Basic Information | |
---|---|
Family ID | F017066 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 243 |
Average Sequence Length | 45 residues |
Representative Sequence | VILPLAHHSALVALPVFAPALVVILVLLVHRLRERRRWEEEEAEG |
Number of Associated Samples | 177 |
Number of Associated Scaffolds | 243 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 83.26 % |
% of genes near scaffold ends (potentially truncated) | 9.88 % |
% of genes from short scaffolds (< 2000 bps) | 47.74 % |
Associated GOLD sequencing projects | 150 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.47 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (95.062 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (22.634 % of family members) |
Environment Ontology (ENVO) | Unclassified (35.802 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (48.148 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 49.32% β-sheet: 0.00% Coil/Unstructured: 50.68% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 243 Family Scaffolds |
---|---|---|
PF06831 | H2TH | 13.17 |
PF10263 | SprT-like | 11.11 |
PF00574 | CLP_protease | 4.12 |
PF13411 | MerR_1 | 4.12 |
PF06827 | zf-FPG_IleRS | 2.88 |
PF00486 | Trans_reg_C | 2.06 |
PF13338 | AbiEi_4 | 1.65 |
PF06736 | TMEM175 | 1.23 |
PF03167 | UDG | 1.23 |
PF02771 | Acyl-CoA_dh_N | 1.23 |
PF00535 | Glycos_transf_2 | 1.23 |
PF03176 | MMPL | 1.23 |
PF02518 | HATPase_c | 1.23 |
PF05237 | Obsolete Pfam Family | 0.82 |
PF08471 | Ribonuc_red_2_N | 0.82 |
PF01613 | Flavin_Reduct | 0.82 |
PF07690 | MFS_1 | 0.82 |
PF04545 | Sigma70_r4 | 0.82 |
PF02649 | GCHY-1 | 0.41 |
PF13091 | PLDc_2 | 0.41 |
PF13561 | adh_short_C2 | 0.41 |
PF00501 | AMP-binding | 0.41 |
PF00196 | GerE | 0.41 |
PF00034 | Cytochrom_C | 0.41 |
PF10589 | NADH_4Fe-4S | 0.41 |
PF12680 | SnoaL_2 | 0.41 |
PF00353 | HemolysinCabind | 0.41 |
PF01641 | SelR | 0.41 |
PF00903 | Glyoxalase | 0.41 |
PF00344 | SecY | 0.41 |
PF13298 | LigD_N | 0.41 |
PF00899 | ThiF | 0.41 |
PF13510 | Fer2_4 | 0.41 |
PF14338 | Mrr_N | 0.41 |
PF08327 | AHSA1 | 0.41 |
PF11799 | IMS_C | 0.41 |
PF02661 | Fic | 0.41 |
PF00589 | Phage_integrase | 0.41 |
PF01850 | PIN | 0.41 |
PF01957 | NfeD | 0.41 |
PF00067 | p450 | 0.41 |
PF02272 | DHHA1 | 0.41 |
PF00528 | BPD_transp_1 | 0.41 |
PF00252 | Ribosomal_L16 | 0.41 |
PF13668 | Ferritin_2 | 0.41 |
PF01904 | DUF72 | 0.41 |
PF03706 | LPG_synthase_TM | 0.41 |
PF00146 | NADHdh | 0.41 |
PF00366 | Ribosomal_S17 | 0.41 |
PF10066 | DUF2304 | 0.41 |
PF12840 | HTH_20 | 0.41 |
PF12838 | Fer4_7 | 0.41 |
PF02082 | Rrf2 | 0.41 |
PF13622 | 4HBT_3 | 0.41 |
PF03006 | HlyIII | 0.41 |
PF00743 | FMO-like | 0.41 |
PF00171 | Aldedh | 0.41 |
PF00326 | Peptidase_S9 | 0.41 |
PF01370 | Epimerase | 0.41 |
PF03358 | FMN_red | 0.41 |
PF00702 | Hydrolase | 0.41 |
COG ID | Name | Functional Category | % Frequency in 243 Family Scaffolds |
---|---|---|---|
COG0266 | Formamidopyrimidine-DNA glycosylase | Replication, recombination and repair [L] | 13.17 |
COG0616 | Periplasmic serine protease, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 8.23 |
COG0740 | ATP-dependent protease ClpP, protease subunit | Posttranslational modification, protein turnover, chaperones [O] | 8.23 |
COG1030 | Membrane-bound serine protease NfeD, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 4.12 |
COG0692 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 1.23 |
COG1033 | Predicted exporter protein, RND superfamily | General function prediction only [R] | 1.23 |
COG1573 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 1.23 |
COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 1.23 |
COG2409 | Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamily | General function prediction only [R] | 1.23 |
COG3548 | Uncharacterized membrane protein | Function unknown [S] | 1.23 |
COG3663 | G:T/U-mismatch repair DNA glycosylase | Replication, recombination and repair [L] | 1.23 |
COG0209 | Ribonucleotide reductase alpha subunit | Nucleotide transport and metabolism [F] | 0.82 |
COG1853 | FMN reductase RutF, DIM6/NTAB family | Energy production and conversion [C] | 0.82 |
COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.41 |
COG0186 | Ribosomal protein S17 | Translation, ribosomal structure and biogenesis [J] | 0.41 |
COG0197 | Ribosomal protein L16/L10AE | Translation, ribosomal structure and biogenesis [J] | 0.41 |
COG0201 | Preprotein translocase subunit SecY | Intracellular trafficking, secretion, and vesicular transport [U] | 0.41 |
COG0229 | Peptide methionine sulfoxide reductase MsrB | Posttranslational modification, protein turnover, chaperones [O] | 0.41 |
COG0392 | Predicted membrane flippase AglD2/YbhN, UPF0104 family | Cell wall/membrane/envelope biogenesis [M] | 0.41 |
COG0640 | DNA-binding transcriptional regulator, ArsR family | Transcription [K] | 0.41 |
COG0650 | Formate hydrogenlyase subunit HyfC | Energy production and conversion [C] | 0.41 |
COG1005 | NADH:ubiquinone oxidoreductase subunit 1 (chain H) | Energy production and conversion [C] | 0.41 |
COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.41 |
COG1272 | Predicted membrane channel-forming protein YqfA, hemolysin III family | Intracellular trafficking, secretion, and vesicular transport [U] | 0.41 |
COG1414 | DNA-binding transcriptional regulator, IclR family | Transcription [K] | 0.41 |
COG1469 | GTP cyclohydrolase FolE2 | Coenzyme transport and metabolism [H] | 0.41 |
COG1725 | DNA-binding transcriptional regulator YhcF, GntR family | Transcription [K] | 0.41 |
COG1801 | Sugar isomerase-related protein YecE, UPF0759/DUF72 family | General function prediction only [R] | 0.41 |
COG1959 | DNA-binding transcriptional regulator, IscR family | Transcription [K] | 0.41 |
COG2072 | Predicted flavoprotein CzcO associated with the cation diffusion facilitator CzcD | Inorganic ion transport and metabolism [P] | 0.41 |
COG2124 | Cytochrome P450 | Defense mechanisms [V] | 0.41 |
COG2186 | DNA-binding transcriptional regulator, FadR family | Transcription [K] | 0.41 |
COG2188 | DNA-binding transcriptional regulator, GntR family | Transcription [K] | 0.41 |
COG2378 | Predicted DNA-binding transcriptional regulator YobV, contains HTH and WYL domains | Transcription [K] | 0.41 |
COG2524 | Predicted transcriptional regulator, contains C-terminal CBS domains | Transcription [K] | 0.41 |
COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.41 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 95.06 % |
Unclassified | root | N/A | 4.94 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000956|JGI10216J12902_105417269 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1127 | Open in IMG/M |
3300001305|C688J14111_10196508 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
3300001686|C688J18823_10031117 | All Organisms → cellular organisms → Bacteria | 3650 | Open in IMG/M |
3300002568|C688J35102_119812942 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
3300002568|C688J35102_120537364 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1157 | Open in IMG/M |
3300002568|C688J35102_120648825 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1293 | Open in IMG/M |
3300002568|C688J35102_120788115 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1581 | Open in IMG/M |
3300003320|rootH2_10142595 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2390 | Open in IMG/M |
