Basic Information | |
---|---|
Family ID | F016961 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 243 |
Average Sequence Length | 45 residues |
Representative Sequence | MNTALTIMGMAVLLPLCVIAGIYVGHSLTIKSQQTKTNEQNNRSL |
Number of Associated Samples | 166 |
Number of Associated Scaffolds | 243 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 59.67 % |
% of genes near scaffold ends (potentially truncated) | 33.33 % |
% of genes from short scaffolds (< 2000 bps) | 76.54 % |
Associated GOLD sequencing projects | 146 |
AlphaFold2 3D model prediction | No |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (86.420 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (14.403 % of family members) |
Environment Ontology (ENVO) | Unclassified (47.737 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (39.918 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 82.22% β-sheet: 0.00% Coil/Unstructured: 17.78% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 243 Family Scaffolds |
---|---|---|
PF00271 | Helicase_C | 31.69 |
PF13604 | AAA_30 | 10.70 |
PF04851 | ResIII | 9.47 |
PF12684 | DUF3799 | 4.12 |
PF13481 | AAA_25 | 1.65 |
PF14890 | Intein_splicing | 0.82 |
PF02511 | Thy1 | 0.41 |
PF01555 | N6_N4_Mtase | 0.41 |
PF08774 | VRR_NUC | 0.41 |
COG ID | Name | Functional Category | % Frequency in 243 Family Scaffolds |
---|---|---|---|
COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 0.41 |
COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 0.41 |
COG1351 | Thymidylate synthase ThyX, FAD-dependent family | Nucleotide transport and metabolism [F] | 0.41 |
COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 0.41 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 93.83 % |
Unclassified | root | N/A | 6.17 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000882|FwDRAFT_10000366 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 13544 | Open in IMG/M |
3300001213|JGIcombinedJ13530_107603040 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 602 | Open in IMG/M |
3300002402|B570J29627_1023926 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 505 | Open in IMG/M |
3300002835|B570J40625_100083521 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 4101 | Open in IMG/M |
3300002835|B570J40625_100242147 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 1892 | Open in IMG/M |
3300003277|JGI25908J49247_10033531 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1434 | Open in IMG/M |
3300003413|JGI25922J50271_10003217 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 4689 | Open in IMG/M |
3300003499|JGI25930J51415_1081670 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 537 | Open in IMG/M |
3300004481|Ga0069718_14826709 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 713 | Open in IMG/M |
3300005525|Ga0068877_10000364 | Not Available | 38956 | Open in IMG/M |
3300005581|Ga0049081_10021350 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 2458 | Open in IMG/M |
3300005581|Ga0049081_10311213 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 541 | Open in IMG/M |
3300005582|Ga0049080_10059515 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 1315 | Open in IMG/M |
3300005662|Ga0078894_10930379 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 752 | Open in IMG/M |
3300005805|Ga0079957_1034439 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 3303 | Open in IMG/M |
3300005805|Ga0079957_1247211 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 830 | Open in IMG/M |
3300005940|Ga0073913_10001331 | All Organisms → cellular organisms → Bacteria | 3579 | Open in IMG/M |
3300005940|Ga0073913_10081813 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 546 | Open in IMG/M |
3300005943|Ga0073926_10028753 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 1036 | Open in IMG/M |
3300005943|Ga0073926_10086423 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 632 | Open in IMG/M |
3300005955|Ga0073922_1016405 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 875 | Open in IMG/M |
3300006030|Ga0075470_10092091 | All Organisms → cellular organisms → Bacteria | 910 | Open in IMG/M |
3300006030|Ga0075470_10092446 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 908 | Open in IMG/M |
3300006639|Ga0079301_1009012 | All Organisms → cellular organisms → Bacteria | 3792 | Open in IMG/M |
3300006641|Ga0075471_10025461 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 3458 | Open in IMG/M |
3300006641|Ga0075471_10227066 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 965 | Open in IMG/M |
3300006641|Ga0075471_10382670 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
3300006641|Ga0075471_10634714 | Not Available | 522 | Open in IMG/M |
3300006802|Ga0070749_10034702 | All Organisms → Viruses → Predicted Viral | 3124 | Open in IMG/M |
3300006802|Ga0070749_10179373 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 1220 | Open in IMG/M |
3300006802|Ga0070749_10581464 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 605 | Open in IMG/M |
3300006802|Ga0070749_10673799 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 554 | Open in IMG/M |
3300006802|Ga0070749_10676376 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 553 | Open in IMG/M |
3300006805|Ga0075464_10075696 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 1903 | Open in IMG/M |
3300006920|Ga0070748_1059651 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 1501 | Open in IMG/M |
3300007538|Ga0099851_1012460 | All Organisms → Viruses → Predicted Viral | 3478 | Open in IMG/M |
3300007541|Ga0099848_1005001 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 6072 | Open in IMG/M |
3300007541|Ga0099848_1049329 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 1700 | Open in IMG/M |
3300007541|Ga0099848_1274937 | Not Available | 583 | Open in IMG/M |
3300007542|Ga0099846_1011121 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 3555 | Open in IMG/M |
3300007542|Ga0099846_1160463 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 805 | Open in IMG/M |
3300007543|Ga0102853_1075040 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 614 | Open in IMG/M |
3300007559|Ga0102828_1064407 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 864 | Open in IMG/M |
3300007593|Ga0102918_1285611 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 508 | Open in IMG/M |
3300007606|Ga0102923_1172518 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 673 | Open in IMG/M |
3300007618|Ga0102896_1261873 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 533 | Open in IMG/M |
3300007642|Ga0102876_1094255 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 814 | Open in IMG/M |
3300007670|Ga0102862_1098079 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 733 | Open in IMG/M |
3300007735|Ga0104988_10906 | Not Available | 37936 | Open in IMG/M |
3300007860|Ga0105735_1078854 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 678 | Open in IMG/M |
3300007972|Ga0105745_1009059 | Not Available | 2291 | Open in IMG/M |
3300007972|Ga0105745_1146844 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 720 | Open in IMG/M |
3300007974|Ga0105747_1016486 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1985 | Open in IMG/M |
3300008107|Ga0114340_1016374 | All Organisms → Viruses → Predicted Viral | 3546 | Open in IMG/M |
3300008107|Ga0114340_1110222 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 1084 | Open in IMG/M |
3300008113|Ga0114346_1045558 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 2215 | Open in IMG/M |
3300008117|Ga0114351_1227051 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 1537 | Open in IMG/M |
3300008120|Ga0114355_1099431 | All Organisms → Viruses → Predicted Viral | 1148 | Open in IMG/M |
