678_10389534 | Not Available | 555 | Open in IMG/M |
3300020415|Ga0211553_10247108 | Not Available | 723 | Open in IMG/M |
3300020431|Ga0211554_10005081 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales | 8744 | Open in IMG/M |
3300020431|Ga0211554_10018288 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 4236 | Open in IMG/M |
3300020438|Ga0211576_10150461 | All Organisms → cellular organisms → Bacteria | 1260 | Open in IMG/M |
3300020438|Ga0211576_10185334 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster | 1114 | Open in IMG/M |
3300020441|Ga0211695_10180146 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 739 | Open in IMG/M |
3300020451|Ga0211473_10279603 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86E | 858 | Open in IMG/M |
3300020454|Ga0211548_10040746 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2166 | Open in IMG/M |
3300020463|Ga0211676_10052050 | All Organisms → cellular organisms → Bacteria | 2897 | Open in IMG/M |
3300020466|Ga0211714_10393286 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 658 | Open in IMG/M |
3300020468|Ga0211475_10022357 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3666 | Open in IMG/M |
3300020469|Ga0211577_10278302 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1068 | Open in IMG/M |
3300020469|Ga0211577_10279288 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1066 | Open in IMG/M |
3300020470|Ga0211543_10087469 | Not Available | 1601 | Open in IMG/M |
3300020472|Ga0211579_10120275 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1562 | Open in IMG/M |
3300021089|Ga0206679_10210782 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86B | 1082 | Open in IMG/M |
3300021169|Ga0206687_1155860 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 639 | Open in IMG/M |
3300021185|Ga0206682_10067750 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales | 1870 | Open in IMG/M |
3300021185|Ga0206682_10189142 | All Organisms → cellular organisms → Bacteria | 945 | Open in IMG/M |
3300021347|Ga0213862_10077808 | All Organisms → cellular organisms → Bacteria | 1171 | Open in IMG/M |
3300021365|Ga0206123_10081422 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales | 1584 | Open in IMG/M |
3300021375|Ga0213869_10010389 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 5590 | Open in IMG/M |
3300021375|Ga0213869_10146001 | All Organisms → cellular organisms → Bacteria | 1108 | Open in IMG/M |
3300021378|Ga0213861_10005144 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales | 10548 | Open in IMG/M |
3300021378|Ga0213861_10019051 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 4859 | Open in IMG/M |
3300021389|Ga0213868_10013151 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales | 6792 | Open in IMG/M |
3300021389|Ga0213868_10067949 | All Organisms → cellular organisms → Bacteria | 2395 | Open in IMG/M |
3300021389|Ga0213868_10248554 | Not Available | 1040 | Open in IMG/M |
3300021957|Ga0222717_10342815 | Not Available | 841 | Open in IMG/M |
3300021959|Ga0222716_10697378 | Not Available | 539 | Open in IMG/M |
3300021960|Ga0222715_10239949 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1061 | Open in IMG/M |
3300022905|Ga0255756_1015999 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5615 | Open in IMG/M |
3300022907|Ga0255775_1005031 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86B | 10190 | Open in IMG/M |
(restricted) 3300022920|Ga0233426_10036318 | All Organisms → cellular organisms → Bacteria | 2471 | Open in IMG/M |
3300022921|Ga0255765_1027252 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3785 | Open in IMG/M |
3300022928|Ga0255758_10036671 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3019 | Open in IMG/M |
3300024250|Ga0228677_1108185 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster | 547 | Open in IMG/M |
3300024346|Ga0244775_10040613 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 4098 | Open in IMG/M |
3300024346|Ga0244775_10100996 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2453 | Open in IMG/M |
3300024348|Ga0244776_10067605 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2737 | Open in IMG/M |
3300025431|Ga0209449_1074918 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 561 | Open in IMG/M |
3300025614|Ga0209665_1139630 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 619 | Open in IMG/M |
3300025621|Ga0209504_1045299 | All Organisms → cellular organisms → Bacteria | 1386 | Open in IMG/M |
3300025621|Ga0209504_1052993 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales | 1230 | Open in IMG/M |
3300025622|Ga0209264_1025649 | Not Available | 1761 | Open in IMG/M |
3300025637|Ga0209197_1178149 | All Organisms → cellular organisms → Bacteria → FCB group | 550 | Open in IMG/M |
3300025672|Ga0209663_1004372 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6251 | Open in IMG/M |
3300025676|Ga0209657_1042702 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales | 1679 | Open in IMG/M |
3300025688|Ga0209140_1033378 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1877 | Open in IMG/M |
3300025704|Ga0209602_1086871 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales | 1143 | Open in IMG/M |
3300025770|Ga0209362_1081624 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales | 1254 | Open in IMG/M |
3300025822|Ga0209714_1106317 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 771 | Open in IMG/M |
3300025860|Ga0209119_1032532 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2831 | Open in IMG/M |
3300025860|Ga0209119_1063978 | All Organisms → cellular organisms → Bacteria | 1767 | Open in IMG/M |
3300025870|Ga0209666_1236210 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
3300025876|Ga0209223_10111928 | Not Available | 1471 | Open in IMG/M |
3300025886|Ga0209632_10218941 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales | 994 | Open in IMG/M |
3300025892|Ga0209630_10230740 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 881 | Open in IMG/M |
3300026257|Ga0208407_1000374 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 21136 | Open in IMG/M |
3300026260|Ga0208408_1040725 | Not Available | 1590 | Open in IMG/M |
3300027170|Ga0208963_1038444 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 759 | Open in IMG/M |
3300027206|Ga0208023_1081824 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 509 | Open in IMG/M |
3300027255|Ga0208681_1013739 | Not Available | 1607 | Open in IMG/M |
3300027406|Ga0208965_1028133 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster | 1391 | Open in IMG/M |
3300027413|Ga0208950_1017388 | All Organisms → cellular organisms → Bacteria | 2169 | Open in IMG/M |
3300027501|Ga0208948_1000824 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 13768 | Open in IMG/M |
3300027501|Ga0208948_1053385 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 826 | Open in IMG/M |
3300027506|Ga0208973_1029747 | All Organisms → cellular organisms → Bacteria | 1562 | Open in IMG/M |
3300027553|Ga0208947_1015779 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales | 2174 | Open in IMG/M |