3300004081|Ga0063454_101939737 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 519 | Open in IMG/M |
3300005093|Ga0062594_101790982 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 646 | Open in IMG/M |
3300005327|Ga0070658_10069725 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2877 | Open in IMG/M |
3300005329|Ga0070683_100002792 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 13965 | Open in IMG/M |
3300005329|Ga0070683_100044874 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 4078 | Open in IMG/M |
3300005329|Ga0070683_100166615 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2091 | Open in IMG/M |
3300005330|Ga0070690_100093705 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1981 | Open in IMG/M |
3300005331|Ga0070670_100040843 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3987 | Open in IMG/M |
3300005334|Ga0068869_101976234 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 523 | Open in IMG/M |
3300005337|Ga0070682_100000086 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 83703 | Open in IMG/M |
3300005337|Ga0070682_101398171 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 598 | Open in IMG/M |
3300005337|Ga0070682_101509260 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
3300005338|Ga0068868_100008612 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 7306 | Open in IMG/M |
3300005340|Ga0070689_100281313 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1380 | Open in IMG/M |
3300005343|Ga0070687_100574826 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 770 | Open in IMG/M |
3300005344|Ga0070661_100000633 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 26147 | Open in IMG/M |
3300005345|Ga0070692_10374837 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 891 | Open in IMG/M |
3300005347|Ga0070668_100007524 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 8088 | Open in IMG/M |
3300005354|Ga0070675_100000063 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 64820 | Open in IMG/M |
3300005365|Ga0070688_100000613 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 17847 | Open in IMG/M |
3300005365|Ga0070688_100000727 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 16223 | Open in IMG/M |
3300005366|Ga0070659_100038392 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 3735 | Open in IMG/M |
3300005437|Ga0070710_11069034 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 591 | Open in IMG/M |
3300005438|Ga0070701_11268764 | Not Available | 525 | Open in IMG/M |
3300005456|Ga0070678_100033791 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 3555 | Open in IMG/M |
3300005539|Ga0068853_100365039 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1346 | Open in IMG/M |
3300005543|Ga0070672_100000003 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 159532 | Open in IMG/M |
3300005548|Ga0070665_100007890 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 10799 | Open in IMG/M |
3300005548|Ga0070665_100079990 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3274 | Open in IMG/M |
3300005548|Ga0070665_100135785 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 2462 | Open in IMG/M |
3300005549|Ga0070704_100437834 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1123 | Open in IMG/M |
3300005563|Ga0068855_100386347 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1536 | Open in IMG/M |
3300005577|Ga0068857_100173633 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1960 | Open in IMG/M |
3300005578|Ga0068854_100000091 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 63568 | Open in IMG/M |
3300005614|Ga0068856_100000146 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 71991 | Open in IMG/M |
3300005614|Ga0068856_100131526 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2507 | Open in IMG/M |
3300005615|Ga0070702_101461240 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 561 | Open in IMG/M |
3300005616|Ga0068852_100000035 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 99721 | Open in IMG/M |
3300005616|Ga0068852_100015537 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5909 | Open in IMG/M |
3300005834|Ga0068851_10002302 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 8399 | Open in IMG/M |
3300005834|Ga0068851_10032088 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2612 | Open in IMG/M |
3300006046|Ga0066652_100157946 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1909 | Open in IMG/M |
3300006163|Ga0070715_10180435 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1058 | Open in IMG/M |
3300006175|Ga0070712_100002601 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 11148 | Open in IMG/M |
3300006794|Ga0066658_10000009 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 61111 | Open in IMG/M |
3300006853|Ga0075420_100178361 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1859 | Open in IMG/M |
3300006881|Ga0068865_100000056 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 62122 | Open in IMG/M |
3300006914|Ga0075436_100518716 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 873 | Open in IMG/M |
3300006954|Ga0079219_10357147 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 942 | Open in IMG/M |
3300006954|Ga0079219_10839042 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 730 | Open in IMG/M |
3300006954|Ga0079219_10922252 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 710 | Open in IMG/M |
3300007790|Ga0105679_10204351 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 1124 | Open in IMG/M |
3300009098|Ga0105245_10000319 | All Organisms → cellular organisms → Bacteria | 45611 | Open in IMG/M |
3300009112|Ga0115923_10013215 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 702 | Open in IMG/M |
3300009112|Ga0115923_10159176 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 6594 | Open in IMG/M |
3300009148|Ga0105243_10007359 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 8464 | Open in IMG/M |
3300009156|Ga0111538_11949521 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 739 | Open in IMG/M |
3300009177|Ga0105248_10000547 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 42972 | Open in IMG/M |
3300009177|Ga0105248_10083359 | All Organisms → cellular organisms → Bacteria | 3596 | Open in IMG/M |
3300009789|Ga0126307_10615044 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 877 | Open in IMG/M |
3300009840|Ga0126313_10007604 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 6640 | Open in IMG/M |
3300009840|Ga0126313_10040582 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 3241 | Open in IMG/M |
3300009840|Ga0126313_10159191 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 1711 | Open in IMG/M |
3300009840|Ga0126313_10194447 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 1554 | Open in IMG/M |
3300009840|Ga0126313_10768733 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 782 | Open in IMG/M |
3300009840|Ga0126313_11222187 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 620 | Open in IMG/M |
3300009840|Ga0126313_11833534 | Not Available | 508 | Open in IMG/M |
3300010036|Ga0126305_10000091 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 38513 | Open in IMG/M |
3300010036|Ga0126305_10021044 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 3443 | Open in IMG/M |