3300008261|Ga0114336_1038245 | All Organisms → Viruses → Predicted Viral | 4567 | Open in IMG/M |
3300008261|Ga0114336_1151155 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 1028 | Open in IMG/M |
3300008264|Ga0114353_1085774 | All Organisms → Viruses → Predicted Viral | 1719 | Open in IMG/M |
3300008266|Ga0114363_1230843 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 539 | Open in IMG/M |
3300008267|Ga0114364_1061398 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 1301 | Open in IMG/M |
3300008450|Ga0114880_1044911 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1897 | Open in IMG/M |
3300008450|Ga0114880_1090193 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 1205 | Open in IMG/M |
3300008450|Ga0114880_1264159 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 527 | Open in IMG/M |
3300008996|Ga0102831_1018819 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 2371 | Open in IMG/M |
3300009059|Ga0102830_1042648 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 1387 | Open in IMG/M |
3300009079|Ga0102814_10021421 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 3721 | Open in IMG/M |
3300009079|Ga0102814_10332345 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 827 | Open in IMG/M |
3300009085|Ga0105103_10018067 | All Organisms → Viruses → Predicted Viral | 3446 | Open in IMG/M |
3300009155|Ga0114968_10005709 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 9212 | Open in IMG/M |
3300009158|Ga0114977_10428709 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 733 | Open in IMG/M |
3300009160|Ga0114981_10103715 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 1576 | Open in IMG/M |
3300009161|Ga0114966_10347050 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 883 | Open in IMG/M |
3300009164|Ga0114975_10583011 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 597 | Open in IMG/M |
3300009165|Ga0105102_10382872 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 744 | Open in IMG/M |
3300009168|Ga0105104_10126864 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 1376 | Open in IMG/M |
3300009181|Ga0114969_10179859 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 1310 | Open in IMG/M |
3300009184|Ga0114976_10039612 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 2809 | Open in IMG/M |
3300009184|Ga0114976_10665448 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 524 | Open in IMG/M |
3300010354|Ga0129333_10342255 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 1332 | Open in IMG/M |
3300010354|Ga0129333_11353556 | Not Available | 587 | Open in IMG/M |
3300010370|Ga0129336_10251699 | All Organisms → cellular organisms → Bacteria | 993 | Open in IMG/M |
3300010370|Ga0129336_10488029 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 665 | Open in IMG/M |
3300012017|Ga0153801_1027206 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 1013 | Open in IMG/M |
3300012666|Ga0157498_1017963 | Not Available | 1107 | Open in IMG/M |
3300013005|Ga0164292_10239956 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 1268 | Open in IMG/M |
3300013005|Ga0164292_10561230 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 742 | Open in IMG/M |
3300013005|Ga0164292_10583054 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 724 | Open in IMG/M |
3300013005|Ga0164292_10732254 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 629 | Open in IMG/M |
3300014811|Ga0119960_1009867 | All Organisms → cellular organisms → Bacteria | 944 | Open in IMG/M |
3300015050|Ga0181338_1043111 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 668 | Open in IMG/M |
3300017716|Ga0181350_1097965 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 725 | Open in IMG/M |
3300017716|Ga0181350_1098408 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 723 | Open in IMG/M |
3300017722|Ga0181347_1036031 | All Organisms → Viruses → Predicted Viral | 1530 | Open in IMG/M |
3300017722|Ga0181347_1042785 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 1385 | Open in IMG/M |
3300017722|Ga0181347_1104079 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 807 | Open in IMG/M |
3300017747|Ga0181352_1019920 | All Organisms → Viruses → Predicted Viral | 2082 | Open in IMG/M |
3300017747|Ga0181352_1049886 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 1220 | Open in IMG/M |
3300017747|Ga0181352_1128128 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 681 | Open in IMG/M |
3300017754|Ga0181344_1115598 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 774 | Open in IMG/M |
3300017754|Ga0181344_1159726 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 642 | Open in IMG/M |
3300017766|Ga0181343_1051653 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 1209 | Open in IMG/M |
3300017766|Ga0181343_1061693 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 1090 | Open in IMG/M |
3300017766|Ga0181343_1137928 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 682 | Open in IMG/M |
3300017774|Ga0181358_1108282 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 988 | Open in IMG/M |
3300017784|Ga0181348_1280927 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 564 | Open in IMG/M |
3300017785|Ga0181355_1039741 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 2018 | Open in IMG/M |
3300017785|Ga0181355_1106314 | All Organisms → Viruses → Predicted Viral | 1157 | Open in IMG/M |
3300017785|Ga0181355_1166310 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 883 | Open in IMG/M |
3300019784|Ga0181359_1012356 | All Organisms → cellular organisms → Bacteria | 3087 | Open in IMG/M |
3300019784|Ga0181359_1032006 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 2034 | Open in IMG/M |
3300019784|Ga0181359_1042179 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 1767 | Open in IMG/M |
3300019784|Ga0181359_1057561 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 1492 | Open in IMG/M |
3300020141|Ga0211732_1218834 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 1091 | Open in IMG/M |
3300020151|Ga0211736_10247649 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 13063 | Open in IMG/M |
3300020172|Ga0211729_10153070 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 572 | Open in IMG/M |
3300020205|Ga0211731_11345566 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 814 | Open in IMG/M |
3300020498|Ga0208050_1000441 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 6723 | Open in IMG/M |
3300020513|Ga0208090_1004586 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 2434 | Open in IMG/M |
3300020548|Ga0208856_1004748 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 2810 | Open in IMG/M |
3300020549|Ga0207942_1013494 | All Organisms → Viruses → Predicted Viral | 1071 | Open in IMG/M |
3300020551|Ga0208360_1005204 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 2028 | Open in IMG/M |
3300020555|Ga0208358_1010378 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 1798 | Open in IMG/M |
3300020566|Ga0208222_1018931 | All Organisms → cellular organisms → Bacteria | 1367 | Open in IMG/M |
3300020570|Ga0208465_1001407 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 5130 | Open in IMG/M |
3300021312|Ga0210306_1160346 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 500 | Open in IMG/M |
3300021956|Ga0213922_1000092 | All Organisms → cellular organisms → Bacteria | 54049 | Open in IMG/M |
3300021960|Ga0222715_10000878 | Not Available | 29727 | Open in IMG/M |
3300021960|Ga0222715_10316719 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 881 | Open in IMG/M |
3300021961|Ga0222714_10004937 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 12873 | Open in IMG/M |