3300027571|Ga0208897_1152100 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 572 | Open in IMG/M |
3300027686|Ga0209071_1084587 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster | 937 | Open in IMG/M |
3300027704|Ga0209816_1043976 | Not Available | 2075 | Open in IMG/M |
3300027757|Ga0208671_10043217 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1682 | Open in IMG/M |
3300027757|Ga0208671_10065177 | All Organisms → cellular organisms → Bacteria | 1346 | Open in IMG/M |
3300027771|Ga0209279_10044072 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1276 | Open in IMG/M |
3300027801|Ga0209091_10007973 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86B | 7713 | Open in IMG/M |
3300027859|Ga0209503_10254289 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 851 | Open in IMG/M |
3300028196|Ga0257114_1147983 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster | 907 | Open in IMG/M |
3300028197|Ga0257110_1234778 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster | 691 | Open in IMG/M |
3300028279|Ga0228613_1142778 | Not Available | 558 | Open in IMG/M |
3300028287|Ga0257126_1008170 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Halieaceae | 5790 | Open in IMG/M |
3300028287|Ga0257126_1146946 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 785 | Open in IMG/M |
3300028287|Ga0257126_1155131 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
3300031597|Ga0302116_1171013 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
3300031638|Ga0302125_10047567 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1469 | Open in IMG/M |
3300031638|Ga0302125_10253928 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 533 | Open in IMG/M |
3300031701|Ga0302120_10009740 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4262 | Open in IMG/M |
3300031705|Ga0308003_1162282 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86B | 683 | Open in IMG/M |
3300031773|Ga0315332_10418660 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 853 | Open in IMG/M |
3300031773|Ga0315332_10599511 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
3300031775|Ga0315326_10123848 | Not Available | 1690 | Open in IMG/M |
3300031775|Ga0315326_10588197 | Not Available | 709 | Open in IMG/M |
3300032011|Ga0315316_10398591 | All Organisms → cellular organisms → Bacteria | 1155 | Open in IMG/M |
3300032047|Ga0315330_10007569 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 7371 | Open in IMG/M |
3300032047|Ga0315330_10027272 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3843 | Open in IMG/M |
3300032047|Ga0315330_10112582 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales | 1796 | Open in IMG/M |
3300032073|Ga0315315_10145610 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2209 | Open in IMG/M |
3300032073|Ga0315315_10207768 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales | 1827 | Open in IMG/M |
3300032073|Ga0315315_10549208 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86E | 1068 | Open in IMG/M |
3300032088|Ga0315321_10068514 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2450 | Open in IMG/M |
3300032088|Ga0315321_10241821 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae | 1170 | Open in IMG/M |
3300032360|Ga0315334_10537169 | Not Available | 1004 | Open in IMG/M |
3300032360|Ga0315334_11335016 | Not Available | 617 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 17.14% |
Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 16.33% |
Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 9.80% |
Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 7.35% |
Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 6.94% |
Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 5.71% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 4.90% |
Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 4.90% |
Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 4.08% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 2.86% |
Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 2.04% |
Marine | Environmental → Aquatic → Marine → Inlet → Unclassified → Marine | 1.63% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 1.63% |
Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 1.63% |
Methane Seep Mesocosm | Environmental → Aquatic → Marine → Unclassified → Unclassified → Methane Seep Mesocosm | 1.22% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.22% |
Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 1.22% |
Estuarine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Estuarine | 1.22% |
Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.82% |
Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 0.82% |
Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 0.82% |
Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 0.82% |
Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.41% |
Marine | Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine | 0.41% |
Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 0.41% |
Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.41% |
Marine Surface Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water | 0.41% |
Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.41% |
Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.41% |
Freshwater And Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine | 0.41% |
Diffuse Hydrothermal Flow Volcanic Vent | Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Hydrothermal Flow Volcanic Vent | 0.41% |
Diffuse Vent Fluid, Hydrothermal Vents | Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Vent Fluid, Hydrothermal Vents | 0.41% |
Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 0.41% |
Saline | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline | 0.41% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
3300000137 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - sample F_10_SI03_10 | Environmental | Open in IMG/M |
3300000148 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 47 07/07/10 100m | Environmental | Open in IMG/M |
3300000192 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 60 08/10/11 100m | Environmental | Open in IMG/M |
3300000223 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - June 2009 P4 10m | Environmental | Open in IMG/M |
3300000239 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 36 08/11/09 120m | Environmental | Open in IMG/M |
3300000251 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - June 2008 P16 500m | Environmental | Open in IMG/M |
3300000254 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 34 06/16/09 100m | Environmental | Open in IMG/M |
3300000257 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - sample_F_10_SI03_100 | Environmental | Open in IMG/M |
3300000265 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - sample_A_09_P04_10 | Environmental | Open in IMG/M |
3300000324 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 48 08/11/10 100m | Environmental | Open in IMG/M |
3300000929 | Marine plume microbial communities from the Columbia River - 15 PSU | Environmental | Open in IMG/M |