3300010036|Ga0126305_10742116 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 665 | Open in IMG/M |
3300010037|Ga0126304_10518135 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 801 | Open in IMG/M |
3300010037|Ga0126304_10536119 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 787 | Open in IMG/M |
3300010038|Ga0126315_11037065 | Not Available | 551 | Open in IMG/M |
3300010041|Ga0126312_11397488 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 519 | Open in IMG/M |
3300010044|Ga0126310_10096774 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1778 | Open in IMG/M |
3300010045|Ga0126311_10398015 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 1059 | Open in IMG/M |
3300010045|Ga0126311_10743949 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 786 | Open in IMG/M |
3300010045|Ga0126311_10969411 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 694 | Open in IMG/M |
3300010166|Ga0126306_10012676 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5395 | Open in IMG/M |
3300010166|Ga0126306_10524933 | All Organisms → cellular organisms → Bacteria | 938 | Open in IMG/M |
3300010166|Ga0126306_11721963 | Not Available | 524 | Open in IMG/M |
3300010166|Ga0126306_11730571 | Not Available | 522 | Open in IMG/M |
3300010371|Ga0134125_10120213 | All Organisms → cellular organisms → Bacteria | 2925 | Open in IMG/M |
3300010375|Ga0105239_11435420 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 797 | Open in IMG/M |
3300010397|Ga0134124_10613897 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 1067 | Open in IMG/M |
3300012200|Ga0137382_10307399 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 1107 | Open in IMG/M |
3300012893|Ga0157284_10000115 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 11851 | Open in IMG/M |
3300012900|Ga0157292_10000016 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 67701 | Open in IMG/M |
3300012901|Ga0157288_10204380 | Not Available | 632 | Open in IMG/M |
3300012907|Ga0157283_10000857 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 4288 | Open in IMG/M |
3300012908|Ga0157286_10162097 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 722 | Open in IMG/M |
3300012909|Ga0157290_10037627 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 1180 | Open in IMG/M |
3300012914|Ga0157297_10152774 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 754 | Open in IMG/M |
3300012939|Ga0162650_100000032 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 14080 | Open in IMG/M |
3300012955|Ga0164298_10190592 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 1190 | Open in IMG/M |
3300012957|Ga0164303_10893689 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 621 | Open in IMG/M |
3300012960|Ga0164301_10000016 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 48614 | Open in IMG/M |
3300012961|Ga0164302_10002730 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 5928 | Open in IMG/M |
3300012984|Ga0164309_10919264 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 714 | Open in IMG/M |
3300012985|Ga0164308_10461107 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 1054 | Open in IMG/M |
3300012987|Ga0164307_10187239 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 1398 | Open in IMG/M |
3300012988|Ga0164306_10429510 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 1000 | Open in IMG/M |
3300013102|Ga0157371_10008215 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 8345 | Open in IMG/M |
3300013104|Ga0157370_10106293 | All Organisms → cellular organisms → Bacteria | 2627 | Open in IMG/M |
3300013105|Ga0157369_10000348 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 61516 | Open in IMG/M |
3300013297|Ga0157378_10014733 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 6850 | Open in IMG/M |
3300013297|Ga0157378_10091241 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 2769 | Open in IMG/M |
3300013306|Ga0163162_11415398 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 791 | Open in IMG/M |
3300014326|Ga0157380_10000092 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 48994 | Open in IMG/M |
3300014326|Ga0157380_10122179 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 2207 | Open in IMG/M |
3300014326|Ga0157380_13315777 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 515 | Open in IMG/M |
3300014487|Ga0182000_10246725 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 714 | Open in IMG/M |
3300014969|Ga0157376_10007684 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 7723 | Open in IMG/M |
3300015200|Ga0173480_10030151 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 2329 | Open in IMG/M |
3300015201|Ga0173478_10647411 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 557 | Open in IMG/M |
3300015371|Ga0132258_11385077 | All Organisms → cellular organisms → Bacteria | 1777 | Open in IMG/M |
3300015374|Ga0132255_100229985 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 2640 | Open in IMG/M |
3300017792|Ga0163161_10009770 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6650 | Open in IMG/M |
3300018067|Ga0184611_1067066 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1216 | Open in IMG/M |
3300018422|Ga0190265_10821378 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 1052 | Open in IMG/M |
3300018431|Ga0066655_10257014 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 1119 | Open in IMG/M |
3300018432|Ga0190275_10000268 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 52124 | Open in IMG/M |
3300018432|Ga0190275_10740701 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1043 | Open in IMG/M |
3300018465|Ga0190269_10000019 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 67318 | Open in IMG/M |
3300018465|Ga0190269_10478015 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 801 | Open in IMG/M |
3300018465|Ga0190269_11090584 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 614 | Open in IMG/M |
3300018465|Ga0190269_11401236 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 567 | Open in IMG/M |
3300018476|Ga0190274_10014975 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 4929 | Open in IMG/M |
3300018481|Ga0190271_10000001 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 460146 | Open in IMG/M |
3300018481|Ga0190271_10000218 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 28507 | Open in IMG/M |
3300018481|Ga0190271_10040443 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 3870 | Open in IMG/M |
3300018920|Ga0190273_10000154 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 35407 | Open in IMG/M |
3300018920|Ga0190273_10140612 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 1425 | Open in IMG/M |
3300018920|Ga0190273_10241097 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1165 | Open in IMG/M |
3300019767|Ga0190267_10010353 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2509 | Open in IMG/M |
3300020020|Ga0193738_1033409 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 1590 | Open in IMG/M |
3300020081|Ga0206354_10880857 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 907 | Open in IMG/M |
3300020181|Ga0196958_10004412 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 4077 | Open in IMG/M |
3300020181|Ga0196958_10244819 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 650 | Open in IMG/M |
3300021363|Ga0193699_10057198 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1519 | Open in IMG/M |