3300021961|Ga0222714_10053785 | All Organisms → Viruses → Predicted Viral | 2769 | Open in IMG/M |
3300021961|Ga0222714_10068810 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 2355 | Open in IMG/M |
3300021962|Ga0222713_10237602 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 1195 | Open in IMG/M |
3300021962|Ga0222713_10429045 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 807 | Open in IMG/M |
3300021962|Ga0222713_10728454 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 562 | Open in IMG/M |
3300021963|Ga0222712_10276223 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 1063 | Open in IMG/M |
3300022179|Ga0181353_1040830 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 1226 | Open in IMG/M |
3300022190|Ga0181354_1062231 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 1240 | Open in IMG/M |
3300022198|Ga0196905_1071040 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 960 | Open in IMG/M |
3300022200|Ga0196901_1268266 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 524 | Open in IMG/M |
3300022213|Ga0224500_10235688 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 669 | Open in IMG/M |
3300022407|Ga0181351_1173035 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
3300024346|Ga0244775_11360608 | Not Available | 547 | Open in IMG/M |
3300024348|Ga0244776_10075833 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 2558 | Open in IMG/M |
3300025585|Ga0208546_1022489 | All Organisms → Viruses → Predicted Viral | 1586 | Open in IMG/M |
3300025585|Ga0208546_1037575 | All Organisms → Viruses → Predicted Viral | 1174 | Open in IMG/M |
3300025646|Ga0208161_1009186 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 4220 | Open in IMG/M |
3300025647|Ga0208160_1142450 | Not Available | 587 | Open in IMG/M |
3300025655|Ga0208795_1082782 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 886 | Open in IMG/M |
3300025848|Ga0208005_1134025 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 773 | Open in IMG/M |
3300025872|Ga0208783_10309404 | Not Available | 627 | Open in IMG/M |
3300025889|Ga0208644_1139681 | All Organisms → Viruses → Predicted Viral | 1128 | Open in IMG/M |
3300025896|Ga0208916_10238010 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 790 | Open in IMG/M |
3300026931|Ga0209850_1022045 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 522 | Open in IMG/M |
3300027114|Ga0208009_1027273 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 1221 | Open in IMG/M |
3300027213|Ga0208555_1011880 | All Organisms → Viruses → Predicted Viral | 1367 | Open in IMG/M |
3300027393|Ga0209867_1057926 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 584 | Open in IMG/M |
3300027608|Ga0208974_1022793 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 1930 | Open in IMG/M |
3300027656|Ga0209357_1093730 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 860 | Open in IMG/M |
3300027659|Ga0208975_1009349 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 3423 | Open in IMG/M |
3300027733|Ga0209297_1020721 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 3131 | Open in IMG/M |
3300027733|Ga0209297_1064152 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 1632 | Open in IMG/M |
3300027733|Ga0209297_1090180 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 1325 | Open in IMG/M |
3300027734|Ga0209087_1096400 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 1261 | Open in IMG/M |
3300027746|Ga0209597_1398887 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 502 | Open in IMG/M |
3300027759|Ga0209296_1069257 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 1774 | Open in IMG/M |
3300027797|Ga0209107_10005126 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 7335 | Open in IMG/M |
3300027806|Ga0209985_10000587 | Not Available | 38970 | Open in IMG/M |
3300027808|Ga0209354_10227513 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 752 | Open in IMG/M |
3300027808|Ga0209354_10381150 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 551 | Open in IMG/M |
3300027940|Ga0209893_1000876 | All Organisms → cellular organisms → Bacteria | 2849 | Open in IMG/M |
3300027969|Ga0209191_1003601 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 9175 | Open in IMG/M |
3300027972|Ga0209079_10102806 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 976 | Open in IMG/M |
3300027973|Ga0209298_10046550 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 2032 | Open in IMG/M |
3300027974|Ga0209299_1021491 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 2897 | Open in IMG/M |
3300028420|Ga0210366_10511878 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 521 | Open in IMG/M |
3300031707|Ga0315291_10419593 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1266 | Open in IMG/M |
3300031707|Ga0315291_10572793 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 1030 | Open in IMG/M |
3300031707|Ga0315291_10714393 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 887 | Open in IMG/M |
3300031746|Ga0315293_10187839 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1706 | Open in IMG/M |
3300031758|Ga0315907_10340589 | All Organisms → cellular organisms → Bacteria | 1222 | Open in IMG/M |
3300031758|Ga0315907_11245466 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 518 | Open in IMG/M |
3300031784|Ga0315899_10002710 | Not Available | 19482 | Open in IMG/M |
3300031784|Ga0315899_11691890 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 520 | Open in IMG/M |
3300031787|Ga0315900_10611641 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 794 | Open in IMG/M |
3300031787|Ga0315900_10837707 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 628 | Open in IMG/M |
3300031857|Ga0315909_10075333 | All Organisms → Viruses → Predicted Viral | 3002 | Open in IMG/M |
3300031857|Ga0315909_10271623 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 1286 | Open in IMG/M |
3300031857|Ga0315909_10438700 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 922 | Open in IMG/M |
3300031857|Ga0315909_10973838 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 515 | Open in IMG/M |
3300031873|Ga0315297_10790644 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 791 | Open in IMG/M |
3300031885|Ga0315285_10181526 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1705 | Open in IMG/M |
3300031885|Ga0315285_10269304 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 1300 | Open in IMG/M |
3300031885|Ga0315285_10620638 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 712 | Open in IMG/M |
3300031951|Ga0315904_10020100 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 8049 | Open in IMG/M |
3300031951|Ga0315904_10322049 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 1438 | Open in IMG/M |
3300031951|Ga0315904_10811887 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 768 | Open in IMG/M |
3300031951|Ga0315904_11219806 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 576 | Open in IMG/M |
3300031952|Ga0315294_10252037 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1722 | Open in IMG/M |
3300031963|Ga0315901_10538631 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 900 | Open in IMG/M |
3300032050|Ga0315906_10649803 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 857 | Open in IMG/M |
3300032092|Ga0315905_10785284 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 831 | Open in IMG/M |
3300032093|Ga0315902_10943460 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 657 | Open in IMG/M |
3300032116|Ga0315903_10319994 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 1300 | Open in IMG/M |
3300032116|Ga0315903_10419850 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 1082 | Open in IMG/M |