3300001346 | Pelagic Microbial community sample from North Sea - COGITO 998_met_01 | Environmental | Open in IMG/M |
3300001347 | Pelagic Microbial community sample from North Sea - COGITO 998_met_06 | Environmental | Open in IMG/M |
3300001348 | Pelagic Microbial community sample from North Sea - COGITO 998_met_04 | Environmental | Open in IMG/M |
3300001349 | Pelagic Microbial community sample from North Sea - COGITO 998_met_10 | Environmental | Open in IMG/M |
3300001351 | Pelagic Microbial community sample from North Sea - COGITO 998_met_03 | Environmental | Open in IMG/M |
3300001352 | Pelagic Microbial community sample from North Sea - COGITO 998_met_07 | Environmental | Open in IMG/M |
3300001353 | Pelagic Microbial community sample from North Sea - COGITO 998_met_09 | Environmental | Open in IMG/M |
3300001354 | Pelagic Microbial community sample from North Sea - COGITO 998_met_05 | Environmental | Open in IMG/M |
3300001936 | Marine microbial communities from Halifax, Nova Scotia, Canada - GS004 | Environmental | Open in IMG/M |
3300001952 | Marine microbial communities from Newport Harbor, Rhode Island, USA - GS008 | Environmental | Open in IMG/M |
3300002176 | Marine microbial communities from oxygen minimum zone in mesopelagic equatorial Pacific - METZYME_5_50m | Environmental | Open in IMG/M |
3300002230 | Marine microbial communities from the Baltic Sea - M1t2 FKB2 (103N) | Environmental | Open in IMG/M |
3300002913 | Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - AAIW_A/KNORR_S2/LV | Environmental | Open in IMG/M |
3300002955 | Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - DCM_A/KNORR_S2/LV | Environmental | Open in IMG/M |
3300003269 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_08_M0_20 | Environmental | Open in IMG/M |
3300003271 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_18_M0_10 | Environmental | Open in IMG/M |
3300003346 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_74LU_5_DNA | Environmental | Open in IMG/M |
3300003428 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_04_M0_20 | Environmental | Open in IMG/M |
3300003474 | Estuarine microbial communities from the Sarno estuary, Gulf of Naples, Italy - Sample Station 4 | Environmental | Open in IMG/M |
3300003476 | Estuarine microbial communities from the Sarno estuary, Gulf of Naples, Italy - Sample Station 2 | Environmental | Open in IMG/M |
3300003477 | Estuarine microbial communities from the Sarno estuary, Gulf of Naples, Italy - Sample Station 3 | Environmental | Open in IMG/M |
3300003478 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_100m_DNA | Environmental | Open in IMG/M |
3300003500 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S4LV_100m_DNA | Environmental | Open in IMG/M |
3300003540 | Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS896_ElGuapo_DNA | Environmental | Open in IMG/M |
3300003583 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI073_LV_100m_DNA | Environmental | Open in IMG/M |
3300003584 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI073_LV_120m_DNA | Environmental | Open in IMG/M |
3300003586 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI074_LV_135m_DNA | Environmental | Open in IMG/M |
3300003596 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - Saanich Inlet SI073_LV_135m_DNA | Environmental | Open in IMG/M |
3300003619 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI072_LV_165m_DNA | Environmental | Open in IMG/M |
3300003620 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_125m_DNA | Environmental | Open in IMG/M |
3300004280 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_100m | Environmental | Open in IMG/M |
3300004369 | Saline microbial communities from the South Caspian sea - cas-15 | Environmental | Open in IMG/M |
3300005239 | Environmental Genome Shotgun Sequencing: Ocean Microbial Populations from the Gulf of Maine | Environmental | Open in IMG/M |
3300005402 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV73 | Environmental | Open in IMG/M |
3300005404 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV205 | Environmental | Open in IMG/M |
3300005522 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F10-02SV257 | Environmental | Open in IMG/M |
3300005523 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV265 | Environmental | Open in IMG/M |
3300005606 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV84 | Environmental | Open in IMG/M |
3300005837 | Exploring phylogenetic diversity in Port Hacking ocean in Sydney, Australia - Port Hacking PH4 TJ4-TJ18 | Environmental | Open in IMG/M |
3300005941 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 | Environmental | Open in IMG/M |
3300006027 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA | Environmental | Open in IMG/M |
3300006164 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA | Environmental | Open in IMG/M |
3300006165 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNA | Environmental | Open in IMG/M |
3300006166 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV91 | Environmental | Open in IMG/M |
3300006190 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG058-DNA | Environmental | Open in IMG/M |
3300006191 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG104-DNA | Environmental | Open in IMG/M |
3300006193 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG029-DNA | Environmental | Open in IMG/M |
3300006352 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG108-DNA | Environmental | Open in IMG/M |
3300006869 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA | Environmental | Open in IMG/M |
3300006870 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA | Environmental | Open in IMG/M |
3300006902 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_250_ad_251m_LV_A | Environmental | Open in IMG/M |
3300006947 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA | Environmental | Open in IMG/M |
3300007234 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA | Environmental | Open in IMG/M |
3300007236 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA | Environmental | Open in IMG/M |
3300007514 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 143m, 2.7-0.2um, replicate a | Environmental | Open in IMG/M |
3300007681 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.753 | Environmental | Open in IMG/M |
3300007777 | Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS918_NRZ_DNA CLC_assembly | Environmental | Open in IMG/M |
3300007956 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1459A_0.2um | Environmental | Open in IMG/M |
3300008012 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNA | Environmental | Open in IMG/M |
3300008253 | Methane-oxidizing microbial communities from mesocosms in the Hudson Canyon - EN1B Hudson Canyon | Environmental | Open in IMG/M |
3300008961 | Estuarine microbial communities from the Columbia River estuary - metaG 1550B-02 | Environmental | Open in IMG/M |
3300009000 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MG | Environmental | Open in IMG/M |