3300022880|Ga0247792_1011949 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 1348 | Open in IMG/M |
3300022898|Ga0247745_1002163 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 2542 | Open in IMG/M |
3300022899|Ga0247795_1000817 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 5207 | Open in IMG/M |
3300022910|Ga0247768_1000009 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 236372 | Open in IMG/M |
3300023070|Ga0247755_1000002 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 243542 | Open in IMG/M |
3300023071|Ga0247752_1032216 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 779 | Open in IMG/M |
3300023077|Ga0247802_1009154 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 1276 | Open in IMG/M |
3300023097|Ga0247757_10154147 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 740 | Open in IMG/M |
3300023266|Ga0247789_1013847 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1297 | Open in IMG/M |
3300023268|Ga0247765_1020747 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1409 | Open in IMG/M |
3300023268|Ga0247765_1047294 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 891 | Open in IMG/M |
3300023275|Ga0247776_10002808 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 5583 | Open in IMG/M |
3300024055|Ga0247794_10010728 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 2117 | Open in IMG/M |
3300024426|Ga0196960_10000076 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 38785 | Open in IMG/M |
3300024426|Ga0196960_10013736 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2054 | Open in IMG/M |
3300025321|Ga0207656_10000136 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 27533 | Open in IMG/M |
3300025321|Ga0207656_10022217 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 2543 | Open in IMG/M |
3300025903|Ga0207680_10160247 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1508 | Open in IMG/M |
3300025909|Ga0207705_10422464 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 1032 | Open in IMG/M |
3300025911|Ga0207654_10051276 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 2374 | Open in IMG/M |
3300025915|Ga0207693_10001028 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 24954 | Open in IMG/M |
3300025916|Ga0207663_10262017 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 1277 | Open in IMG/M |
3300025919|Ga0207657_11395373 | Not Available | 526 | Open in IMG/M |
3300025920|Ga0207649_10000333 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 35819 | Open in IMG/M |
3300025925|Ga0207650_10021959 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 4516 | Open in IMG/M |
3300025926|Ga0207659_10000054 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 76823 | Open in IMG/M |
3300025927|Ga0207687_10000027 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 168505 | Open in IMG/M |
3300025927|Ga0207687_10029970 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3664 | Open in IMG/M |
3300025935|Ga0207709_10006077 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6807 | Open in IMG/M |
3300025938|Ga0207704_10000092 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 52383 | Open in IMG/M |
3300025940|Ga0207691_10000005 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 163117 | Open in IMG/M |
3300025941|Ga0207711_10000019 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 412779 | Open in IMG/M |
3300025941|Ga0207711_10630387 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 1000 | Open in IMG/M |
3300025944|Ga0207661_10000155 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 44064 | Open in IMG/M |
3300025944|Ga0207661_10005035 | All Organisms → cellular organisms → Bacteria | 9269 | Open in IMG/M |
3300025944|Ga0207661_10043837 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3532 | Open in IMG/M |
3300025949|Ga0207667_10320161 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1584 | Open in IMG/M |
3300025972|Ga0207668_11233096 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 672 | Open in IMG/M |
3300025981|Ga0207640_10000140 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 53451 | Open in IMG/M |
3300026023|Ga0207677_10012774 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 4845 | Open in IMG/M |
3300026041|Ga0207639_10102168 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 2320 | Open in IMG/M |
3300026078|Ga0207702_10003190 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 15161 | Open in IMG/M |
3300026078|Ga0207702_10009653 | All Organisms → cellular organisms → Bacteria | 8103 | Open in IMG/M |
3300026116|Ga0207674_10131603 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 2464 | Open in IMG/M |
3300026121|Ga0207683_10052530 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 3571 | Open in IMG/M |
3300026142|Ga0207698_10000014 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 240703 | Open in IMG/M |
3300026142|Ga0207698_10027737 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 4026 | Open in IMG/M |
3300026308|Ga0209265_1032668 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1609 | Open in IMG/M |
3300026325|Ga0209152_10000270 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 26049 | Open in IMG/M |
3300026774|Ga0207451_103481 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 607 | Open in IMG/M |
3300027765|Ga0209073_10330873 | Not Available | 610 | Open in IMG/M |
3300027775|Ga0209177_10218866 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 687 | Open in IMG/M |
3300028379|Ga0268266_10001920 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 23363 | Open in IMG/M |
3300028379|Ga0268266_10011495 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 7689 | Open in IMG/M |
3300028379|Ga0268266_10030470 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 4584 | Open in IMG/M |
3300028379|Ga0268266_11413911 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 671 | Open in IMG/M |
3300028704|Ga0307321_1003604 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 2594 | Open in IMG/M |
3300028712|Ga0307285_10000005 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 196184 | Open in IMG/M |
3300028715|Ga0307313_10197930 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 623 | Open in IMG/M |
3300028721|Ga0307315_10013065 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2076 | Open in IMG/M |
3300028721|Ga0307315_10038886 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 1294 | Open in IMG/M |
3300028721|Ga0307315_10248303 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 558 | Open in IMG/M |
3300028722|Ga0307319_10000019 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 63123 | Open in IMG/M |
3300028754|Ga0307297_10007950 | All Organisms → cellular organisms → Bacteria | 2725 | Open in IMG/M |
3300028768|Ga0307280_10000013 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 75305 | Open in IMG/M |
3300028778|Ga0307288_10000011 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 150087 | Open in IMG/M |
3300028778|Ga0307288_10000115 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 28672 | Open in IMG/M |
3300028782|Ga0307306_10000041 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 25725 | Open in IMG/M |
3300028787|Ga0307323_10202138 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 717 | Open in IMG/M |