3300032164|Ga0315283_11321873 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 746 | Open in IMG/M |
3300032173|Ga0315268_10309159 | All Organisms → Viruses → Predicted Viral | 1532 | Open in IMG/M |
3300032256|Ga0315271_10185242 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 1657 | Open in IMG/M |
3300033233|Ga0334722_10018822 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 5967 | Open in IMG/M |
3300033418|Ga0316625_101332836 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 668 | Open in IMG/M |
3300033418|Ga0316625_101388113 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 657 | Open in IMG/M |
3300033980|Ga0334981_0079550 | All Organisms → cellular organisms → Bacteria | 1650 | Open in IMG/M |
3300033981|Ga0334982_0008026 | All Organisms → cellular organisms → Bacteria | 6366 | Open in IMG/M |
3300033981|Ga0334982_0077935 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 1780 | Open in IMG/M |
3300033981|Ga0334982_0090222 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 1629 | Open in IMG/M |
3300033995|Ga0335003_0348827 | Not Available | 649 | Open in IMG/M |
3300033996|Ga0334979_0201088 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 1175 | Open in IMG/M |
3300033996|Ga0334979_0331247 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 857 | Open in IMG/M |
3300033996|Ga0334979_0677174 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 540 | Open in IMG/M |
3300034012|Ga0334986_0081910 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 1969 | Open in IMG/M |
3300034012|Ga0334986_0425434 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 669 | Open in IMG/M |
3300034061|Ga0334987_0499967 | Not Available | 741 | Open in IMG/M |
3300034063|Ga0335000_0000057 | All Organisms → cellular organisms → Bacteria | 81639 | Open in IMG/M |
3300034064|Ga0335001_0624066 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 565 | Open in IMG/M |
3300034068|Ga0334990_0307476 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 861 | Open in IMG/M |
3300034102|Ga0335029_0002150 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 15723 | Open in IMG/M |
3300034102|Ga0335029_0067153 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 2590 | Open in IMG/M |
3300034102|Ga0335029_0191310 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 1366 | Open in IMG/M |
3300034104|Ga0335031_0065229 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 2606 | Open in IMG/M |
3300034104|Ga0335031_0126333 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 1785 | Open in IMG/M |
3300034104|Ga0335031_0309899 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 1023 | Open in IMG/M |
3300034106|Ga0335036_0233183 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 1256 | Open in IMG/M |
3300034106|Ga0335036_0240517 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 1231 | Open in IMG/M |
3300034109|Ga0335051_0261782 | All Organisms → cellular organisms → Bacteria | 848 | Open in IMG/M |
3300034117|Ga0335033_0100672 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 1670 | Open in IMG/M |
3300034200|Ga0335065_0388448 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 859 | Open in IMG/M |
3300034280|Ga0334997_0114840 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 1805 | Open in IMG/M |
3300034283|Ga0335007_0372767 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 904 | Open in IMG/M |
3300034284|Ga0335013_0157848 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 1537 | Open in IMG/M |
3300034284|Ga0335013_0422671 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 815 | Open in IMG/M |
3300034284|Ga0335013_0755572 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 548 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 14.40% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 13.99% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 12.35% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 8.23% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 7.00% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 6.17% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 5.35% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 4.12% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 3.70% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 3.29% |
Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 3.29% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 2.47% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 2.06% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.65% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.65% |
Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 1.65% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 1.23% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.23% |
Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.41% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 0.41% |
Freshwater, Surface Ice | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Surface Ice | 0.41% |
Freshwater And Marine | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater And Marine | 0.41% |
Aquatic | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Aquatic | 0.41% |
Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.41% |
Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.41% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.41% |
Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.41% |
Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.82% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.82% |
Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.82% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000882 | Freshwater microbial communities from the Columbia River | Environmental | Open in IMG/M |
3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
3300002402 | Freshwater microbial communities from Lake Mendota, WI - 13SEP2009 deep hole epilimnion | Environmental | Open in IMG/M |
3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
3300003413 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD | Environmental | Open in IMG/M |
3300003499 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN | Environmental | Open in IMG/M |
3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
3300005525 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG | Environmental | Open in IMG/M |
3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
3300005940 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_25-Nov-14 | Environmental | Open in IMG/M |
3300005943 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_4-Nov-14 | Environmental | Open in IMG/M |
3300005955 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T2_23-Sept-14 | Environmental | Open in IMG/M |
3300006030 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA | Environmental | Open in IMG/M |
3300006639 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 | Environmental | Open in IMG/M |
3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
3300007543 | Estuarine microbial communities from the Columbia River estuary - metaG 1370B-3 | Environmental | Open in IMG/M |
3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
3300007593 | Estuarine microbial communities from the Columbia River estuary - metaG 1563A-3 | Environmental | Open in IMG/M |
3300007606 | Estuarine microbial communities from the Columbia River estuary - metaG 1569-02 | Environmental | Open in IMG/M |
3300007618 | Estuarine microbial communities from the Columbia River estuary - metaG 1554A-02 | Environmental | Open in IMG/M |
3300007642 | Estuarine microbial communities from the Columbia River estuary - metaG 1548A-3 | Environmental | Open in IMG/M |
3300007670 | Estuarine microbial communities from the Columbia River estuary - metaG 1449C-3 | Environmental | Open in IMG/M |