3300009001 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG | Environmental | Open in IMG/M |
3300009052 | Estuarine microbial communities from the Columbia River estuary - metaG 1550A-02 | Environmental | Open in IMG/M |
3300009054 | Estuarine microbial communities from the Columbia River estuary - metaG S.737 | Environmental | Open in IMG/M |
3300009071 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 | Environmental | Open in IMG/M |
3300009077 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328 | Environmental | Open in IMG/M |
3300009080 | Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759 | Environmental | Open in IMG/M |
3300009172 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 | Environmental | Open in IMG/M |
3300009409 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150 | Environmental | Open in IMG/M |
3300009425 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 | Environmental | Open in IMG/M |
3300009434 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516 | Environmental | Open in IMG/M |
3300009437 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110414 | Environmental | Open in IMG/M |
3300009438 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110506 | Environmental | Open in IMG/M |
3300009472 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110404 | Environmental | Open in IMG/M |
3300009497 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503 | Environmental | Open in IMG/M |
3300009508 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412 | Environmental | Open in IMG/M |
3300009703 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV12_W25 metaG | Environmental | Open in IMG/M |
3300012928 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaG | Environmental | Open in IMG/M |
3300012954 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaG | Environmental | Open in IMG/M |
3300017782 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19 | Environmental | Open in IMG/M |
3300018415 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011508AT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300019459 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011511BT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300020051 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011504AT metaG (spades assembly) | Environmental | Open in IMG/M |
3300020053 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041401AS metaG (spades assembly) | Environmental | Open in IMG/M |
3300020175 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160321_2 | Environmental | Open in IMG/M |
3300020177 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041402US metaG (spades assembly) | Environmental | Open in IMG/M |
3300020178 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041405US metaG (spades assembly) | Environmental | Open in IMG/M |
3300020182 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160502_2 | Environmental | Open in IMG/M |
3300020188 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041411US metaG (spades assembly) | Environmental | Open in IMG/M |
3300020281 | Marine microbial communities from Tara Oceans - TARA_A100001035 (ERX556022-ERR599116) | Environmental | Open in IMG/M |
3300020294 | Marine microbial communities from Tara Oceans - TARA_E500000331 (ERX556124-ERR599153) | Environmental | Open in IMG/M |
3300020309 | Marine microbial communities from Tara Oceans - TARA_B100000795 (ERX556064-ERR599104) | Environmental | Open in IMG/M |
3300020339 | Marine microbial communities from Tara Oceans - TARA_B100000674 (ERX555929-ERR599080) | Environmental | Open in IMG/M |
3300020374 | Marine microbial communities from Tara Oceans - TARA_A100001011 (ERX291766-ERR318618) | Environmental | Open in IMG/M |
3300020379 | Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556001-ERR599168) | Environmental | Open in IMG/M |
3300020385 | Marine microbial communities from Tara Oceans - TARA_B100001059 (ERX556045-ERR598965) | Environmental | Open in IMG/M |
3300020388 | Marine microbial communities from Tara Oceans - TARA_B100001063 (ERX555965-ERR599064) | Environmental | Open in IMG/M |
3300020415 | Marine microbial communities from Tara Oceans - TARA_B100001146 (ERX555973-ERR599166) | Environmental | Open in IMG/M |
3300020431 | Marine microbial communities from Tara Oceans - TARA_B100001142 (ERX556101-ERR598983) | Environmental | Open in IMG/M |
3300020438 | Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942) | Environmental | Open in IMG/M |
3300020441 | Marine prokaryotic communities collected during Tara Oceans survey from station TARA_078 - TARA_B100000524 (ERX556088-ERR599006) | Environmental | Open in IMG/M |
3300020451 | Marine microbial communities from Tara Oceans - TARA_B100001778 (ERX555927-ERR598996) | Environmental | Open in IMG/M |
3300020454 | Marine microbial communities from Tara Oceans - TARA_B100001769 (ERX556037-ERR599170) | Environmental | Open in IMG/M |
3300020463 | Marine microbial communities from Tara Oceans - TARA_B100001057 (ERX555988-ERR599050) | Environmental | Open in IMG/M |
3300020466 | Marine microbial communities from Tara Oceans - TARA_B100001540 (ERX556059-ERR598968) | Environmental | Open in IMG/M |
3300020468 | Marine microbial communities from Tara Oceans - TARA_A100000164 (ERX555914-ERR598993) | Environmental | Open in IMG/M |
3300020469 | Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052) | Environmental | Open in IMG/M |
3300020470 | Marine microbial communities from Tara Oceans - TARA_B100000287 (ERX555976-ERR599053) | Environmental | Open in IMG/M |
3300020472 | Marine microbial communities from Tara Oceans - TARA_B100001250 (ERX556017-ERR598995) | Environmental | Open in IMG/M |
3300021089 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 12015 | Environmental | Open in IMG/M |
3300021169 | Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021185 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 | Environmental | Open in IMG/M |
3300021347 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO266 | Environmental | Open in IMG/M |
3300021365 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1 | Environmental | Open in IMG/M |
3300021375 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO132 | Environmental | Open in IMG/M |
3300021378 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO131 | Environmental | Open in IMG/M |
3300021389 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127 | Environmental | Open in IMG/M |
3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
3300022905 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011509CT metaG | Environmental | Open in IMG/M |
3300022907 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011511BT metaG | Environmental | Open in IMG/M |
3300022920 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_118_April2016_10_MG | Environmental | Open in IMG/M |
3300022921 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041407BS metaG | Environmental | Open in IMG/M |
3300022928 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011513CT metaG | Environmental | Open in IMG/M |