3300028802|Ga0307503_10000001 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 484270 | Open in IMG/M |
3300028802|Ga0307503_10000056 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 73312 | Open in IMG/M |
3300028872|Ga0307314_10000046 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 31028 | Open in IMG/M |
3300028872|Ga0307314_10005833 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 2583 | Open in IMG/M |
3300031152|Ga0307501_10086066 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 771 | Open in IMG/M |
3300031731|Ga0307405_10427529 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 1044 | Open in IMG/M |
3300031938|Ga0308175_100000056 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 90154 | Open in IMG/M |
3300032080|Ga0326721_10000027 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 139773 | Open in IMG/M |
3300032144|Ga0315910_10000001 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1323568 | Open in IMG/M |
3300032157|Ga0315912_10010028 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 8087 | Open in IMG/M |
3300032205|Ga0307472_100363764 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 1193 | Open in IMG/M |
3300032205|Ga0307472_101261401 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 709 | Open in IMG/M |
3300032896|Ga0335075_10325593 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 1695 | Open in IMG/M |
3300034000|Ga0334918_021059 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 903 | Open in IMG/M |
3300034009|Ga0334944_059785 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 723 | Open in IMG/M |
3300034132|Ga0334915_000022 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 78189 | Open in IMG/M |
3300034133|Ga0334916_019694 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 808 | Open in IMG/M |
3300034144|Ga0334962_043307 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 594 | Open in IMG/M |
3300034173|Ga0334925_013234 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 1866 | Open in IMG/M |
3300034173|Ga0334925_031070 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1177 | Open in IMG/M |
3300034173|Ga0334925_072992 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 738 | Open in IMG/M |
3300034687|Ga0334905_000302 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 7146 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 22.63% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 9.46% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 8.64% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 4.94% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.70% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 3.70% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 3.29% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.88% |
Hypolithic Biocrust | Environmental → Terrestrial → Soil → Soil Crust → Unclassified → Hypolithic Biocrust | 2.47% |
Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 2.47% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.47% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.06% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.06% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 2.06% |
Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 2.06% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.06% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.06% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.65% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.65% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.23% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.23% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.23% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.23% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.41% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.41% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.41% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.41% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Desert → Soil | 0.41% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.41% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.41% |
Sugarcane Root And Bulk Soil | Host-Associated → Plants → Rhizome → Unclassified → Unclassified → Sugarcane Root And Bulk Soil | 0.41% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.41% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.82% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.82% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.82% |
Sub-Biocrust Soil | Environmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil | 0.82% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.82% |
Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.82% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.82% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.82% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.82% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.82% |
Swimming Pool Sandfilter Backwash | Engineered → Built Environment → Unclassified → Unclassified → Unclassified → Swimming Pool Sandfilter Backwash | 0.82% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300001305 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300003320 | Sugarcane root Sample H2 | Host-Associated | Open in IMG/M |
3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300007790 | Microbial communities of desert soil contaminated with blood from dead anthrax infected zebra in Etosha National Park, Namibia. Combined Assembly of 14 sequencing projects | Environmental | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009112 | Microbial communities from sand-filter backwash in Singapore swimming pools - KB-2 | Engineered | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012893 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S059-202B-1 | Environmental | Open in IMG/M |
3300012900 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S179-409R-1 | Environmental | Open in IMG/M |
3300012901 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1 | Environmental | Open in IMG/M |
3300012907 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1 | Environmental | Open in IMG/M |
3300012908 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1 | Environmental | Open in IMG/M |
3300012909 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S149-409B-1 | Environmental | Open in IMG/M |
3300012914 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2 | Environmental | Open in IMG/M |
3300012937 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t5i015 | Environmental | Open in IMG/M |
3300012939 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t1i015 | Environmental | Open in IMG/M |
3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300014487 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG | Environmental | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
3300015201 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2) | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
3300018067 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coex | Environmental | Open in IMG/M |
3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
3300019767 | Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T | Environmental | Open in IMG/M |
3300020020 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a1 | Environmental | Open in IMG/M |