3300007735 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea ? 2014Oct | Environmental | Open in IMG/M |
3300007860 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1372A_3um | Environmental | Open in IMG/M |
3300007972 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460ABC_3.0um | Environmental | Open in IMG/M |
3300007974 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um | Environmental | Open in IMG/M |
3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
3300008117 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
3300008261 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA | Environmental | Open in IMG/M |
3300008264 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-53-LTR | Environmental | Open in IMG/M |
3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
3300008996 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 | Environmental | Open in IMG/M |
3300009059 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703 | Environmental | Open in IMG/M |
3300009079 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 | Environmental | Open in IMG/M |
3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
3300012017 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m | Environmental | Open in IMG/M |
3300012666 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Surface Ice version 2 | Environmental | Open in IMG/M |
3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
3300014811 | Aquatic viral communities from ballast water - Michigan State University - AB_ballast water | Environmental | Open in IMG/M |
3300015050 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
3300020498 | Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020513 | Freshwater microbial communities from Lake Mendota, WI - 20JUL2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020548 | Freshwater microbial communities from Lake Mendota, WI - 13JUL2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020549 | Freshwater microbial communities from Lake Mendota, WI - 12OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020551 | Freshwater microbial communities from Lake Mendota, WI - 27JUL2010 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
3300020555 | Freshwater microbial communities from Lake Mendota, WI - 10AUG2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020566 | Freshwater microbial communities from Lake Mendota, WI - 13SEP2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020570 | Freshwater microbial communities from Lake Mendota, WI - 31AUG2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300021312 | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1072 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021956 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MG | Environmental | Open in IMG/M |
3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
3300022213 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_4_1 | Environmental | Open in IMG/M |
3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
3300025585 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025646 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
3300025647 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
3300025655 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
3300025848 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025872 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300026931 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T2_23-Sept-14 (SPAdes) | Environmental | Open in IMG/M |
3300027114 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16 (SPAdes) | Environmental | Open in IMG/M |
3300027213 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-3 (SPAdes) | Environmental | Open in IMG/M |
3300027393 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_4-Nov-14 (SPAdes) | Environmental | Open in IMG/M |
3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027656 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027746 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
3300027806 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG (SPAdes) | Environmental | Open in IMG/M |
3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
3300027940 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T3_25-Nov-14 (SPAdes) | Environmental | Open in IMG/M |
3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027972 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 (SPAdes) | Environmental | Open in IMG/M |
3300027973 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027974 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300028420 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.641 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300031873 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0 | Environmental | Open in IMG/M |
3300031885 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36 | Environmental | Open in IMG/M |
3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
3300031952 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40 | Environmental | Open in IMG/M |
3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
3300032164 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0 | Environmental | Open in IMG/M |
3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
3300032256 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_top | Environmental | Open in IMG/M |
3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
3300033418 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A | Environmental | Open in IMG/M |
3300033980 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME09Aug2015-rr0007 | Environmental | Open in IMG/M |
3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
3300033995 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056 | Environmental | Open in IMG/M |
3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
3300034063 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Oct2008D10-rr0053 | Environmental | Open in IMG/M |
3300034064 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME14Nov2013-rr0054 | Environmental | Open in IMG/M |
3300034068 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Apr2016-rr0031 | Environmental | Open in IMG/M |
3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
3300034109 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME26Aug2009-rr0158 | Environmental | Open in IMG/M |
3300034117 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jun2014-rr0124 | Environmental | Open in IMG/M |
3300034200 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190 | Environmental | Open in IMG/M |
3300034280 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME10Aug2009-rr0048 | Environmental | Open in IMG/M |
3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
3300034284 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
FwDRAFT_1000036610 | 3300000882 | Freshwater And Marine | MHDPMNTALTIMGMAVLLPLCVIAGIYVGHSLTIRSQQTKTNEQNNRSL* |
JGIcombinedJ13530_1076030401 | 3300001213 | Wetland | MRDRMNTALTIMGMAILLPLCVIAGIYVGHSLTIKSQQTNDKQNNRSL* |
B570J29627_10239261 | 3300002402 | Freshwater | NTALTIVSMAVLMPLCVIAGVYVGHTLTIKSQQTKTNEQNNRSL* |
B570J40625_1000835215 | 3300002835 | Freshwater | MLDCMNTVITIVCMAVLMPLCVIAGVYVGHSLTIKSQNTKTNEQNNRSL* |
B570J40625_1002421473 | 3300002835 | Freshwater | MNTALTIMGMAILLPLCVIAGIYVGHSLTIKSQQTKTNEQK* |
JGI25908J49247_100335312 | 3300003277 | Freshwater Lake | MNTVITIVCMAVLLPLCVIAGIYVGHSITIKSQQTKTNEQNNRSL* |
JGI25922J50271_100032175 | 3300003413 | Freshwater Lake | MLDCMNTVITIVCMAVLMPLCVIAGIYVGHSLTIKSQNTKTNEQNNRSL* |
JGI25930J51415_10816701 | 3300003499 | Freshwater Lake | VITIVCMAVLMPLCVIAGIYVGHSLTIKSQNTKTNEQNNRSL* |