3300024250 | Seawater microbial communities from Monterey Bay, California, United States - 58D_r | Environmental | Open in IMG/M |
3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
3300025431 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI074_LV_100m_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025614 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI074_LV_200m_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025621 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100511 (SPAdes) | Environmental | Open in IMG/M |
3300025622 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_150m (SPAdes) | Environmental | Open in IMG/M |
3300025637 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110512 (SPAdes) | Environmental | Open in IMG/M |
3300025672 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - Saanich Inlet SI073_LV_135m_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025676 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_100m_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025688 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI073_LV_120m_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025704 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524 (SPAdes) | Environmental | Open in IMG/M |
3300025770 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI072_LV_165m_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025822 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110414 (SPAdes) | Environmental | Open in IMG/M |
3300025860 | Pelagic Microbial community sample from North Sea - COGITO 998_met_03 (SPAdes) | Environmental | Open in IMG/M |
3300025870 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_125m_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025876 | Pelagic Microbial community sample from North Sea - COGITO 998_met_06 (SPAdes) | Environmental | Open in IMG/M |
3300025886 | Pelagic Microbial community sample from North Sea - COGITO 998_met_10 (SPAdes) | Environmental | Open in IMG/M |
3300025892 | Pelagic Microbial community sample from North Sea - COGITO 998_met_01 (SPAdes) | Environmental | Open in IMG/M |
3300026257 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV69 (SPAdes) | Environmental | Open in IMG/M |
3300026260 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV67 (SPAdes) | Environmental | Open in IMG/M |
3300027170 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - C0912_C43A7_35 (SPAdes) | Environmental | Open in IMG/M |
3300027206 | Estuarine microbial communities from the Columbia River estuary - metaG 1370A-02 (SPAdes) | Environmental | Open in IMG/M |
3300027255 | Estuarine microbial communities from the Columbia River estuary - metaG 1558A-02 (SPAdes) | Environmental | Open in IMG/M |
3300027406 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_07_M0_10 (SPAdes) | Environmental | Open in IMG/M |
3300027413 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_54_BLW_10 (SPAdes) | Environmental | Open in IMG/M |
3300027501 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_17_M020 (SPAdes) | Environmental | Open in IMG/M |
3300027506 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_66_BLW_10 (SPAdes) | Environmental | Open in IMG/M |
3300027553 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_04_M0_20 (SPAdes) | Environmental | Open in IMG/M |
3300027571 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 (SPAdes) | Environmental | Open in IMG/M |
3300027686 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG108-DNA (SPAdes) | Environmental | Open in IMG/M |
3300027704 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA (SPAdes) | Environmental | Open in IMG/M |
3300027757 | Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759 (SPAdes) | Environmental | Open in IMG/M |
3300027771 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNA (SPAdes) | Environmental | Open in IMG/M |
3300027801 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 (SPAdes) | Environmental | Open in IMG/M |
3300027859 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 Metagenome (SPAdes) | Environmental | Open in IMG/M |
3300028196 | Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI112_10m | Environmental | Open in IMG/M |
3300028197 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_10m | Environmental | Open in IMG/M |
3300028279 | Seawater microbial communities from Monterey Bay, California, United States - 14D | Environmental | Open in IMG/M |
3300028287 | Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI060_120m | Environmental | Open in IMG/M |
3300031597 | Marine microbial communities from Western Arctic Ocean, Canada - AG5_SCM | Environmental | Open in IMG/M |
3300031638 | Marine microbial communities from Western Arctic Ocean, Canada - CB4_surface | Environmental | Open in IMG/M |
3300031701 | Marine microbial communities from Western Arctic Ocean, Canada - AG5_Bottom | Environmental | Open in IMG/M |
3300031705 | Marine microbial communities from water near the shore, Antarctic Ocean - #36 | Environmental | Open in IMG/M |
3300031773 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 34915 | Environmental | Open in IMG/M |
3300031775 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 32315 | Environmental | Open in IMG/M |
3300032011 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 3416 | Environmental | Open in IMG/M |
3300032047 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 34915 | Environmental | Open in IMG/M |
3300032073 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 3416 | Environmental | Open in IMG/M |
3300032088 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 21515 | Environmental | Open in IMG/M |
3300032360 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 34915 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
DelMOSum2010_100795771 | 3300000101 | Marine | GVYLIDQLGPTYKQLQTGVREKEKVETKRESDTKSRQ* |
DelMOSum2011_100052522 | 3300000115 | Marine | VLTLLFRGVYLIDQLRPTYKQLQTGVREKEKAETKGESDAKS* |
DelMOWin2010_100263284 | 3300000117 | Marine | VLTLFRKVVYLIDQLGPTYKQLQTGVREKEKEETKGESVT |
LP_F_10_SI03_10DRAFT_10177951 | 3300000137 | Marine | VLTLNPKGVYLIDQLGPTYKQLQTGVREKEKVETKGESDTKS* |
SI47jul10_100mDRAFT_10015521 | 3300000148 | Marine | LIDQLGPTYKQLQTGVREKEKVETKGESDAKSRR* |
SI47jul10_100mDRAFT_10045464 | 3300000148 | Marine | VLTLNPKGVYLIDQLGPTYKQLQTGVREKEKVETKGESD |
SI47jul10_100mDRAFT_10064001 | 3300000148 | Marine | GVYLIDQLGPTYKQLQTGVREKEKAETKGESDTKSRQ* |
SI60aug11_100mDRAFT_10001451 | 3300000192 | Marine | VYLIDQLGPTYKQLQTGVREKEKVETKGESDAKSRR* |
SI60aug11_100mDRAFT_10079131 | 3300000192 | Marine | LIDQLGPTYKQLQTGVREKEKAETKGESDTKSRQ* |
SI60aug11_100mDRAFT_10119211 | 3300000192 | Marine | GVYLIDQLGPTYKQLQTGVREKEKVETKGESDTKS* |
LPjun09P410mDRAFT_10145711 | 3300000223 | Marine | VLTLLIKGVYLIDQLGPTYKQLQTGVREKETVETKGESDTKS* |
SI36aug09_120mDRAFT_10345061 | 3300000239 | Marine | KAKNLNFLTKRLTLLIRGVYLIDQLGPTYKQLQTGVREKEKVETKGESDTKS* |
SI36aug09_120mDRAFT_10874681 | 3300000239 | Marine | VYLIDQLGPTYKQLQTGVREKEKVETKGESDTKS* |
LPjun08P16500mDRAFT_10332532 | 3300000251 | Marine | VLTLNPKGVYLIDQLGPTYKQLQTGVREKEKVETKXESDAKSRR* |