3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020181 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S1+v_10 | Environmental | Open in IMG/M |
3300021363 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2 | Environmental | Open in IMG/M |
3300022880 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S106-311C-6 | Environmental | Open in IMG/M |
3300022898 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S109-311C-5 | Environmental | Open in IMG/M |
3300022899 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S016-104C-6 | Environmental | Open in IMG/M |
3300022910 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L016-104C-6 | Environmental | Open in IMG/M |
3300023070 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L096-311B-4 | Environmental | Open in IMG/M |
3300023071 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S019-104C-5 | Environmental | Open in IMG/M |
3300023077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S076-202R-6 | Environmental | Open in IMG/M |
3300023097 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L126-311R-4 | Environmental | Open in IMG/M |
3300023266 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S220-509R-4 | Environmental | Open in IMG/M |
3300023268 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L106-311C-6 | Environmental | Open in IMG/M |
3300023275 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L199-509C-5 | Environmental | Open in IMG/M |
3300024055 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6 | Environmental | Open in IMG/M |
3300024426 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S3+v_5 | Environmental | Open in IMG/M |
3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026308 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes) | Environmental | Open in IMG/M |
3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
3300026774 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G01K1-12 (SPAdes) | Environmental | Open in IMG/M |
3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300028704 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_379 | Environmental | Open in IMG/M |
3300028712 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139 | Environmental | Open in IMG/M |
3300028715 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203 | Environmental | Open in IMG/M |
3300028721 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355 | Environmental | Open in IMG/M |
3300028722 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368 | Environmental | Open in IMG/M |
3300028754 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_157 | Environmental | Open in IMG/M |
3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
3300028778 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142 | Environmental | Open in IMG/M |
3300028782 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_193 | Environmental | Open in IMG/M |
3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
3300028872 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_204 | Environmental | Open in IMG/M |
3300031152 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_S | Environmental | Open in IMG/M |
3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
3300032080 | Soil microbial communities from Southern Great Plains, Lamont, Oklahoma, United States - SGP_1_2016 | Environmental | Open in IMG/M |
3300032144 | Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soil | Environmental | Open in IMG/M |
3300032157 | Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soil | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
3300034000 | Biocrust microbial communities from Mojave Desert, California, United States - 14HMC | Environmental | Open in IMG/M |
3300034009 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 40SMS | Environmental | Open in IMG/M |
3300034132 | Biocrust microbial communities from Mojave Desert, California, United States - 11HMC | Environmental | Open in IMG/M |
3300034133 | Biocrust microbial communities from Mojave Desert, California, United States - 12HMC | Environmental | Open in IMG/M |
3300034144 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 58SNS | Environmental | Open in IMG/M |
3300034173 | Biocrust microbial communities from Mojave Desert, California, United States - 21HNC | Environmental | Open in IMG/M |
3300034687 | Soil microbial communities from Mojave Desert, California, United States - 1NOC | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI10216J12902_1054172693 | 3300000956 | Soil | MILPLAHHPILVSLPVFAPAVVIILFLLVHHLRERRHWDEEVEG* |
C688J14111_101965082 | 3300001305 | Soil | ILPLAHHNAIVALPVFAPALVVLLVLVVHHLRERRHWDEEESETQA* |
C688J18823_100311174 | 3300001686 | Soil | MILPLAHHGAIVALPVSAPAIVVISSSSPTTLRERRNWDEEEIGS* |
C688J35102_1190271432 | 3300002568 | Soil | LPARRRQMILPLAHHNAIVALPVFAPALVVILVLVVHHLRERRRWDEEESETQA* |
C688J35102_1198129422 | 3300002568 | Soil | MILPLAHHNAIVALPVFAPALVVLLVLVVHHLRERRHWDEEESETQA* |
C688J35102_1205373642 | 3300002568 | Soil | LILPLAHHNAIVALPVFAPALVVILVLVVHHLRERRHWD* |
C688J35102_1206488253 | 3300002568 | Soil | MILPLAHHNAIVALPVFAPAVVVILVLIVHHLRERRHWGEEEIES* |
C688J35102_1207881153 | 3300002568 | Soil | VILPLAHHNAIVALPVFAPAIVVVLVLIVHHLRERRHWNEEETET* |
rootH2_101425952 | 3300003320 | Sugarcane Root And Bulk Soil | VILPLAHHNTIVALPVFAPAVVVILVLLVHHLRERRHWDEEEETQS* |
Ga0063454_1019397372 | 3300004081 | Soil | MILPLAHHNAIVALPVFAPALVVILVLVVHHLRERRHWDEEETKG* |
Ga0062594_1017909821 | 3300005093 | Soil | MTLPLAHHSALVALPVFAPALVVILVLLVHRLREGRRWDEEEANGNN* |
Ga0070658_100697255 | 3300005327 | Corn Rhizosphere | VNLPLAHHNAIVALPVFAPALVVILVLLVHRLREGRHWDEEEADG* |
Ga0070683_10000279216 | 3300005329 | Corn Rhizosphere | VNLPLAHHNAIVALPVFAPALVVIAFLLVHRLREKRRWEEEEAEG* |
Ga0070683_1000448745 | 3300005329 | Corn Rhizosphere | VNLPLAHHNAIVALPVFAPALVVILFLLVHRLRERKRWEEEEEAEG* |
Ga0070683_1001666152 | 3300005329 | Corn Rhizosphere | VILPLAHHSALVALPVFAPALVVILVLLVHRMREKRRWEEEEGGS* |
Ga0070690_1000937054 | 3300005330 | Switchgrass Rhizosphere | VTLPLAHHSALVALPVFAPALVVILFLLVHRLREGRHWDEEEADNPS* |
Ga0070670_1000408432 | 3300005331 | Switchgrass Rhizosphere | VILPLAHHTAIVALPVFAPALIVIAVLVVHHLRERRHWDEEESEG* |
Ga0068869_1019762342 | 3300005334 | Miscanthus Rhizosphere | VILPLAHHNAIVALPVFAPAVVIVLVLVVHHLRERRHWDDEDEAAPER* |
Ga0070682_10000008668 | 3300005337 | Corn Rhizosphere | VILPLAHHNAIVALPVFAPAVVIVLVLLVHHLRERRHWDDEDEAAPES* |
Ga0070682_1013981712 | 3300005337 | Corn Rhizosphere | VILPLAHHSALVALPVFAPALVVILVLLVHRLREGRHWDEEETDASN* |
Ga0070682_1015092602 | 3300005337 | Corn Rhizosphere | VILPLAHHNAIAALPVFAPALIVCVVVAIHFLRERRHWSEEEEG* |
Ga0068868_1000086127 | 3300005338 | Miscanthus Rhizosphere | VILPLAHHSALVALPVFAPALVVILVLLVHRMRERKHWDEEEIEG* |
Ga0070689_1002813132 | 3300005340 | Switchgrass Rhizosphere | VILPLAHHNLVVALPVFAPAIVVVAVLVVHHLRERRHWDEEEGQP* |
Ga0070687_1005748262 | 3300005343 | Switchgrass Rhizosphere | VTLPLAHHSALVALPVFAPALVVILVLLVHRLREGRHWDEEETTDG* |
Ga0070661_1000006336 | 3300005344 | Corn Rhizosphere | VILPLAHHNAIVALPVFAPALIVILFLLVHRMREKKRWEEEEAEN* |
Ga0070692_103748372 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MILPLAHHNAIVALPVFAPAVVIVLVLVVHHLRERRHWEDEETEG* |
Ga0070668_1000075247 | 3300005347 | Switchgrass Rhizosphere | VILPLAHHSALVALPVFAPALVVILVLLVHRMRERKRWEEEEAEH* |