Ga0069718_148267092 | 3300004481 | Sediment | MNTALTIMGMAILLPLCVIAGIYVGHSLTIKSQQTNDKQNNRSL* |
Ga0068877_1000036437 | 3300005525 | Freshwater Lake | MRDNMNTALTIVSMAVLMPLCVIAGIYVGHTLTIKSQKTTTNEQSNRNRM* |
Ga0049081_100213502 | 3300005581 | Freshwater Lentic | MRDPMNTVITIVCMAVLLPFCVIAGIYVGHSLTIRSQQTKTNEQNNRSL* |
Ga0049081_103112132 | 3300005581 | Freshwater Lentic | MNTALTSMGMAILLPLCVIAGSYVGHSLTIKSQQTNDKQNNRSL* |
Ga0049080_100595155 | 3300005582 | Freshwater Lentic | MNTVITIVCMAVLLPLCVIAGIYVGHSITIKSQTNETKTKNEL* |
Ga0078894_109303793 | 3300005662 | Freshwater Lake | CMAVLMPLCVIAGIYVGHSLTIKSQNTKTNEQNNRSL* |
Ga0079957_10344393 | 3300005805 | Lake | MSTALTIVSMAVLMPLCVIAGIYVGHTLTIKSQKTTINEQSNRNRM* |
Ga0079957_12472112 | 3300005805 | Lake | MNTALTIISMAVLMPLCVIAGIYVGHTLTIKSQQTTTNEQSNRNRM* |
Ga0073913_100013314 | 3300005940 | Sand | MLDPMNTALTIMGMAVLLPLCVIAGIYVGHSLTIRSQQTKTNEQNNRSL* |
Ga0073913_100818131 | 3300005940 | Sand | GTWMLDPMNTALTIMGMAVLLPLCVIAGIYVGHSITIKSQTNETKTKNEL* |
Ga0073926_100287532 | 3300005943 | Sand | MLDPMNTVITIVCMAVLMPLCVIAGIYVGHSLTIKSQNTKTNEQNNRSL* |
Ga0073926_100864233 | 3300005943 | Sand | WMLDPMNTALTIMGMAVLLPLCVIAGIYVGHSITIKSQTNETKTKNEL* |
Ga0073922_10164051 | 3300005955 | Sand | NTVITIVCMAVLLPLCVIAGIYVGHSITIKSQQTKTNEQNNRSL* |
Ga0075470_100920912 | 3300006030 | Aqueous | MNTALTIISMAALMPLCVIAGIYVGHTLTIRSQQTKTNEQNNRSL* |
Ga0075470_100924462 | 3300006030 | Aqueous | MSTALTIISMAVLMPLCVIAGIYVGHTLTIKSQQTTTNEQSNRNRM* |
Ga0079301_10090125 | 3300006639 | Deep Subsurface | MSTALTIISMAALMPLCVIAGIYVGHTLTIKSQNTKTNEQSNRNLM* |
Ga0075471_100254616 | 3300006641 | Aqueous | MNTVITIVCMAVLMPLCVIAGIYVGHSLTIKSQNTKTNEQKNNNRL* |
Ga0075471_102270662 | 3300006641 | Aqueous | MSTALTIISMAVLMPLCVIAGIYVGHTLTILTIKSQQTTTNEQSNRNRM* |
Ga0075471_103826702 | 3300006641 | Aqueous | MSTALTIISMAALMPICVIAGIYVGHRITIKSQQTTNEQSNRNRM* |
Ga0075471_106347142 | 3300006641 | Aqueous | MNTALTIISMAVLMPLCVIAGIYVGHTLTIRSQQTTTNEQSNRNRM* |
Ga0070749_100347022 | 3300006802 | Aqueous | MSTALTIISMAVLMPLCVIAGIYVGHTLTIKSQNTKTNDKQNNRSL* |
Ga0070749_101793732 | 3300006802 | Aqueous | MNTALTIMGMAILLPLCVIAGIYVGHSLTIKSQQTNDKQNDRSL* |
Ga0070749_105814642 | 3300006802 | Aqueous | MLDCMNTVITIVCMAVLMPLCVIAGIYVGHSLTIKSQQTNDKQN |
Ga0070749_106737992 | 3300006802 | Aqueous | MSTALTIISLAALMPLCVIAGIYVGHTLTIKSQNTKTNEQSNRNRM* |
Ga0070749_106763762 | 3300006802 | Aqueous | MNTALTIVSMAVLMPLCVIAGIYVGHTLTIKSQKTTTNEQSNRNRM* |
Ga0075464_100756963 | 3300006805 | Aqueous | MLDPMNTALTIMGMAVLLPFCVIAGIYVGHSITIRSQQTKTNEQNNRSL* |
Ga0070748_10596512 | 3300006920 | Aqueous | MNTVITIVCMAVMLPFCVIAGIYVGHSLTIRSQQTKTNEQNNRSL* |
Ga0099851_10124605 | 3300007538 | Aqueous | MSTALTIISMAVLMPLCVIAGIYVGHTLTIKSQQTTNEQSNRNRM* |
Ga0099848_100500115 | 3300007541 | Aqueous | MNTALTIISMAVLMPLCVIAGIYVGHSLTIKSQKTTTNEQSNRNRM* |
Ga0099848_10493292 | 3300007541 | Aqueous | MNTAITIMGMAILLPLCVIAGIYVGHSLTIKSQQTNDKQNDRSL* |
Ga0099848_12749371 | 3300007541 | Aqueous | TIMGMAILLPLCVIAGIYVGHSLTIKSQQTKTNEQK* |
Ga0099846_10111211 | 3300007542 | Aqueous | MSTALTIISMAVLIPLCVIAGIYVGHTLTIKSQQTTNEQSNRNRM* |
Ga0099846_11604632 | 3300007542 | Aqueous | MSTALTIISMAVLMPLCVIAGIYVGHSLTIKSQKTTTNEQSNRNRM* |
Ga0102853_10750401 | 3300007543 | Estuarine | MNTALTIMGMAVLLPLCVIAGIYVGHSLTIRSQQTKTNEQNNRSL* |
Ga0102828_10644072 | 3300007559 | Estuarine | MNTVITIVCMAVLMPLCVIAGIYVDHSLTIKSQNTKTNEQNNRSL* |
Ga0102918_12856111 | 3300007593 | Estuarine | MNTALTIMGMAILLPFCVIAGIYVGHSITIKSQQTKTNEQNNRSL* |
Ga0102923_11725181 | 3300007606 | Estuarine | VLQGTWMRDPMNTALTIMGMAVLLPLCVIAGIYVGHSLTIRSQQTKTNEQNNRSL* |
Ga0102896_12618732 | 3300007618 | Estuarine | MNTALTIMGMAVLLPLCVIAGIYVGHSITIKSQTN |
Ga0102876_10942552 | 3300007642 | Estuarine | MLDPMNTALTIMGMAVLLPLCVIAGIYVGHSLTIKSQQTKTNEQNNRSL* |
Ga0102862_10980792 | 3300007670 | Estuarine | MNTVITIVCMAVLMPLCVIAGIYVGHSLTIKSQNTKTNEQNNRSL* |
Ga0104988_1090623 | 3300007735 | Freshwater | MSTALTIISMAALMPICVIAGIYVGHTLTIKSQQTTNEQSNRNRM* |
Ga0105735_10788542 | 3300007860 | Estuary Water | MLDPMNTALTIMGMAVLLPFCVIAGIYVGHSLTIKSQQTKTNEQNNRSL* |
Ga0105745_10090591 | 3300007972 | Estuary Water | MLNPMNTALTIMGMAVLLPLCVIAGIYVGHSLTIKSQQTKTK* |
Ga0105745_11468441 | 3300007972 | Estuary Water | MNTVITIVCMAVLLPLCVIAGIYVGHSLTIKSQQTKTNEQNNRSL* |
Ga0105747_10164861 | 3300007974 | Estuary Water | MKTVITIVCMAVLLPLCVIAGIYVGHSLTIKSQQTKTNEQNNRSL* |
Ga0114340_10163745 | 3300008107 | Freshwater, Plankton | MNTVITIVCMAVLMPLCVIAGIYVGHSLTIKSQNTKTNEQQNNRSL* |
Ga0114340_11102222 | 3300008107 | Freshwater, Plankton | MNTVITIVCMAVLMPLCVIAGIYVGHSITIKSQNTKTNEQNNRSL* |
Ga0114346_10455582 | 3300008113 | Freshwater, Plankton | MSTALTIISMAALMPLCVIAGIYVGHTLTIKSQNTKTNEQSNRNRM* |
Ga0114351_12270512 | 3300008117 | Freshwater, Plankton | MLQGTWLLNPMNTALTIMGMAILLPLCVIAGIYVGHSLTIKSQQTNDKQNNRSL* |
Ga0114355_10994312 | 3300008120 | Freshwater, Plankton | MSTALTIVSMAVLMPLCVIAGIYVGHTLTIKSQKITTNEQSNRNRM* |
Ga0114336_10382452 | 3300008261 | Freshwater, Plankton | MNTALTIMGMAVLLPLCVIAGIYVGHSLTIKSQQTNDKQNNRSL* |
Ga0114336_11511551 | 3300008261 | Freshwater, Plankton | LLDPMNTALTIMGMAILLPLCVIAGIYVGHSLTIKSQQTNDKQNNRSL* |
Ga0114353_10857741 | 3300008264 | Freshwater, Plankton | ALTIMGMAILLPLCVIAGIYVGHSLTIKSQQTNDKQNNRSL* |
Ga0114363_12308432 | 3300008266 | Freshwater, Plankton | MNTALTIMGMAILLPLCVIAGIYVGHSLTIKSQQTNDK |
Ga0114364_10613981 | 3300008267 | Freshwater, Plankton | MSTALTIISMAILLPLCVIAGIYVGHSLTIKSQQTNDKQNNRSL* |
Ga0114880_10449111 | 3300008450 | Freshwater Lake | MNTVITIVCMAVLMPLCVIAGIYVGHSLTIKSQNTKTN |
Ga0114880_10901932 | 3300008450 | Freshwater Lake | MNTALTIMGMAILLPLCVIAGIYVGHSLTIKSQQT |
Ga0114880_12641592 | 3300008450 | Freshwater Lake | MNTALTIMGMAILLPLCVIAGIYVGHSLTIKSQQTND |
Ga0102831_10188197 | 3300008996 | Estuarine | MNTALTIMGMAILLPLCVIAGIYVGHSLTIKSQNTKTNEQQNNRSL* |
Ga0102830_10426483 | 3300009059 | Estuarine | MLDPMNTVITIVCMAVLMPLCVIAGIYVGHSLTIKSQN |
Ga0102814_100214211 | 3300009079 | Estuarine | MLDPMNTVITIVCMAVLMPLCVIAGIYVGHSLTIKS |
Ga0102814_103323452 | 3300009079 | Estuarine | MNTALTIMGMAVLLPLCVIAGIYVGHSLTIKSQQTKTNE |
Ga0105103_100180675 | 3300009085 | Freshwater Sediment | MSTALTIVSMAVLMPLCVIAGVYVGHTLTIKSQQTKTNEQNNRSL* |
Ga0114968_100057091 | 3300009155 | Freshwater Lake | MNTALTIMGMAVMLPFCVIAGIYVGHSLTIRSQQTKTNEQNNRSL* |
Ga0114977_104287091 | 3300009158 | Freshwater Lake | MNTVITIVCMAVLLPFCVIAGIYVGHSLTIKSQTNETKTKNEL* |
Ga0114981_101037151 | 3300009160 | Freshwater Lake | MNTVITIVCMAVLLPFCVIAGIYVGHSLTIKSQQTKTNEQNNRSL* |
Ga0114966_103470502 | 3300009161 | Freshwater Lake | MNTVITIMGMAVLLPLCVIAGIYVGHSLTIRSQQTKTNEQNNRSV* |
Ga0114975_105830112 | 3300009164 | Freshwater Lake | MNTALTIMGMAVLLPLCVIAGIYVGHSLTIKSQQTKTNEQNNRSL* |
Ga0105102_103828722 | 3300009165 | Freshwater Sediment | MLNRMSTALTIVSMAVLMPLCVIAGIYVGHTLTIKSQQTKTNEQNNRSL* |
Ga0105104_101268642 | 3300009168 | Freshwater Sediment | MSTALTIVSMAVLMPLCVIAGVYVGHSLTIKSQQTKTNEQNNRSL* |
Ga0114969_101798592 | 3300009181 | Freshwater Lake | MNTVITIVCMAVLLPFCVIAGIYVGHSLTIRSQQTKTNEQNNRSL* |
Ga0114976_100396121 | 3300009184 | Freshwater Lake | MLDPMNTVITIVCMAVLLPLCVIAGIYVGHSLTIKSQQTKTNEQNNRSL* |
Ga0114976_106654482 | 3300009184 | Freshwater Lake | MNTALTIMGMAVLLPLCVIAGIYVGHSLTIKSQQTKT |
Ga0129333_103422552 | 3300010354 | Freshwater To Marine Saline Gradient | MSTALTIISMAALMPLCVIAGIYVGHTLTIRSQQTKTNEQNNRSL* |
Ga0129333_113535562 | 3300010354 | Freshwater To Marine Saline Gradient | MNTALTIISMAVLMPLCVIAGIYVGHTLTIKSQQTTNEQSNRNRM* |
Ga0129336_102516992 | 3300010370 | Freshwater To Marine Saline Gradient | MSTALTIISMAVLMPLCVIAGIYVGHTLTIKSQQTTNEQNNRSL* |
Ga0129336_104880293 | 3300010370 | Freshwater To Marine Saline Gradient | TIISMAVLMPLCVIAGIYVGHTLTIKSQQTTNEQSNRNRM* |
Ga0153801_10272062 | 3300012017 | Freshwater | MNTVITIVCMAVLLPLCVIAGIYVGHSLTIKSQQTKTK* |