SI34jun09_100mDRAFT_10398762 | 3300000254 | Marine | VLTLLFKGVYLIDQLGPTYKQLQTGVREKETVETKRESDTKSRQ* |
LP_F_10_SI03_100DRAFT_10074211 | 3300000257 | Marine | VLTLLIKGVYLIDQLGPTYKQLQTGVREKEKAETKG |
LP_A_09_P04_10DRAFT_10042352 | 3300000265 | Marine | VLTLLFKGVYLIDQLGPTYKQLQTGVREKETVETKXESDTKSRQ* |
LP_A_09_P04_10DRAFT_10235422 | 3300000265 | Marine | VLTLLIRGVYLIDQLXPTYKQLQTGVREKEKVETKRESDTKSRQ* |
SI48aug10_100mDRAFT_10122963 | 3300000324 | Marine | VLTLNPKGVYLIDQLGPTYKQLQTGVREKEKVETKG |
NpDRAFT_100434681 | 3300000929 | Freshwater And Marine | VLTLLIRGVYLIDQLGPTYKQLQTGVREKEKVETKGESDTKS* |
JGI20151J14362_100243525 | 3300001346 | Pelagic Marine | VLTLFPKGVYLIDQLGPTYKQLQTGVREKEKEETKGESVTKVDDKK |
JGI20156J14371_100098932 | 3300001347 | Pelagic Marine | VLTLLIKGVYLIDQLGPTYKQLQTGVREKEKAETKRESDTKSRQ* |
JGI20156J14371_100253094 | 3300001347 | Pelagic Marine | KGLTLLIRGVYLIDQLGPTYKQLQTGVREKEKVETKGESDTKS* |
JGI20156J14371_101350221 | 3300001347 | Pelagic Marine | VLTLLFRGVYLIDQLRPTYKQLQTGVREKEKAETKGESDAKVDDKKEL |
JGI20154J14316_100469013 | 3300001348 | Pelagic Marine | VLTLLFRGVYLIDQLGPTYKQLQTGVREKEKAETKGESDXKS* |
JGI20160J14292_100180411 | 3300001349 | Pelagic Marine | VLTLLIXGVYXIDQLRPTYKQLQTGVREKEKAETKGE |
JGI20160J14292_100368161 | 3300001349 | Pelagic Marine | VLTLLFRGVYLIDQLRPTYKQLQTGVREKEKAETKGE |
JGI20153J14318_100394632 | 3300001351 | Pelagic Marine | VLTLLFRGVYLIDQLGPTYKQLQTGVREKEKAETKSESDAKS* |
JGI20157J14317_1000030057 | 3300001352 | Pelagic Marine | KGVYLIDQLGPTYKQLQTGVREKEKEETKGESVTKSRR* |
JGI20157J14317_100297001 | 3300001352 | Pelagic Marine | VLTLLFRGVYLIDQLRPTYKQLQTGVREKEKAETKGESD |
JGI20159J14440_100109035 | 3300001353 | Pelagic Marine | VLTLFPKGVYLIDQLGPTYKQLQTGVREKEKEETKGESVTKVDDKKEL |
JGI20155J14468_101633331 | 3300001354 | Pelagic Marine | VLTLLFKGVYLIDQLGPTYKQLQTGVREKETVETK |
GOS2220_10178102 | 3300001936 | Marine | VLTLLIIGVYLIDQLGPTYKQLQTGVREKEKVETKGESDAKS* |
GOS2220_10194522 | 3300001936 | Marine | VLTLLIRGVYLIDQLGPTYKQLQTGVREKEKVETKRESDTKSRQ* |
GOS2224_10041712 | 3300001952 | Marine | MLTLFPKGVYLIDQLGPTYKQLQTGVREKEKEETKGESDTKSRR* |
GOS2224_10497453 | 3300001952 | Marine | VLTLFPKGVYLIDQLGDLQTTADGSKREREEETKGESVTKSRR* |
JGI24820J26691_10361051 | 3300002176 | Marine | LTLFSRGVYLIDQLGLTYKQLQTGVGEKEKEETKG |
M1t2FKB2103N_17898123 | 3300002230 | Marine | LTLLIRGVYLIDQLGPTYKQLQTGVREKEKVETKGESDTKVDDKKELS |
JGI26060J43896_101190562 | 3300002913 | Marine | KLKLFYKKVLTLLIRSVYLIDQLGPTYKQLQTGVREKEKEETKGESDTKSRQ* |
JGI26062J44793_10064191 | 3300002955 | Marine | LFXNGVYLIDQLGLTYKQLQTGVGEKEEEETKGESVIKSRR* |
JGI26112J46591_10220102 | 3300003269 | Marine | VLTLNPKGVYLIDQLGPTYKQLQTGVREKEKVETKGESDAKSRR* |
JGI26114J46594_10118272 | 3300003271 | Marine | VLTLFSIGVYLIDQLGPTYKQLQTGVREKEKVETKGESDAKSRR* |
JGI26081J50195_10119093 | 3300003346 | Marine | VLTLLIRGVYLLDQLGPTYKQLQTGVREKEEAETKGESDAKS* |
JGI26111J50215_10048172 | 3300003428 | Marine | VLTLFSIGVYLIDQLGPTYKQLQTGVREKEKAETKGESDTKSRQ* |
NAP4_10774981 | 3300003474 | Estuarine | VLTLFPKGVYLIDQLGPTYKQLQTGVREKEKEETKGESVIKSRR* |
NAP2_10956961 | 3300003476 | Estuarine | QKVLTPFPKGVYLIDQLGPTYNQLQTGVREKEKEETKGESVIKSRR* |
nap3_100043403 | 3300003477 | Estuarine | VLTLFPKGVYLIDQLGPTYNQLQTGVREKEKEETKGESVIKSRR* |
JGI26238J51125_10062092 | 3300003478 | Marine | VLTLLIXGVYLIDQLGPTYKQLQTGVREKEKVETKRESDTKSRQ* |
JGI26242J51144_10258372 | 3300003500 | Marine | LTLLIRGVYLIDQLGPTYKQLQTGVREKEKVETKGESDTKS* |
FS896DNA_106253582 | 3300003540 | Diffuse Hydrothermal Flow Volcanic Vent | VLTVFLRGVYLIDQLKLTNKQLQTGVRENEKVETKGESVIKSR* |
JGI26253J51717_100007330 | 3300003583 | Marine | LTLLIRGVYLIDQLGPTYKQLQTGVREKEKXETKGESDTKS* |
JGI26254J51713_100073410 | 3300003584 | Marine | VLTLFSIGVYLIDQLGPTYKQLQTGVREKEKAETKGESDTKS |
JGI26261J51718_10013913 | 3300003586 | Marine | VLTLLIKGVYLIDQLGPTYKQLQTGVREKEKVETKRESDTKSRQ* |
JGI26261J51718_10096134 | 3300003586 | Marine | LTLLIRGVYLIDQLGPTYKQLQTGVREKEKAETKGESDTKS* |
JGI26255J51710_100066310 | 3300003596 | Marine | VLTLFSIGVYLIDQLGPTYKQLQTGVREKEKAETKGESDT |
JGI26380J51729_100750011 | 3300003619 | Marine | VLTLLFKGVYLIDQLGPTYKQLQTGVREKETVETKRESDTKSDNKKELSN |
JGI26273J51734_100283162 | 3300003620 | Marine | VLTLNPKGVYLIDQLGPTYKQLQTGVREKEKVETKGESDTKSRR* |
JGI26273J51734_100810181 | 3300003620 | Marine | TLLFKGVYLIDQLGPTYKQLQTGVREKETVETKSESDTKSRQ* |
Ga0066606_100161671 | 3300004280 | Marine | VKFFLLKVLTLFSIGVYLIDQLGPTYKQLQTGVREKEKAETKGESDTKSRQ* |
Ga0065726_183411 | 3300004369 | Saline | LTLLIRGVYLIDQLGPTYKQLQTGVREKEEAETKGESDAKS* |
Ga0073579_10954109 | 3300005239 | Marine | VLTLLIRGVYLIDQLGPTYKQLQTGVREKEKVETKGESDAKS* |
Ga0066855_101340011 | 3300005402 | Marine | VLTVCLRGVYLIDQLKLTSKQLQTGVRENEKEETKAKALLRVGDKK* |
Ga0066856_100471111 | 3300005404 | Marine | LTLFPKGVYLIDQLGPTYKQLQTGVREKEKEETKGESVIKSR |
Ga0066856_100885071 | 3300005404 | Marine | VLTLFTKGVYLIDQLGPTYNQLQTGVREKEKEETKGESVIKSRR |
Ga0066856_104832122 | 3300005404 | Marine | VLTLFPKGVYLIDQLRPTYKQLQTGVREKEKEETKGESDTKSRDK |
Ga0066861_100011347 | 3300005522 | Marine | VLTLFPKGVYLIDQLRPTYKQLQTGVREKEKEETKGESD |
Ga0066861_100531393 | 3300005522 | Marine | VLTLFPKGVYLIDQLGPTYKQLQTGVREKEKEETKGESDTKSRDKKELSNPP |
Ga0066865_103640332 | 3300005523 | Marine | LLIFFYTEVLTLFPKGVYLIDQLGPTYNQLQTGVREKEKEETKGESVIKSRR* |
Ga0066835_100393182 | 3300005606 | Marine | VLTHFPNQVYLIDQIGLTYKQLQTGVGEKEEEETKGESDTKSRR* |
Ga0078893_106481601 | 3300005837 | Marine Surface Water | LTLFPKGVYLIDQLGPTYNQLQTGVREKEKEETKGES |
Ga0070743_100224032 | 3300005941 | Estuarine | VLTLLFKGVYLIDQLGPTYKQLQTGVREKETVETKSESDTKSRQ* |
Ga0075462_100109281 | 3300006027 | Aqueous | VLTLFPKVVYLIDQLGPTYKQLQTGVREKEKEETKGESVTKVDDKKE |
Ga0075462_100182761 | 3300006027 | Aqueous | VLTLFPKGVYLIDQLGPTYKQLQTGVREKEKEETKGESVTKSDDKKE |
Ga0075441_101378731 | 3300006164 | Marine | VLTLFTRGVYFIDQLGPTYKQLQTGVREKEKAETKSESATKVDDKKELSN |
Ga0075443_100176141 | 3300006165 | Marine | VLTLLIKGVYLIDQLGPTYKQLQTGVREKEKVETK |
Ga0066836_103389833 | 3300006166 | Marine | VLTLFPKGVYLIDQLGLTYKQLQTGVREKEKEETKGESDTKSRDKKELSN |
Ga0075446_100286372 | 3300006190 | Marine | LTLKIIRVTLIDQLGPTYKQLQTGVREKEEVETKGESDTKS* |
Ga0075446_101830051 | 3300006190 | Marine | VLTLLIKGVYLIDQLGPTYKQLQTGVREKEKVETKGESDAKVDDKKELSN |
Ga0075447_100762102 | 3300006191 | Marine | VLTLLIKGVYLIDQLGPTYKQLQTGVREKEKVETKG |
Ga0075447_102238212 | 3300006191 | Marine | VLTLFIRGVYLIDQLGPTYKQLQTGVREKEKAETKSES |
Ga0075445_100143161 | 3300006193 | Marine | LTLKIIRVTLIDQLGPTYKQLQTGVREKEEVETKGESDTK |
Ga0075448_100490012 | 3300006352 | Marine | LTPFVRGVYLIDQLGPTYKQLQTGVREKEKVETKGESDTKSRQ* |
Ga0075477_100156372 | 3300006869 | Aqueous | VLTLFSKGVYLIDQLGPTYKQLQTGVREKEKEETKGESVTKSRR* |
Ga0075479_100467722 | 3300006870 | Aqueous | VLTLFPKVVYLIDQLGPTYKQLQTGVREKEKEETKGESVTKSRR* |
Ga0066372_100182932 | 3300006902 | Marine | VLTVYLRGVYLIDQLKPTNKQLQTGVRENEKEETKGESVIKSR* |
Ga0075444_100517122 | 3300006947 | Marine | VLTLLIRGVYLIDQLGPTYKQLQTGVREKEKAETKGESDTKS* |
Ga0075444_101677953 | 3300006947 | Marine | VLTLFIRGVYLIDQLGPTYKQLQTGVREKEKAETK |
Ga0075460_102797341 | 3300007234 | Aqueous | VLTLFPKVVYLIDQLGPTYKQLQTGVREKEKEETKGE |
Ga0075463_100044955 | 3300007236 | Aqueous | PKGVYLIDQLGPTYKQLQTGVREKEKEETKGESVTKSRR* |