Ga0070675_10000006341 | 3300005354 | Miscanthus Rhizosphere | VTLPLAHHNAIVALPVFAPALVVIVFLLVHRLRERRRWEEEEAAEASREIGPR* |
Ga0070688_10000061312 | 3300005365 | Switchgrass Rhizosphere | VILPLAHHNAIVALPVFAPALVVILVLVVHHLRERRHWGDEEETQN* |
Ga0070688_1000007278 | 3300005365 | Switchgrass Rhizosphere | VILPLAHHNALVALPVFAPALIVILVLLVHRMRERRRWEEEEADG* |
Ga0070659_1000383922 | 3300005366 | Corn Rhizosphere | MTLPLAHHNAIVALPVFAPAIIICLVLFVHHLRERRHWDEEDADEGT* |
Ga0070710_110690342 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | VILPLAHHNAIVALPVFAPAVVIVLVLVVHHLRERRHWDDEDEATTER* |
Ga0070701_112687641 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLPLAHHAAVAALPVFAPALIVVLVLAVRYLRERRHWDDEEPAEG* |
Ga0070678_1000337912 | 3300005456 | Miscanthus Rhizosphere | VTLPLAHHSALVALPVFAPALVVILVLLVHRLRESRRWDEEEADG* |
Ga0068853_1003650392 | 3300005539 | Corn Rhizosphere | VILPLAHHNAIVALPVFAPALVVILVLVVHHLRERRHWDEEESEG* |
Ga0070672_100000003125 | 3300005543 | Miscanthus Rhizosphere | VTLPLAHHSALVALPVFAPALVVVLVLLVHRMRERRRWEEEEAEG* |
Ga0070665_1000078906 | 3300005548 | Switchgrass Rhizosphere | MNLPLAHHAAVAALPVFAPALIIITVLTIRYLRERRHWDEEAE* |
Ga0070665_1000799905 | 3300005548 | Switchgrass Rhizosphere | VTLPLAHHALVLALPVFAPALVVILVICVHYLRERKRWEEEGEA* |
Ga0070665_1001357852 | 3300005548 | Switchgrass Rhizosphere | MTLPLAHHSALVALPVFAPALVVILVLLVHRLREGRRWDEEEADNPS* |
Ga0070704_1004378342 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MILPLAHHSAIVALPVFAPAIVVCLVLVVHRLRERRRWDEERG* |
Ga0068855_1003863473 | 3300005563 | Corn Rhizosphere | VTLPLAHHSALVALPVFAPALIVILVLLVHRLREGRRWAEEEAETNS* |
Ga0068857_1001736332 | 3300005577 | Corn Rhizosphere | VTLPLAHHNAIMALPVFAPALVVILFLLIHRLRERRRWEEEDETLASEKSH* |
Ga0068854_10000009135 | 3300005578 | Corn Rhizosphere | VILPLAHHNAIVALPVFAPAVVIVLVLIVHHLRERRHWDDEDEPATES* |
Ga0068856_1000001465 | 3300005614 | Corn Rhizosphere | VILPLAHHNAIVALPVFAPAIVVILVLIVHHLRERRHWD* |
Ga0068856_1001315265 | 3300005614 | Corn Rhizosphere | VILPLAHHNAIVALPVFAPALIVILVLVVHHLRERKHWDDEETEA* |
Ga0070702_1014612402 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | VILPLAHHSALVALPVFAPALVVILVILVHRIREKRRWEEEEAEG* |
Ga0068852_10000003531 | 3300005616 | Corn Rhizosphere | VILPLAHHNAIVALPVFAPALIVILVLVVHHLRERRHWDDEEETQA* |
Ga0068852_1000155378 | 3300005616 | Corn Rhizosphere | VTLPLAHHSALVALPVFAPALIVILVILVHRLREGRHWDEEEAESNS* |
Ga0068851_100023026 | 3300005834 | Corn Rhizosphere | VILPLAHHNAIVALPVFAPAVVIVLVLIVHHLRERRHWDDEDEAASES* |
Ga0068851_100320882 | 3300005834 | Corn Rhizosphere | MNLPLAHHNAIVALPVFAPALIVILVLLVHRLREGRHWDEEETDA* |
Ga0066652_1001579462 | 3300006046 | Soil | VTLPLAHHALVLALPVFAPALVVILVICVHYLRERKRWEEEEAR* |
Ga0070715_101804353 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | VILPLAHHSLVVALPVFAPALVVVIVLVVHHLRERRRWEEEEAEG* |
Ga0070712_1000026018 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | VNLPLAHHNAIVALPVFAPALVVILFLLVHRLRERKRWEEEEAEG* |
Ga0066658_1000000912 | 3300006794 | Soil | VILPLAHHSALVALPVFAPALVVILVLLVHRMREKRRWEEEEAER* |
Ga0075420_1001783612 | 3300006853 | Populus Rhizosphere | MTLPLAHHAAVAALPVFAPALIIVSVLTIRFLRERRHWDDES* |
Ga0068865_10000005662 | 3300006881 | Miscanthus Rhizosphere | VILPLAHHNAIVALPVFAPALVVILVLIVHHLRERRHWDDEETEG* |
Ga0075436_1005187162 | 3300006914 | Populus Rhizosphere | VILPLAHHNAIVALPVFAPAVVIVLVLIVHHLRERRHWDDEDEATTES* |
Ga0079219_103571472 | 3300006954 | Agricultural Soil | MTLPLAHHNTIVALPVFAPAIVVVIVLVVHHLRERRRWEDEEDGA* |
Ga0079219_108390422 | 3300006954 | Agricultural Soil | VTLPLAHHSLVVALPVFAPALVVILVIAVHYLRERRRWDEEEAG* |
Ga0079219_109222521 | 3300006954 | Agricultural Soil | MTLPLAHHNAIVALPVFAPAIIICLVLAVHHLRERRHWDEEDETDEV* |
Ga0105679_102043512 | 3300007790 | Soil | VILPLAHHSALVALPVFAPALVVVLFLLVHRLRERRRWDEEENEA* |
Ga0105245_1000031941 | 3300009098 | Miscanthus Rhizosphere | VILPLAHHNAIVALPVFAPALVVILVLVVHHLRERRHWDDEEETEA* |
Ga0115923_100132151 | 3300009112 | Swimming Pool Sandfilter Backwash | HARPKRERRPMTLPLAPHAAVAALPVFAPALIIVSVLTVRFLRERRHWDDE* |
Ga0115923_101591764 | 3300009112 | Swimming Pool Sandfilter Backwash | MTLVLAHHAAVAALPVFAPAVIIIAVLSVRYLRERHHWDDEP* |
Ga0105243_100073595 | 3300009148 | Miscanthus Rhizosphere | VILPLAHHSALVALPVFAPALVVILVLLVHRMREKRRWEEEEAEQS* |
Ga0111538_119495211 | 3300009156 | Populus Rhizosphere | VTLPLAHHSALVALPVFAPALVVILVLLVHRLRERRR |
Ga0105248_1000054742 | 3300009177 | Switchgrass Rhizosphere | VILPLAHHNAIVALPVFAPALVVILVLVVHHLRERRHWDDEEETNA* |
Ga0105248_100833592 | 3300009177 | Switchgrass Rhizosphere | VNLPLAHHNAIVALPVFAPALVVILVLLVHRLREGRHWDEEETDAS* |
Ga0126307_106150442 | 3300009789 | Serpentine Soil | VILPLAHHPILVSLPVFAPAVVIVLFLLVHRLREGRRWDEEEA* |
Ga0126313_100076049 | 3300009840 | Serpentine Soil | VTLPLAHHSALVALPVFAPALVVILVLLVHRLREGRHWDEEESAGDATDA* |
Ga0126313_100405825 | 3300009840 | Serpentine Soil | VILPLAHHNAIVALPVFAPALVVILVLVVHHLRERRHWHDDEETQA* |
Ga0126313_101591911 | 3300009840 | Serpentine Soil | VILPLAHHNAIVALPVFAPALVVILVLVVHHLRERRHWDDEETEA* |
Ga0126313_101944472 | 3300009840 | Serpentine Soil | VILPLAHHSALVALPVFAPALVVILVLLVHRMREKRRWEEEDPEG* |
Ga0126313_107687332 | 3300009840 | Serpentine Soil | VILPLAHHTAIAALPVLAPALIVCIAVAIHFLRERRHWAEDEEG* |
Ga0126313_112221872 | 3300009840 | Serpentine Soil | VTLPLAHHSALVALPVFAPALVVILVLLVHRLREGRHWDEEEPNP* |
Ga0126313_118335342 | 3300009840 | Serpentine Soil | VILPLADHAAVAALPVFAPALVVCLVLVVHYLRERRHWED* |
Ga0126305_1000009137 | 3300010036 | Serpentine Soil | VILPLAHHSALVALPVFAPALVVILVLLVHRMREKRRWEEEEAEG* |
Ga0126305_100210445 | 3300010036 | Serpentine Soil | VILPLAHHSALVALPVFAPALVVILVLLVHRMRERRRWEKEETGS* |
Ga0126305_107421162 | 3300010036 | Serpentine Soil | MILPLADHSAITALTVFAPALIISLVLVVHHLRERRRWDD* |
Ga0126304_105181352 | 3300010037 | Serpentine Soil | VILPLAHHSALVALPVFAPALVVILVLLVHRMREKRRWEEEESGS* |
Ga0126304_105361192 | 3300010037 | Serpentine Soil | VTVLLADHHAVAALPVFAPALVICLVLLVHYLRERRHWED* |
Ga0126315_110370652 | 3300010038 | Serpentine Soil | VTLPLAHHSALVALPVFAPALVVILVLLVHRLREGRHWDEEETNGNN* |
Ga0126312_113974882 | 3300010041 | Serpentine Soil | VILPLAHHTAIVALPVFAPALVVILVLVVHHLRERRHWDEEETEG* |
Ga0126310_100967743 | 3300010044 | Serpentine Soil | VTLPLAHHSALVALPVFAPALVVILVLLVHRLRERRRWEEEETEA* |
Ga0126311_103980152 | 3300010045 | Serpentine Soil | MNLPLAHHNALVALPVFAPALVVIFVLLVHRLREGRHWDEEETDS* |
Ga0126311_107439492 | 3300010045 | Serpentine Soil | MTLPLAHHAAVAALPVFAPALIVIAVLSIRYLRDRRHWDEPE* |
Ga0126311_109694111 | 3300010045 | Serpentine Soil | VNLPLAHHNAIVALPVFAPALVVIVFLLVHRLRERRR |
Ga0126306_100126769 | 3300010166 | Serpentine Soil | ILPLAHHSALVALPVFAPALVVILVLLVHRMREKRRWEEEEADG* |
Ga0126306_105249331 | 3300010166 | Serpentine Soil | HDAIEALPVFAPVLVICLVLAVQYLRARRHWDEEEEEPDRGPIGP* |
Ga0126306_117219632 | 3300010166 | Serpentine Soil | VILPLAHHSALVALPVFAPALVVILVLLVHRMREKRQWEEEEGEG* |
Ga0126306_117305711 | 3300010166 | Serpentine Soil | PLAHHSALVALPVFAPALVVILVLLVHRLREGRRWDEEESVGDATDA* |
Ga0134125_101202133 | 3300010371 | Terrestrial Soil | VILPLAHHNAVAALPVFAPAIVVCLVLLVHFLRERRRWDEEPSGDDPV* |
Ga0105239_114354202 | 3300010375 | Corn Rhizosphere | VILPLAHHNAIVALPVFAPALVVILVLVVHHLRERKHWDDEEETEA* |
Ga0134124_106138971 | 3300010397 | Terrestrial Soil | VILPLAHHNAIVALPVFAPALVVILVLIVHHLRERRHWDEEETETQA* |
Ga0137382_103073992 | 3300012200 | Vadose Zone Soil | VILPLAHHNAIVALPVFAPAVVVVLVLVVHHLRERRHWDDEDEAAPES* |
Ga0157284_1000011511 | 3300012893 | Soil | VILPLAHHSALVALPVFAPALVVILVLLVHRLRERRRWEEEEAEG* |
Ga0157292_1000001646 | 3300012900 | Soil | VTLPLAHHAAVAALPVLLPALIVCAVLLVHFLRERRHWDEEDGDSA* |