Ga0157498_10179631 | 3300012666 | Freshwater, Surface Ice | NTVITIVCMAVLLPLCVIAGIYVGHSLTIKSQQTKTK* |
Ga0164292_102399565 | 3300013005 | Freshwater | PMNTALTIMGMAILLPLCVIAGIYVGHSLTIKSQQTNDKQNDRSL* |
Ga0164292_105612301 | 3300013005 | Freshwater | GTWMLDCMNTVITIVCMAVLMPLCVIAGIYVGHSLTIKSQNTKTNEQNNRSL* |
Ga0164292_105830542 | 3300013005 | Freshwater | MNTALTIMGMAVLLPLCVIAGIYVGHSHTIKSQQT |
Ga0164292_107322541 | 3300013005 | Freshwater | PMNTALTIMGMAILLPLCVIAGIYVGHSLTIKSQQTNDKQNNRSL* |
Ga0119960_10098672 | 3300014811 | Aquatic | MSTALTIISMAVLMPLCVIAGIYVGHTLTIKSQQTKTK* |
Ga0181338_10431111 | 3300015050 | Freshwater Lake | VLQGTWMFDPMNTVITIVCMAVLLPFCVIAGIYVGHSLTIKSQQTKTNEQNNRSL* |
Ga0181350_10979653 | 3300017716 | Freshwater Lake | LDPMNTALTIMGMAVLLPLCVIAGIYVGHSITIKSQTNETKTKNEL |
Ga0181350_10984082 | 3300017716 | Freshwater Lake | MRDSMNTALTIMGMAVLLPLCVIAGIYVGHSITIKSQT |
Ga0181347_10360311 | 3300017722 | Freshwater Lake | QMLQGTWLLDPMNTALTIMGMAILLPLCVIAGIYVGHSLTIKSQQTNDKQNNRSL |
Ga0181347_10427851 | 3300017722 | Freshwater Lake | AVLLPLCVIAGIYVGHSITIKSQQTKTNEQNNRSL |
Ga0181347_11040792 | 3300017722 | Freshwater Lake | MRDHMNTALTIMGMAVLLPLCVIAGIYVGHSITIKSQTNETKTKNEL |
Ga0181352_10199209 | 3300017747 | Freshwater Lake | MSTALTIISMAALMPLCVIAGIYVGHRITIKSQQTTNEQSNRNRM |
Ga0181352_10498861 | 3300017747 | Freshwater Lake | NTALTIMGMAILLPLCVIAGIYVGHSLTIKSQQTNDKQNNRSN |
Ga0181352_11281281 | 3300017747 | Freshwater Lake | MNTALTIMGMAILLPLCVIAGIYVGHSLTIKSQQTNDKQNN |
Ga0181344_11155982 | 3300017754 | Freshwater Lake | MNTALTIIGMAILLPLCVIAGIYVGHSLTIKSQQTNDKQNNRSL |
Ga0181344_11597261 | 3300017754 | Freshwater Lake | SMAAMMPLCVIAGIYVGHTLTIKSQQKTNEQSNRNRM |
Ga0181343_10516532 | 3300017766 | Freshwater Lake | MFDPMNTALTIMGMAVLLPLCVIAGIYVGHSLTIRSQQTKTNEQNNRSL |
Ga0181343_10616935 | 3300017766 | Freshwater Lake | VCMAVLMPLCVIAGIYVGHSLTIKSQNTKTNEQNNRSL |
Ga0181343_11379281 | 3300017766 | Freshwater Lake | GALTIMGMAILLPLCVIAGIYVGHSLTIKSQQTNDKKNNRSL |
Ga0181358_11082822 | 3300017774 | Freshwater Lake | MSTALTIISMAVLMPLCVIAGIYVGHTLTIKSQQTKTNEQSNRNRM |
Ga0181348_12809272 | 3300017784 | Freshwater Lake | MNTVITIVCMAVLLPLCVIAGIYVGHSITIKSQTNETKTKNEL |
Ga0181355_10397413 | 3300017785 | Freshwater Lake | MSIALTIISMAVLMPLCVIAGIYVGHTLTIKSQNT |
Ga0181355_11063142 | 3300017785 | Freshwater Lake | MPLRMSTALTIISMAALMPLCVIAGIYVGHTLTIRSQNTKTNEQSNRNRM |
Ga0181355_11663102 | 3300017785 | Freshwater Lake | MNTALTIISMAVLMPLCVIAGIYVGHTLTIKSQQTTTNEQSNRNRM |
Ga0181359_10123564 | 3300019784 | Freshwater Lake | MNTVITIVCMAVLLPLCVIAGIYVGHSITIKSQQTKTNEQNNRSL |
Ga0181359_10320062 | 3300019784 | Freshwater Lake | MNTALTIMGMAVLLPLCVIAGIYVGHSLTIRSQQTKTK |
Ga0181359_10421797 | 3300019784 | Freshwater Lake | MSTALTIISMAVLMPLCVIAGIYVGHTLTIKSQNTKTNEQSNRNRM |
Ga0181359_10575611 | 3300019784 | Freshwater Lake | MLDCMNTVITIVCMAVLMPLCVIAGIYVGHSLTIK |
Ga0211732_12188342 | 3300020141 | Freshwater | MFDPMSTALTIMGMAILLPFCVIAGIYVGHSLTIRSQQTNENKPNNSRL |
Ga0211736_102476497 | 3300020151 | Freshwater | MFDPMSTALTIMGMAILLPFCVIAGIYVGHSLTIRSQQTNENKPNNSRM |
Ga0211729_101530702 | 3300020172 | Freshwater | MSTALTIMGMAILLPFCVIAGIYVGHSLTIRSQQTNENKPNNSRL |
Ga0211731_113455664 | 3300020205 | Freshwater | MFDPMSTALTIMGMAILLPFCVIAGIYVGHSLTIKSQQTKTNEQNNSRL |
Ga0208050_10004416 | 3300020498 | Freshwater | MPLRMSTALTIVSMAVLMPLCVIAGVYVGHTLTIKSQQTKTNEQNNRSL |
Ga0208090_10045862 | 3300020513 | Freshwater | MLDCMNTVITIVCMAVLMPLCVIAGVYVGHSLTIKSQNTKTNEQNNRSL |
Ga0208856_100474810 | 3300020548 | Freshwater | MLDPMNTALTIMGMAVLLPLCVIAGIYVGHSLTIRSQQTKTNEQNNRSL |
Ga0207942_10134941 | 3300020549 | Freshwater | MLNRMSTALTIVSMAVLMPLCVIAGIYVGHTLTIKSQQTKTNEQNNRSL |
Ga0208360_10052048 | 3300020551 | Freshwater | RMPLRMSTALTIVSMAVLMPLCVIAGVYVGHTLTIKSQQTKTNEQNNRSL |
Ga0208358_10103787 | 3300020555 | Freshwater | MNTVITIVCMAVLMPLCVIAGIYVGHSLTIKSQNTKTNEQNNRSL |
Ga0208222_10189312 | 3300020566 | Freshwater | MLYCMNTALTIVSMAVLMPLCVIAGVYVGHTLTIKSQQTKTNEQNNRSL |
Ga0208465_10014075 | 3300020570 | Freshwater | MNTALTIMGMAILLPLCVIAGIYVGHSLTIKSQQTKTNEQK |
Ga0210306_11603462 | 3300021312 | Estuarine | MLDPMNTVITIVCMAVLLPLCVIAGIYVGHSITIKSQQTKTNEQNNRSL |
Ga0213922_10000927 | 3300021956 | Freshwater | MSTALTIISMAALMPLCVIAGIYVGHTLTIKSQNNKTNEQNRNRM |
Ga0222715_1000087822 | 3300021960 | Estuarine Water | MNTALTIMGMAILLPLCVIAGIYVGHSLTIKSQQTNDKQNNRSL |
Ga0222715_103167192 | 3300021960 | Estuarine Water | MSTALTIISMAALMPICVIAGIYVGHTLTIKSQQTTNEQSNRNRM |
Ga0222714_1000493712 | 3300021961 | Estuarine Water | MNTALTIISMAVLMPLCVIAGIYVGHTLTIRSQQTKTNEQNNRSL |
Ga0222714_100537855 | 3300021961 | Estuarine Water | MLDPMNTVITIVCMAVLMPLCVIAGIYVGHSLTIKSQNTKTNEQQNNNRL |
Ga0222714_100688103 | 3300021961 | Estuarine Water | MSTALTIVSMAVLMPLCVIAGIYVGHTLTIKSQKTTTNEQSNRNRM |
Ga0222713_102376022 | 3300021962 | Estuarine Water | MSTAMTIISMAALMPLCVIAGIYVGHTLTIKSQNNKTNEQQQNRNRM |
Ga0222713_104290451 | 3300021962 | Estuarine Water | DRMNTALTIMGMAILLPLCVIAGIYVGHSLTIKSQQTNDKQNDRSL |
Ga0222713_107284542 | 3300021962 | Estuarine Water | MPLCMSTALTIVSMAVLMPLCVIAGIYVGHTLTILTIKSQQTTTNEQSNRNRM |
Ga0222712_102762232 | 3300021963 | Estuarine Water | MNTALTIMGMAVLLPLCVIAGIYVGHSITIKSQTNETKTKNEL |
Ga0181353_10408302 | 3300022179 | Freshwater Lake | MSTALTIISMAALMPLCVIAGIYVGHTLTIKSQQTKTNEQSNRNRM |
Ga0181354_10622312 | 3300022190 | Freshwater Lake | MHDPMNTALTIMGMAVLLPLCVIAGIYVGHSLTIKSQQTKTK |
Ga0196905_10710402 | 3300022198 | Aqueous | MSTALTIISMAVLMPLCVIAGIYVGHTLTILTIKSQQTTTNEQSNRNRM |
Ga0196901_12682662 | 3300022200 | Aqueous | MNTALTIMGMAILLPLCVIAGIYVGHSLTIKSQQTNDKQNDRSL |
Ga0224500_102356882 | 3300022213 | Sediment | MNTALTIISMAVLMPLCVIAGIYVGHTLTIKSQQTKTNEQSNRNRM |
Ga0181351_11730352 | 3300022407 | Freshwater Lake | MNTALTIMGMAVLLPLCVIAGIYVGHSLTIKSQQTKTK |
Ga0244775_113606082 | 3300024346 | Estuarine | MRDSMNTALTIMGMAVLLPLCVIAGIYVGHSITIKSQTNETKTKNEL |
Ga0244776_100758336 | 3300024348 | Estuarine | MFDPMNTALTIMGMAVLLPLCVIAGIYVGHSITIKSQTNETKTKNEL |
Ga0208546_10224892 | 3300025585 | Aqueous | MNTALTIISMAALMPLCVIAGIYVGHTLTIRSQQTKTNEQNNRSL |
Ga0208546_10375752 | 3300025585 | Aqueous | MSTALTIISMAVLMPLCVIAGIYVGHTLTIKSQQTTTNEQSNRNRM |
Ga0208161_10091867 | 3300025646 | Aqueous | MNTALTIISMAVLMPLCVIAGIYVGHSLTIKSQKTTTNEQSNRNRM |
Ga0208160_11424502 | 3300025647 | Aqueous | MSTALTIISMAVLMPLCVIAGIYVGHTLTIKSQQTTTNEQS |
Ga0208795_10827822 | 3300025655 | Aqueous | MSTALTIISMAVLMPLCVIAGIYVGHSLTIKSQKTTTNEQSNRNRM |
Ga0208005_11340251 | 3300025848 | Aqueous | MNTALTIISMAVLMPLCVIAGIYVGHTLTIKSQQTTNE |
Ga0208783_103094042 | 3300025872 | Aqueous | MNTALTIISMAVLMPLCVIAGIYVGHTLTIRSQQTTTNEQSNRNRM |
Ga0208644_11396814 | 3300025889 | Aqueous | MSTALTIISLAALMPLCVIAGIYVGHTLTIKSQNTKTNEQSNRNRM |
Ga0208916_102380103 | 3300025896 | Aqueous | MLDPMNTALTIMGMAVLLPFCVIAGIYVGHSITIRSQQTKTNEQNNRSL |
Ga0209850_10220451 | 3300026931 | Sand | NTVITIVCMAVLLPLCVIAGIYVGHSITIKSQQTKTNEQNNRSL |
Ga0208009_10272732 | 3300027114 | Deep Subsurface | MSTALTIISMAALMPLCVIAGIYVGHTLTIKSQNTKTNEQSNRNLM |
Ga0208555_10118806 | 3300027213 | Estuarine | IMGMAVLLPLCVIAGIYVGHSLTIRSQQTKTNEQNNRSL |
Ga0209867_10579263 | 3300027393 | Sand | PMNTALTIMGMAVLLPLCVIAGIYVGHSITIKSQTNETKTKNEL |
Ga0208974_10227932 | 3300027608 | Freshwater Lentic | MRDPMNTVITIVCMAVLLPFCVIAGIYVGHSLTIRSQQTKTNEQNNRSL |
Ga0209357_10937302 | 3300027656 | Freshwater Lake | MNTVITIVCMAVLMPLCVIAGIYVAHSLTIKSQTNETKTKNEL |
Ga0208975_10093496 | 3300027659 | Freshwater Lentic | MNTVITIVCMAVLLPLCVIAGIYVGHSLTIKSQQTKTNEQNNRSL |
Ga0209297_10207213 | 3300027733 | Freshwater Lake | MFDPMNTVITIVCMAVLLPFCVIAGIYVGHSLTVRSQQTKTNEQNNRSL |
Ga0209297_10641527 | 3300027733 | Freshwater Lake | MNTVITIVCMAVLLPFCVIAGIYVGHSLTIKSQTNETKTKNEL |
Ga0209297_10901801 | 3300027733 | Freshwater Lake | MLDPMNTVITIVCMAVLLPFCVIAGIYVGHSLTIRSQQTKTNEQNNRSL |