Ga0105020_100376416 | 3300007514 | Marine | VLTLFPKGVYLIDQLGPTYNQLQTGVREKEKEETKGESV |
Ga0102824_10296571 | 3300007681 | Estuarine | YLIDQLGPTYKQLQTGVREKEKVETKGESDAKSRR* |
Ga0102824_10788121 | 3300007681 | Estuarine | LLIKGVYLIDQLGPTYKQLQTGVREKEKAETKGESDTKS* |
Ga0105711_11533591 | 3300007777 | Diffuse Vent Fluid, Hydrothermal Vents | VLTVCLRGVYLIDQLKLTNKQLQTGVRENEKVETKGES |
Ga0105741_11868701 | 3300007956 | Estuary Water | LLFKGVYLIDQLGPTYKQLQTGVREKEKEETKGESDTKSRR* |
Ga0075480_104874612 | 3300008012 | Aqueous | VLTLFPKGVYLIDQLGPTYKQLQTGVREKEKEETKGESV |
Ga0105349_101981001 | 3300008253 | Methane Seep Mesocosm | FPKGVYLIDQLGPTYKQLQTGVREKEKEETKGESVTKSRR* |
Ga0105349_103673771 | 3300008253 | Methane Seep Mesocosm | KGVYLIDQLGPTYKQLQTGVREKEKVETKGESDAKSRR* |
Ga0105349_104063532 | 3300008253 | Methane Seep Mesocosm | VLTLLIKGVYLIDQLGPTYKQLQTGVREKEKAETK |
Ga0102887_10409581 | 3300008961 | Estuarine | IGVYLIDQLGPTYKQLQTGVREKEKAETKGESDTKS* |
Ga0102960_11194142 | 3300009000 | Pond Water | VLTLFPKGVYLIDQLGPTYKQLQTGVREKEKEETKGESVTKSR |
Ga0102963_10049055 | 3300009001 | Pond Water | VLTLFSKGVYLIDQLGPTYKQLQTGVREKEKEETKGESVTK |
Ga0102886_10165271 | 3300009052 | Estuarine | GVYLIDQLGPTYKQLQTGVREKEKAETKGESDTKS* |
Ga0102826_10625691 | 3300009054 | Estuarine | NPKGVYLIDQLGPTYKQLQTGVREKEKVETKGESDAKSRR* |
Ga0115566_100525761 | 3300009071 | Pelagic Marine | LTLFPKGVYLIDQLGPTYKQLQTGVREKEKEETKGESVTKS |
Ga0115552_11099861 | 3300009077 | Pelagic Marine | KKVLTLFPKGVYLIDQLGPTYKQLQTGVREKEKEETKGESVTKSRR* |
Ga0102815_100383724 | 3300009080 | Estuarine | LIRGVYLIDQLGPTYKQLQTGVREKEKAETKRESATKSRR* |
Ga0102815_101411583 | 3300009080 | Estuarine | TLLIRGVYLIDQLGPTYKQLQTGVREKEKAETKGESDTKSRQ* |
Ga0114995_100429893 | 3300009172 | Marine | IIGVYLIDQLGPTYKQLQTGVREKEKVETKGESDTKSRQ* |
Ga0114993_103782501 | 3300009409 | Marine | LTLLIRGVYLIDQLGPTYKQLQTGVREKEKVETKSESDTKS |
Ga0114997_101539301 | 3300009425 | Marine | VKGVYLIDQLGPTYKQLQTGVREKEKVETKSESDTK |
Ga0115562_10975202 | 3300009434 | Pelagic Marine | VLTLLFRGVYLIDQLGPTYKQLQTGVREKEKAETKGESDAK |
Ga0115556_10732621 | 3300009437 | Pelagic Marine | IRGVYLIDQLGPTYKQLQTGVREKEKAETKGESDAKS* |
Ga0115556_12058811 | 3300009437 | Pelagic Marine | VLTLFPKVVYLIDQLGPTYKQLQTGVREKEKEETKGESVTKS |
Ga0115559_10349621 | 3300009438 | Pelagic Marine | LTLLIRGVYLIDQLGPTYKQLQTGVREKEKAETKRESDTKSRR* |
Ga0115554_10455081 | 3300009472 | Pelagic Marine | KVLTLLIKGVYLIDQLGPTYKQLQTGVREKEKAETKGESVTKS* |
Ga0115569_100176181 | 3300009497 | Pelagic Marine | VLTLLFRGVYLIDQLGPTYKQLQTGVREKEKAETKGESDAKS |
Ga0115567_101352381 | 3300009508 | Pelagic Marine | VLTLLIKGVYLIDQLGPTYKQLQTGVREKEKEETKGESVT |
Ga0114933_107080442 | 3300009703 | Deep Subsurface | FLKKVLTLFPKGVYLIDQLGPTYKQLQTGVREKEKEETKGESVTKSRR* |
Ga0114933_107610631 | 3300009703 | Deep Subsurface | VLTLFPKGVYLIDQLGPTYNQLQTGVREKEKEETKGES |
Ga0163110_108159412 | 3300012928 | Surface Seawater | VLTLFSKGVYLIDQLGLTYKQLQTGVGEKEEEETKGES |
Ga0163111_121169831 | 3300012954 | Surface Seawater | VLTLFSKGVYLIDQLGPTYNQLQTGVREKEKEETKGESV |
Ga0181380_10635953 | 3300017782 | Seawater | LTLFPKGVYLIDQLGPTYKQLQTGVREKEKEETKGESVIKSRR |
Ga0181559_101981001 | 3300018415 | Salt Marsh | VLTLFPKGVYLIDQLGPTYKQLQTGVREKEKEETKGES |
Ga0181562_100161855 | 3300019459 | Salt Marsh | VLTLFPKGVYLIDQLGPTYKQLQTGVREKEKEETKGESVI |
Ga0181555_10058171 | 3300020051 | Salt Marsh | VLTLFPKGVYLIDQLGPTYKQLQTGVREKEKEETKGESVIKS |
Ga0181595_100190855 | 3300020053 | Salt Marsh | VLTLFPKGVYLIDQLGPTYKQLQTGVREKEKEETKGESVT |
Ga0206124_102164461 | 3300020175 | Seawater | VLTLLIKGVYLIDQLGPTYKQLQTGVREKEKVETKRESDT |
Ga0206124_102911102 | 3300020175 | Seawater | LKKVLTLFPKGVYLIDQLGPTYKQLQTGVREKEKEETKGESVTKSRR |
Ga0181596_100675861 | 3300020177 | Salt Marsh | VYLIDQLGPTYNQLQTGVREKEKEETKGESVIKSRR |
Ga0181599_10265401 | 3300020178 | Salt Marsh | SLVLTLFPKGVYLIDQLGPTYKQLQTGVREKEKEETKGESVIKSRR |
Ga0181599_10392103 | 3300020178 | Salt Marsh | VLTLFPKGVYLIDQLGPTYKQLQTGVREKEKEETKGESVIK |
Ga0206129_101251523 | 3300020182 | Seawater | VLTLLIKGVYLIDQLGPTYKQLQTGVREKEKAETKGESDA |
Ga0181605_100313401 | 3300020188 | Salt Marsh | VLTLFPKGVYLIDQLGPTYKQLQTGVREKEKEETKGE |
Ga0211483_103138012 | 3300020281 | Marine | FLKKVLTHFPNQVYLIDQLGLTYKQLQTGVGEKEKEETKGESVIKSRR |
Ga0211520_10204681 | 3300020294 | Marine | TKVLTLFTEGVYLIDQLGPTYNQLQTGVREKEEEETKGESVTKSRR |
Ga0211681_10007631 | 3300020309 | Marine | GVYLIDQLGPTYKQLQTGVREKEKVETKRESDTKS |
Ga0211605_10264922 | 3300020339 | Marine | LTLIPKGVYLIDQLGLTYKQLQTGVGEKEKEETKGESVIKSRR |
Ga0211477_100590273 | 3300020374 | Marine | MFFYTKVLTLFTEGVYLIDQLGPTYNQLQTGVREKEEE |
Ga0211652_100343941 | 3300020379 | Marine | KGVYLIDQLGPTYKQLQTGVREKEKEETKGESDTKSRR |
Ga0211677_104149472 | 3300020385 | Marine | VLTLFPKGVYLIDQLGPTYKQLQTGVREEEKEETKGESDTKSR |
Ga0211678_100383533 | 3300020388 | Marine | VLTLFPKGVYLIDQLGPTYKQLQTGVREKEKEETKGESDT |
Ga0211678_103895341 | 3300020388 | Marine | LTLFPKGVYLIDQLGPTYKQLQTGVREKEKEETKGES |
Ga0211553_102471081 | 3300020415 | Marine | GVYLIDQLKLTNKQLQTGVRENEKEETKGESVIKSR |
Ga0211554_100050816 | 3300020431 | Marine | MQVLTLFTKGVYLIDQLGPTYKQLQTGVREKEKEETKGESDTKSRR |
Ga0211554_100182885 | 3300020431 | Marine | LTLFTKGVYLIDQLGPTYKQLQTGVREKEKEETKGESDTKSR |
Ga0211576_101504612 | 3300020438 | Marine | FPKGVYLIDQLGPTYKQLQTGVREKEKEETKGESDTKSRR |
Ga0211576_101853341 | 3300020438 | Marine | RGVYLIDQLGPTYKQLQTGVREKEKVETKRESDTKSRQ |
Ga0211695_101801461 | 3300020441 | Marine | FSIHVYLIDQLGLTYKQLQTGVGEKEKEETKGESVIKSRR |
Ga0211473_102796032 | 3300020451 | Marine | IFFLKKVLTLFPKGVYLIDQLGPTYNQLQTGVREKEKEETKGESVIKSRR |
Ga0211548_100407463 | 3300020454 | Marine | IFFLQKVLTPFPKGVYLIDQLGPTYKQLQTGVREKEKEETKGESVTKSRR |
Ga0211676_100520501 | 3300020463 | Marine | VLTLSSKSVYLIDQIGPTYKQLQTGVREKEEEETKGE |
Ga0211714_103932862 | 3300020466 | Marine | QKVLTLFPKGVYLIDQLGPTYNQLQTGVREKEKEETKGESVIKSRR |
Ga0211475_100223571 | 3300020468 | Marine | VLTPFPKGVYLIDQLGPTYNQLQTGVREKEKEETKGES |
Ga0211577_102783023 | 3300020469 | Marine | MFFCTKVLTPFTKGVYLIDQLGPTYNQLQTGVREKEK |
Ga0211577_102792883 | 3300020469 | Marine | MFFYTKVLTLFIKGVYLIDQLGPTYKQLQTGVREKEK |
Ga0211543_100874691 | 3300020470 | Marine | VLTLFPKGVYLIDQLGLTYKQLQTGVREKEKEETKGESV |
Ga0211579_101202751 | 3300020472 | Marine | YIQVLTLFPKGVYLIDQLGPTYNQLQTGVREKEKEETKGESETKSRR |
Ga0206679_102107821 | 3300021089 | Seawater | FTNRVYLIDQLGLTYKQLQTGVREKEKEETKGESVIKSRR |
Ga0206687_11558601 | 3300021169 | Seawater | GVYLIDQLGPTYNQLQTGVREKEKEETKGESVIKSRR |
Ga0206682_100677501 | 3300021185 | Seawater | VLTLNPKGVYLIDQLGPTYKQLQTGVREKEKVETKGESDAK |
Ga0206682_101891421 | 3300021185 | Seawater | VLTLFPKGVYLIDQLGPTYKQLQTGVREKEKEETKGESVIKSR |
Ga0213862_100778082 | 3300021347 | Seawater | VLTLFPKGVYLIDQLGPTYKQLQTGVREKEKEETKGESDIKS |
Ga0206123_100814221 | 3300021365 | Seawater | VLTLFPKGVYLIDQLGPTYNQLQTGVREKEKEETKGE |
Ga0213869_100103895 | 3300021375 | Seawater | VLTLFPKGVYLIDQLGPTYKQLQTGVREKEKEETKGESVIKSRR |
Ga0213869_101460011 | 3300021375 | Seawater | MLTLFPKGVYLIDQLGPTYKQLQTGVREKEKEETKG |
Ga0213861_100051441 | 3300021378 | Seawater | LTLFPKGVYLIDQLGPTYKQLQTGVREKEKEETKGESVTKSRR |
Ga0213861_100190515 | 3300021378 | Seawater | LTLFPKGVYLIDQLGPTYKQLQTGVREKEKEETKGESVTKSR |
Ga0213868_100131511 | 3300021389 | Seawater | VLTLFPKGVYLIDQLGPTYKQLQTGVREKEKVETKGESVT |
Ga0213868_100679492 | 3300021389 | Seawater | MLTLFPKGVYLIDQLGPTYKQLQTGVREKEKEETKGESDTKSRR |
Ga0213868_102485541 | 3300021389 | Seawater | LTLFPKGVYLIDQLGPTYKQLQTGVREKEKEETKGESDTKS |
Ga0222717_103428151 | 3300021957 | Estuarine Water | LTLFPKGVYLIDQLGPTYKQLQTGVREKEKVETKGESDTKS |
Ga0222716_106973781 | 3300021959 | Estuarine Water | VLTLFPKVVYLIDQLGPTYKQLQTGVREKDKEETKGESVTKSRR |
Ga0222715_102399493 | 3300021960 | Estuarine Water | VLTLFPKGVYLIDQLGPTYKQLQTGLREKEKEETKGESVTKSR |
Ga0255756_10159995 | 3300022905 | Salt Marsh | FKLIIFFLKKVLTLFPKGVYLIDQLGPTYNQLQTGVREKEKEETKGESVTKSRR |
Ga0255775_10050311 | 3300022907 | Salt Marsh | KLIIFFLKKVLTLFSKGVYLIDQLGPTYKQLQTGVREKEKEETKGESVTKSRR |
(restricted) Ga0233426_100363184 | 3300022920 | Seawater | LIKFFLSKVLTSFSTGVYLIDQLGPTYKQLQTGVREKEKAETKGESDTKS |
Ga0255765_10272525 | 3300022921 | Salt Marsh | VLTLFPKGVYLIDQLGPTYKQLQTGVREKEKEETKG |
Ga0255758_100366714 | 3300022928 | Salt Marsh | IEVLTLFPKGVYLIDQLGPTYNQLQTGVREKEKEETKGESVIKSRR |
Ga0228677_11081852 | 3300024250 | Seawater | KKVLTLFPKGVYLIDQLGPTYKQLQTGVREKEKEETKGESVIKSRR |
Ga0244775_100406131 | 3300024346 | Estuarine | LTLFSIGVYLIDQLGPTYKQLQTGVREKEKAETKGESD |
Ga0244775_101009961 | 3300024346 | Estuarine | LKVLTLFSIGVYLIDQLGPTYKQLQTGVREKEKAETKGESDTKSRQ |
Ga0244776_100676051 | 3300024348 | Estuarine | GVYLIDQLGPTYKQLQTGVREKETVETKRESDTKSRQ |
Ga0209449_10749182 | 3300025431 | Marine | VKFFLLKVLTLFSIGVYLIDQLGPTYKQLQTGVREKEKAETKGESDTKSRQ |
Ga0209665_11396301 | 3300025614 | Marine | KGLTLLIRGVYLIDQLGPTYKQLQTGVREKEKVETKGESDTKS |
Ga0209504_10452993 | 3300025621 | Pelagic Marine | VLTLLFRGVYLIDQLGPTYKQLQTGVREKEKAETKGES |
Ga0209504_10529931 | 3300025621 | Pelagic Marine | VLTLLIRGVYLIDQLGPTYKQLQTGVREKEKAETKGES |
Ga0209264_10256491 | 3300025622 | Marine | VLTLLIRGVYLIDQLGPTYKQLQTGVREKEKAETKGE |
Ga0209197_11781492 | 3300025637 | Pelagic Marine | LTLLIKGVYLIDQLGPTYKQLQTGVREKEKVETKRESDTKSRQ |
Ga0209663_10043726 | 3300025672 | Marine | IKGVYLIDQLGPTYKQLQTGVREKEKAETKGESDTKS |
Ga0209657_10427021 | 3300025676 | Marine | VLTLLIKGVYLIDQLGPTYKQLQTGVREKEKVETKRESD |
Ga0209140_10333783 | 3300025688 | Marine | KLKLFHQKVLTLSIRGVYLIDQLRPTYKQLQTGVREKEKAETKGESDAKS |
Ga0209602_10868711 | 3300025704 | Pelagic Marine | VLTLLIKGVYLIDQLGPTYKQLQTGVREKETVETKSE |
Ga0209362_10816243 | 3300025770 | Marine | VLTLLIKGVYLIDQLGPTYKQLQTGVREKEKAETKGESD |
Ga0209714_11063172 | 3300025822 | Pelagic Marine | YLIDQLGPTYKQLQTGVREKEKAETKGESDTKSRR |
Ga0209119_10325321 | 3300025860 | Pelagic Marine | VLTLLFRGVYLIDQLGPTYKQLQTGVREKEKAETKGESDA |
Ga0209119_10639783 | 3300025860 | Pelagic Marine | KVLTLLFRGVYLIDQLGPTYKQLQTGVREKEKAETKGESDAKS |
Ga0209666_12362101 | 3300025870 | Marine | VLTLLFKGVYLIDQLGPTYKQLQTGVREKETVETKSESDTK |
Ga0209223_101119281 | 3300025876 | Pelagic Marine | VLTLFPKGVYLIDQLGPTYKQLQTGVREKEKEETKGESVTK |
Ga0209632_102189411 | 3300025886 | Pelagic Marine | VLTLFPKGVYLIDQLGPTYKQLQTGVREKEKEETKGESVTKS |
Ga0209630_102307401 | 3300025892 | Pelagic Marine | VLTLLFRGVYLIDQLRPTYKQLQTGVREKEKAETKGESDAK |
Ga0208407_100037419 | 3300026257 | Marine | VLTLFPKGVYLIDQLGPTYKQLQTGVREKEKEETKGESDTK |
Ga0208408_10407251 | 3300026260 | Marine | VLTLFPKGVYLIDQLGPTYKQLQTGVREKEKEETKGESD |
Ga0208963_10384442 | 3300027170 | Marine | IGVYLIDQLGPTYKQLQTGVREKEKAETKGESVTKSXR |
Ga0208023_10818241 | 3300027206 | Estuarine | VLTLLIIGVYLIDQLGPTYKQLQTGVREKETVETK |
Ga0208681_10137392 | 3300027255 | Estuarine | VLTLFSIGVYLIDQLGPTYKQLQTGVREKEKAETKGESDTK |
Ga0208965_10281332 | 3300027406 | Marine | KVLTLLIRGVYLIDQLGPTYKQLQTGVREKEKAETKRESATKSRR |
Ga0208950_10173883 | 3300027413 | Marine | VLTLNPKGVYLIDQLGPTYKQLQTGVREKEKVETKGESDAKSRR |
Ga0208948_100082411 | 3300027501 | Marine | GVYLIDQLGPTYKQLQTGVREKEKAETKGESDTKSRQ |
Ga0208948_10533852 | 3300027501 | Marine | VLTLLIRGVYLIDQLGPTYKQLQTGVREKEKAETKGESD |
Ga0208973_10297471 | 3300027506 | Marine | LFPKGVYLIDQLGPTYKQLQTGVREKEKEETKGESDTKSRR |
Ga0208947_10157791 | 3300027553 | Marine | VLTLLFKGVYLIDQLGPTYKQLQTGVREKETVETKRESDTKSRQ |
Ga0208897_11521001 | 3300027571 | Estuarine | IGVYLIDQLGPTYKQLQTGVREKEKAETKGESDTKSRQ |
Ga0209071_10845872 | 3300027686 | Marine | PFVRGVYLIDQLGPTYKQLQTGVREKEKVETKRESDTKSRQ |
Ga0209816_10439761 | 3300027704 | Marine | VLTLLIKGVYLIDQLGPTYKQLQTGVREKEKVETKGESDAKS |
Ga0208671_100432171 | 3300027757 | Estuarine | TLLIRGVYLIDQLGPTYKQLQTGVREKEKAETKGESDTKS |
Ga0208671_100651773 | 3300027757 | Estuarine | KFFLLKVLTLFSIGVYLIDQLGPTYKQLQTGVREKEKAETKGESDTKSRQ |
Ga0209279_100440721 | 3300027771 | Marine | VLTLLIKGVYLIDQLGPTYKQLQTGVREKEKVETKGESDAK |
Ga0209091_100079731 | 3300027801 | Marine | LFYKKVLTLLIRGVYLIDQLGPTYKQLQTGVREKEKVETKSESDTKSRQ |
Ga0209503_102542891 | 3300027859 | Marine | GVYLIDQLGPTYKQLQTGVREKEKEETKGESDTKSRR |
Ga0257114_11479832 | 3300028196 | Marine | KGVYLMDQLGPTYKQLQTGVREKEKEETKGESVTKSRR |
Ga0257110_12347782 | 3300028197 | Marine | YEKVLTLLIRGVYLIDQLGPTYKQLQTGVREKEKVETKRESDTKSRQ |
Ga0228613_11427782 | 3300028279 | Seawater | LTLFPKGVYLIDQLGPTYKQLQTGVREKEKEETKGESVIKS |
Ga0257126_10081705 | 3300028287 | Marine | VLTLNPKGVYLIDQLGPTYKQLQTGVREKEKVETKGESDAKSR |
Ga0257126_11469461 | 3300028287 | Marine | LSKVLTSFSTGVYLIDQLGPTYKQLQTGVREKEKAETKGESDTKS |
Ga0257126_11551312 | 3300028287 | Marine | VLTLLIKGVYLIDQLGPTYKQLQTGVREKETVETKGES |
Ga0302116_11710131 | 3300031597 | Marine | VLTLLFRGVYLIDQLGPTYKQLQTGVREKEKVETKRESDTKS |
Ga0302125_100475673 | 3300031638 | Marine | KSKKLKLFYKKVLTLLIRGVYLIDQLGPTYKQLQTGVREKEKVETKSESDTKSRQ |
Ga0302125_102539281 | 3300031638 | Marine | KSKKLKLFYKKVLTLLIRGVYLIDQLGPTYKQLQTGVREKEKAETKSESATKS |
Ga0302120_100097404 | 3300031701 | Marine | KKLKLFYKKVLTVLIRSVYLIDQLGPTYKQLQTGVREKEKEETKGESDTKS |
Ga0308003_11622821 | 3300031705 | Marine | GVYLIDQLGPTYKQLQTGVREKEKAETKSESATKS |
Ga0315332_104186601 | 3300031773 | Seawater | FIFFLKKVLTLFTNRVYLIDQLGPTYNQLQTGVREKEKEETKGESVIKSRR |
Ga0315332_105995112 | 3300031773 | Seawater | MQVLTLFTKGVYLIDQLGPTYKQLQTGVREKEKEETKGES |
Ga0315326_101238482 | 3300031775 | Seawater | VLTPFPKGVYLIDQLGPTYKQLQTGVREKEKEETKGESDTKSRR |
Ga0315326_105881972 | 3300031775 | Seawater | VLTLFPKGVYLIDQLGPTYNQLQTGVREKEKEETKGESVI |
Ga0315316_103985911 | 3300032011 | Seawater | VLTLFPKGVYLIDQLGPTYNQLQTGVREKEKEETKGESVIKS |
Ga0315330_100075691 | 3300032047 | Seawater | VLTPFPKGVYLIDQLGPTYKQLQTGVREKEKEETKG |
Ga0315330_100272724 | 3300032047 | Seawater | VLTLFSKSVYLIDQLGPTYKQLQTGVREKEKEETKGESDTKSRR |
Ga0315330_101125823 | 3300032047 | Seawater | MQVLTLFTKGVYLIDQLGPTYKQLQTGVREKEKEET |
Ga0315315_101456101 | 3300032073 | Seawater | VLTLFTKGVYLIDQLGPTYKQLQTGVREKEKEETKGESDTKSR |
Ga0315315_102077683 | 3300032073 | Seawater | MQVLTLFTKGVYLIDQLGPTYKQLQTGVREKEKEETKGESDTKS |
Ga0315315_105492082 | 3300032073 | Seawater | LFHIEVLTLFPKGVYLIDQLGPTYKQLQTGVREKEKEETKGESETKSRR |
Ga0315321_100685141 | 3300032088 | Seawater | VLTLLIKGVYLIDQLGPTYKQLQTGVREKETVETKGESDT |
Ga0315321_102418213 | 3300032088 | Seawater | VLTLFTKGVYLIDQLGPTYKQLQTGVREKEKEETKGESDT |
Ga0315334_105371691 | 3300032360 | Seawater | VLTLFPNRVYLIDQLKPTNKQLQTGVRENEKEETKGESVI |
Ga0315334_113350161 | 3300032360 | Seawater | VLTVCLRGVYLIDQLKLTNKQLQTGVRENEKEETKGESVIKS |
⦗Top⦘ |