Ga0209087_10964002 | 3300027734 | Freshwater Lake | MLDPMNTVITIVCMAVLLPLCVIAGIYVGHSLTIRSQQTK |
Ga0209597_13988873 | 3300027746 | Freshwater Lake | GMAVLLPLCVIAGIYVGHSITIKSQTNETKTKNEL |
Ga0209296_10692572 | 3300027759 | Freshwater Lake | MFDPMNTVITIVCMAVLLPLCVIAGIYVGHSITIKSQTNETKTKNEL |
Ga0209107_100051261 | 3300027797 | Freshwater And Sediment | MHDPMNTALTIMGMAVLLPLCVIAGIYVGHSLTIKSQQTKTNEQNNRSL |
Ga0209985_1000058724 | 3300027806 | Freshwater Lake | MRDNMNTALTIVSMAVLMPLCVIAGIYVGHTLTIKSQKTTTNEQSNRNRM |
Ga0209354_102275133 | 3300027808 | Freshwater Lake | DPMNTVITIVCMAVLLPFCVIAGIYVGHSITIKSQTNETKTKNEL |
Ga0209354_103811502 | 3300027808 | Freshwater Lake | MNTALTIMGMAILLPFCVIAGIYVGHSLTIKSQQTKTK |
Ga0209893_100087610 | 3300027940 | Sand | MHDPMNTALTIMGMAVLLPLCVIAGIYVGHSLTIRSQQTKTNEQNNRSL |
Ga0209191_10036014 | 3300027969 | Freshwater Lake | MLDPMNTVITIVCMAVLLPLCVIAGIYVGHSLTIRSQQTKTNEQNNRSL |
Ga0209079_101028063 | 3300027972 | Freshwater Sediment | MSTALTIVSMAVLMPLCVIAGVYVGHTLTIKSQQTKTNEQNNRSL |
Ga0209298_100465501 | 3300027973 | Freshwater Lake | GTWMHDPMNTVITIVCMAVLLPFCVIAGIYVGHSLTIKSQQTKTNEQNNRSL |
Ga0209299_10214912 | 3300027974 | Freshwater Lake | MNTVITIVCMAVLLPFCVIAGIYVGHSLTIKSQQTKTNEQNNRSL |
Ga0210366_105118782 | 3300028420 | Estuarine | MNTALTIMGMAVLLPLCVIAGIYVGHSLTIRSQQTKTNEQNNRSL |
Ga0315291_104195931 | 3300031707 | Sediment | MNTVITIVCMAVLLPLCVIAGIYVGHSLTIKSQQTKTNEQNN |
Ga0315291_105727933 | 3300031707 | Sediment | MLNPMNTALTIMGMAVLLPLCVIAGIYVGHSITIKSQTNETKTKNEL |
Ga0315291_107143932 | 3300031707 | Sediment | MRDPMNTALTIMGMAVLLPLCVIAGIYVGHSLTIKSQQTKTNEQNNRSL |
Ga0315293_101878391 | 3300031746 | Sediment | MNTVITIVCMAVLLPLCVIAGIYVGHSLTIKSQQTKTNEQNNRS |
Ga0315907_103405891 | 3300031758 | Freshwater | MNTVITIVCMAVLMPLCVIAGIYVGHSLTIKSQNTKTNEQ |
Ga0315907_112454662 | 3300031758 | Freshwater | MSTALTIISMAALMPLCVIAGIYVGHTLTIKSQNTKTNEQSNRNRM |
Ga0315899_1000271025 | 3300031784 | Freshwater | MSTALTIISMAALMPLCVIAGIYVGHTLTIRSQQTTNEQSNRNRM |
Ga0315899_116918901 | 3300031784 | Freshwater | MSTALTIISMAALMPLCVIAGIYVGHTLTIRSQQTKTNEQNNRSL |
Ga0315900_106116412 | 3300031787 | Freshwater | MNTALTIMGMAVLLPLCVIAGIYVGHSLTIKSQQTNDKQNTR |
Ga0315900_108377072 | 3300031787 | Freshwater | MNTVLTIMGMAILLPLCVIAGIYVGHSLTIKSQQTNDKQNNRSL |
Ga0315909_100753331 | 3300031857 | Freshwater | MNTVITIVCMAVLMPLCVIAGIYVGHSLTIKSQNTKT |
Ga0315909_102716232 | 3300031857 | Freshwater | MNTALTIMGMAILLPLCVIAGIYVGHYLTIKSQQTNDKQNNRSL |
Ga0315909_104387002 | 3300031857 | Freshwater | MLDCMNTVITIVCMAVLMPLCVIAGIYVGHSITIKSQNTKTNEQNNRSL |
Ga0315909_109738382 | 3300031857 | Freshwater | MSTALTIVSMAVLMPLCVIAGIYVGHTLTIKSQKITTNEQSNRNRM |
Ga0315297_107906442 | 3300031873 | Sediment | MNTALTIMGMAVLLPLCVIAGIYVGHSLTIKSQQTKTNEQNNRSL |
Ga0315285_101815261 | 3300031885 | Sediment | MNTVITIVCMAVLLPLCVIAGIYVGHSLTIRSQQTKTNEQ |
Ga0315285_102693042 | 3300031885 | Sediment | MLDPMNTALTIMGMAVLLPLCVIAGIYVGHSLTIKSQTNETKTKNEL |
Ga0315285_106206383 | 3300031885 | Sediment | AVLLPLCVIAGIYVGHSLTIKSQQTKTNEQNNRSL |
Ga0315904_1002010019 | 3300031951 | Freshwater | MLDNMNTALTIVSMAVLMPLCVIAGIYVGHTLTIKSQKTTTNEQSNRNRM |
Ga0315904_103220497 | 3300031951 | Freshwater | QVLQGTRMPLRMSTALTIISMAALMPLCVIAGIYVGHTLTIKSQQTTNEQSNRNRM |
Ga0315904_108118872 | 3300031951 | Freshwater | MRDHMNTALTIISMAVLMPLCVIAGIYVGHTLTIKSQQTTNEQSNRNRM |
Ga0315904_112198062 | 3300031951 | Freshwater | MSTALTIISMAILLPLCVIAGIYVGHSLTIKSQQTND |
Ga0315294_102520371 | 3300031952 | Sediment | MNTVITIVCMAVLLPLCVIAGIYVGHSLTIKSQQTKTNEQN |
Ga0315901_105386312 | 3300031963 | Freshwater | MNTALTIMGMAVLLPLCVIAGIYVGHSLTIKSQQTNDKQNNRSL |
Ga0315906_106498032 | 3300032050 | Freshwater | MRDCMNTALTIMGMAILLPLCVIAGIYVGHSLTIKSQQTNDKQNDRSL |
Ga0315905_107852844 | 3300032092 | Freshwater | TIVCMAVLMPLCVIAGIYVGHSLTIKSQNTKTNEQNNRSL |
Ga0315902_109434602 | 3300032093 | Freshwater | MPLRMSTALTIISMAALMPLCVIAGIYVGHTLTIKSQQTTNEQSNRNRM |
Ga0315903_103199941 | 3300032116 | Freshwater | MRDRMNTALTIMGMAILLPLCVIAGIYVGHSLTIKSQQTNDKQN |
Ga0315903_104198501 | 3300032116 | Freshwater | TWMLDCMNTVITIVCMAVLMPLCVIAGIYVGHSLTIKSQNTKTNEQNNRSL |
Ga0315283_113218733 | 3300032164 | Sediment | MRDPMNTVITIVCMAVLLPLCVIAGIYVGHSLTIKSQQTKTNEQNNRSL |
Ga0315268_103091591 | 3300032173 | Sediment | GTWMRDPMNTALTIMGMAVLLPLCVIAGIYVGHSLTIKSQQTKTNEQNNRSL |
Ga0315271_101852422 | 3300032256 | Sediment | MNTALTIMGMAILLPFCVIAGIYVGHSLTIRSQQTKTNEQNNRSL |
Ga0334722_1001882210 | 3300033233 | Sediment | MHDPMNTALTIMGMAILLPFCVIAGIYVGHSLTIRSQQTKTNEQNNRSL |
Ga0316625_1013328361 | 3300033418 | Soil | TIISMAALMPLCVIAGIYVGHTLTIKSQQTTNEQSNRNRM |
Ga0316625_1013881132 | 3300033418 | Soil | MPLRMNTALTIISMAALMPLCVIAGIYVGHTLTIKSQNNKTNEQQQNHNRM |
Ga0334981_0079550_1120_1269 | 3300033980 | Freshwater | MLNRMSTALTIVSMAVLMPLCVIAGVYVGHTLTIKSQQTKTNEQNNRSL |
Ga0334982_0008026_4281_4418 | 3300033981 | Freshwater | MSTALTIVSMAVLMPLCVIAGIYVGHTLTIKSQQTKTNEQNNRSL |
Ga0334982_0077935_702_866 | 3300033981 | Freshwater | MLQGTWLLDPMNTALTIMGMAVLLPLCVIAGIYVGHSLTIKSQQTNDKQNNRSL |
Ga0334982_0090222_1124_1273 | 3300033981 | Freshwater | MLYCMNTVITIVCMAVLMPLCVIAGIYVGHSLTIKSQNTKTNEQNNRSL |
Ga0335003_0348827_193_321 | 3300033995 | Freshwater | MLDPMNTALTIMGMAVLLPLCVIAGIYVGHSLTIKSQQTKTK |
Ga0334979_0201088_37_201 | 3300033996 | Freshwater | MLQGTWLLDPMNTALTIMGMAILLPLCVIAGIYVGHSLTIKSQQTNDKQNDRSL |
Ga0334979_0331247_415_552 | 3300033996 | Freshwater | MNTALTIMGMAVLLPLCVIAGIYVGHSITIKSQQTKTNEQNNRSL |
Ga0334979_0677174_427_540 | 3300033996 | Freshwater | MGMAILLPLCVIAGIYVGHSLTIKSQQTNDKQNNRSL |
Ga0334986_0081910_679_816 | 3300034012 | Freshwater | MSTALTIVSMAVLMPLCVIAGIYVGHTLTIKSQQTTNEQSNRNRM |
Ga0334986_0425434_254_403 | 3300034012 | Freshwater | MLDRMSTALTIVSMAVLMPLCVIAGVYVGHTLTIKSQQTKTNEQNNRSL |
Ga0334987_0499967_632_739 | 3300034061 | Freshwater | ALTIVSMAVLMPLCVIAGVYVGHTLTIKSQQTKTK |
Ga0335000_0000057_221_355 | 3300034063 | Freshwater | MSTALTIISMAILLPLCVIAGIYVGHSLTIKSQQTNDKQNNRSL |
Ga0335001_0624066_418_564 | 3300034064 | Freshwater | MLDCMNTVITIVCMAALMPLCVIAGIYVGHSLTIKSQNTKTNEQNNRSL |
Ga0334990_0307476_3_131 | 3300034068 | Freshwater | MFDPMNTALTIMGMAVLLPLCVIAGIYVGHSLTIKSQQTKTNE |
Ga0335029_0002150_14736_14885 | 3300034102 | Freshwater | MHDPMNTVITIVCMAVLLPFCVIAGIYVGHSLTIRSQQTKTNEQNNRSL |
Ga0335029_0067153_1467_1604 | 3300034102 | Freshwater | MNTALTIVSMAVLMPLCVIAGVYVGHTLTIKSQQTKTNEQNNRSL |
Ga0335029_0191310_400_543 | 3300034102 | Freshwater | MLDPMNTVITIVCMAVLMPLCVIAGIYVGHSITIKSQTNETKTKNEL |
Ga0335031_0065229_2336_2470 | 3300034104 | Freshwater | MNTVITIVCMAVLMPLCVIAGIYVGHSLTIKSQQTNDKQNNRSL |
Ga0335031_0126333_498_662 | 3300034104 | Freshwater | MLQGTWLLDPMNTALTIMGMAILLPLCVIAGIYVGHSLTIKSQQTNDKQNNRSL |
Ga0335031_0309899_912_1022 | 3300034104 | Freshwater | GMAILLPLCVIAGIYVGHSLTIKSQQTNDKQNNRSL |
Ga0335036_0233183_1018_1170 | 3300034106 | Freshwater | MRDHMNTALTIVSMAVLMPLCVIAGIYVGHTLTIKSQKTTTNEQSNRNRM |
Ga0335036_0240517_1_111 | 3300034106 | Freshwater | TALTIVSMAVLMPLCVIAGVYVGHTLTIKSQQTKTK |
Ga0335051_0261782_96_260 | 3300034109 | Freshwater | MLQGTWLLDPTNTALTIMGMAILLPLCVIAGIYVGHSLTIKSQQTNDKQTNRSN |
Ga0335033_0100672_1562_1669 | 3300034117 | Freshwater | MLDPMNTALTIMGMAVLLPLCVIAGIYVGHSLTIKS |
Ga0335065_0388448_1_123 | 3300034200 | Freshwater | TIVSMAVLMPLCVIAGVYVGHTLTIKSQQTKTNEQNNRSL |
Ga0334997_0114840_739_873 | 3300034280 | Freshwater | MNTALTIMGMAILLPLCVIAGIYVGHSLTIKSQQTNDKQTNRSN |
Ga0335007_0372767_2_112 | 3300034283 | Freshwater | MAVLMPLCVIAGIYVGHTLTIKSQQTKTNEQNNRSL |
Ga0335013_0157848_1430_1537 | 3300034284 | Freshwater | MAILLPLCVIAGIYVGHSLTIKSQQTNDKQNNRSL |
Ga0335013_0422671_469_633 | 3300034284 | Freshwater | MLQGTGLLDPMNTALTIMGMAILLPLCVIAGIYVGHSLTIKSQQTNDKQNNRSL |
Ga0335013_0755572_432_548 | 3300034284 | Freshwater | IMGMAILLPLCVIAGIYVGHSLTIKSQQTNDKQNDRSL |
⦗Top⦘ |