Ga0157288_102043801 | 3300012901 | Soil | VTLPLAHHSALVALPVFAPALVVILVLLVHRLREGRRWDEEEADG* |
Ga0157283_100008577 | 3300012907 | Soil | VILPLAHHSLLVALPVFAPALVIVVVLVVHHLRERRRWEEEEAGS* |
Ga0157286_101620972 | 3300012908 | Soil | VILPLAHHSALVALPVFAPALVVILVLLVHRMRERRRWEEEENQS* |
Ga0157290_100376272 | 3300012909 | Soil | MTLPLAHHSLVVALPVFAPALVVIAVIAVHYLRERRRWDAEENGA* |
Ga0157297_101527742 | 3300012914 | Soil | MLPLAHHSLLVALPVFAPALVIVVVLVVHHLRERRRWEEEEAGS* |
Ga0162653_1000295242 | 3300012937 | Soil | RHRRLPARRRQVILPLAHHSALVALPVFAPALVVILVLLVHRMRERKRWEEEEAEH* |
Ga0162650_10000003214 | 3300012939 | Soil | MILPLAHHSLVVALPVFAPALVVIAVLVVHHLRGRRHWDEEPGA* |
Ga0164298_101905922 | 3300012955 | Soil | MILPLAHHSLVVALPVFAPALVIIAVLVVHHMRERRHWDEEEAS* |
Ga0164303_108936892 | 3300012957 | Soil | VILPLAHHNAIVALPVFAPAVVIVLVLIVHHLRERRHWDDEDEAASE |
Ga0164301_1000001634 | 3300012960 | Soil | VNLPLAHHNAIVALPVFAPALIVILVLLVHRLREGRHWDEEETDTSN* |
Ga0164302_100027302 | 3300012961 | Soil | VTLPLAHHSALVALPVFAPALVVILVLLVHRLRESRHWDEEEADS* |
Ga0164309_109192642 | 3300012984 | Soil | VNLPLAHHSALVALPVFAPALVVILVLLVHRLREGRHWDEEELDR* |
Ga0164308_104611073 | 3300012985 | Soil | MTLPLAHHNLVVALPVFAPAIIICLVLAVHHLRERGHWDEEADEEA* |
Ga0164307_101872392 | 3300012987 | Soil | VTLPLAHHNLVVALPVFAPAIVVVAVLVVHHLRERRHWQEEDAEG* |
Ga0164306_104295102 | 3300012988 | Soil | VILPLAHHNAIVALPVFAPALIVILFLLVHRMRERRRWEEEEADG* |
Ga0157371_100082157 | 3300013102 | Corn Rhizosphere | VILPLAHHNTIVALPVFAPAVVIVLVLIVHHLRERRHWDDEETET* |
Ga0157370_101062932 | 3300013104 | Corn Rhizosphere | VILPLAHHNAIVALPVFAPALVVILVLVVHHLRERRHWDEEEETQA* |
Ga0157369_1000034839 | 3300013105 | Corn Rhizosphere | VILPLAHHNAIVALPVFAPALVVILVLVVHHLRERRHWDEEEETQV* |
Ga0157378_100147333 | 3300013297 | Miscanthus Rhizosphere | VTLPLAHHNAIVALPVFAPALVVIVFLLVHRLRERRRWEEEEAEG* |
Ga0157378_100912415 | 3300013297 | Miscanthus Rhizosphere | MNLPLAHHSALVALPVFAPALVVILVLLVHRLREGRHWDEEKTDA* |
Ga0163162_114153982 | 3300013306 | Switchgrass Rhizosphere | MTLPLAHHTAVAALPVLAPALIVCIAVAIHYLRERRHWSEEGEE* |
Ga0157380_1000009224 | 3300014326 | Switchgrass Rhizosphere | VIVPLAHHSLVVALPVFAPALVVIAVIAVHYMRERRRWEEEERA* |
Ga0157380_101221793 | 3300014326 | Switchgrass Rhizosphere | VTLPLAHHSALVALPVFAPALVVILVLLVHRLREGRRWDEEEADNPS* |
Ga0157380_133157771 | 3300014326 | Switchgrass Rhizosphere | ALVALPVFAPALVVVLVLLVHNLRERRRWDEEETEG* |
Ga0182000_102467252 | 3300014487 | Soil | VNLPLAHHNAIVALPVFAPALVVIVFLLVHRLRERRRWEEEEAEG* |
Ga0182000_106190971 | 3300014487 | Soil | APTGPGRVPARRRQVILPLAHHSALVALPVFAPALVVILVLLVHRTRERRRWEEEEAEH* |
Ga0157376_100076843 | 3300014969 | Miscanthus Rhizosphere | MILPLAHHSAIVALPVFAPALVIVAVLAVHHLRERRHWDEEETEG* |
Ga0173480_100301512 | 3300015200 | Soil | VILPLAHHSLVVALPVFAPALVVIAVIAVHYLRERRRWDEEENGA* |
Ga0173478_106474112 | 3300015201 | Soil | VTLPLAHHSLVVALPVFAPALIVILFLLVHRMRERKRWEEEEADG* |
Ga0132258_113850771 | 3300015371 | Arabidopsis Rhizosphere | RVILPLAHHNAIAALPVFAPALLICVVLAIHHLRDRRHWDEEEEGVE* |
Ga0132255_1002299851 | 3300015374 | Arabidopsis Rhizosphere | VILPLAHHSALVALPVFAPALVIVAFLLVHRLRERRH |
Ga0163161_100097705 | 3300017792 | Switchgrass Rhizosphere | VTLPLAHHAAVAALPVLAPALIVCIAVAIHYLRERRHWAEEEES |
Ga0184611_10670662 | 3300018067 | Groundwater Sediment | VILPLAHHSALVALPVFAPALVVILVLLVHRMRERKRWEEEEAEH |
Ga0190265_108213782 | 3300018422 | Soil | VILPLAHHPILVSLPVFAPAVVIVLFLIVHRLREGRRWDEEEA |
Ga0066655_102570142 | 3300018431 | Grasslands Soil | MLPLAHHNAIVALPVFAPAIVVVLVLVVHHLRERRHWDEEEETEA |
Ga0190275_1000026812 | 3300018432 | Soil | VILPLAHHPILVSLPVFAPAMVIVVVLLVHHLRERKQWAEEEAAG |
Ga0190275_107407012 | 3300018432 | Soil | VIVPFADHPTVAALPVLAPALLICLVLAVHYLRERRHWDD |
Ga0190269_1000001949 | 3300018465 | Soil | VILPLAHHSALVALPVFAPALVVIVVLLVHRLREKRRWEEEEADG |
Ga0190269_104780152 | 3300018465 | Soil | VILPIAHHPILVSLPVFAPALVVVAVLVVHHLRERRRWDEEEAQ |
Ga0190269_110905842 | 3300018465 | Soil | VILPLAHHPILVSLPVFAPAVVIVLFLLVHRLREGRRWDEEEA |
Ga0190269_114012361 | 3300018465 | Soil | AHHPILVSLPVFAPAVVIVLFLLVHRLREGRRWDEEEAGS |
Ga0190274_100149753 | 3300018476 | Soil | MMLPLAHHAAVAALPVFAPALVVCIVLLVHHLRARRWDEEETPPGR |
Ga0190271_10000001123 | 3300018481 | Soil | MIDLPLAHHPVVAALPVFAPVLIVCAVLLFHHLRARRWDEEEAAAGDWGSAER |
Ga0190271_100002187 | 3300018481 | Soil | VTLPLAHHAAVAALPVFGPALAVLLVVAVHYLRHRGEWDDEEGEDAPGA |
Ga0190271_100404432 | 3300018481 | Soil | VILPLAHHSLVVALPVFAPALVVIAVIAVHYLRERRRWDEEENGA |
Ga0190273_1000015412 | 3300018920 | Soil | VILPLAHHSALVALPVFAPALIVILVLVVHRLRERRHWDEEGTGS |
Ga0190273_101406122 | 3300018920 | Soil | VILPLAHHSALVALPVFAPALVVILVLLVHRMRERRRWEEEEETG |
Ga0190273_102410971 | 3300018920 | Soil | RRRQVTLPLAHHTAIVALPVFAPALIVILVLVVHHLRERRHWDDEESEG |
Ga0190267_100103532 | 3300019767 | Soil | VILPLAHHSALIALPVFAPALVIVLVLLVHHLRERRHWDEEDEATER |
Ga0193738_10334092 | 3300020020 | Soil | VTLPLAHHSALVALPVFAPALIVILVLLVHRLREGRHWD |
Ga0206354_108808572 | 3300020081 | Corn, Switchgrass And Miscanthus Rhizosphere | VILPLAHHNAIVALPVFAPAVVIVLVLVVHHLRERRHWDDEDEAKTES |
Ga0196958_100044125 | 3300020181 | Soil | VILPLAHHPILVSLPVFAPAVVIVLFLVVHHLRERRRWEEEEV |
Ga0196958_102448191 | 3300020181 | Soil | VILPLAHHPVLVSLPVFAPAVVIVFVLLVHHMRERKRWAEEEAAG |
Ga0193699_100571982 | 3300021363 | Soil | VNLPLAHHNAIVALPVFAPALVVIFVLLVHRLREGRHWDEEEIDR |
Ga0247792_10119492 | 3300022880 | Soil | VILPLAHHNAIVALPVFAPALVIILVLAIHHLRERRHWDEEETEG |
Ga0247745_10021632 | 3300022898 | Soil | VILPLAHHSALVALPVFAPALVVILVLLVHRMRERRRWEEEETES |
Ga0247795_10008175 | 3300022899 | Soil | VILPLAHHSALVALPVFAPALVIVAVLLVHRLRERRHWDEESEA |
Ga0247768_1000009180 | 3300022910 | Plant Litter | VILPLAHHNAIVALPVFAPALIVILVLVVHHLRERRHWDDEEETQA |
Ga0247755_1000002119 | 3300023070 | Plant Litter | VTLPLAHHSLVVALPVFVPALVVILVLLVHRLRERRRWTEEETQG |
Ga0247752_10322162 | 3300023071 | Soil | VTLPLAHHSALVALPVFAPALVVILVLLVHRLREGRHWDEEETDG |
Ga0247802_10091542 | 3300023077 | Soil | VNLPLAHHNAIVALPVFAPALVVIVVLLVHRLREKRRWEEEEAEG |
Ga0247757_101541471 | 3300023097 | Plant Litter | MTLPLAHHNAIMALPVFAPALVVVLFLLVHRMRERR |
Ga0247789_10138472 | 3300023266 | Soil | VILPLAHHSALVALPVFAPALAIVAVLVVHRLRERRRWDEEEAE |
Ga0247765_10207472 | 3300023268 | Plant Litter | VILPLAHHSALVALPVFAPALVVILVLLVHRLREGRRWDEEELDA |
Ga0247765_10472942 | 3300023268 | Plant Litter | VILPLAHHNAIVALPVFAPALVIILVLAIHHLRERRH |
Ga0247776_100028084 | 3300023275 | Plant Litter | VTLPLAHHSLVVALPVFAPALVVILVIAVHYLRERRRWDEEEAG |
Ga0247794_100107282 | 3300024055 | Soil | VILPLAHHNTIVALPVFAPAIVIVLVLLVHHLRERRHWDEEQEVDRP |
Ga0196960_1000007635 | 3300024426 | Soil | MMLPLAHHPILISLPVFAPALVVVLVLLVHHLRERRHWDEEEAQG |
Ga0196960_100137362 | 3300024426 | Soil | VILPLAHHSALVALPVFAPALVVIAFLLVYRRREKRRWEAEGDA |
Ga0207656_1000013632 | 3300025321 | Corn Rhizosphere | VILPLAHHNAIVALPVFAPAVVIVLVLIVHHLRERRHWDDEDEAASES |
Ga0207656_100222172 | 3300025321 | Corn Rhizosphere | MNLPLAHHNAIVALPVFAPALIVILVLLVHRLREGRHWDEEETDA |
Ga0207680_101602473 | 3300025903 | Switchgrass Rhizosphere | VTLPLAHHSALVALPVFAPALVVILFLLVHRLREGRHWDEEEADNPS |
Ga0207705_104224642 | 3300025909 | Corn Rhizosphere | VNLPLAHHNAIVALPVFAPALVVILVLLVHRLREGRHWDEEEADG |
Ga0207654_100512763 | 3300025911 | Corn Rhizosphere | VILPLAHHNAIVALPVFAPAVVIVLVLVVHHLRERRHWDDEDEAAPER |
Ga0207693_1000102813 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | VNLPLAHHNAIVALPVFAPALVVILFLLVHRLRERKRWEEEEAEG |
Ga0207663_102620172 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | VTLPLAHHNLVVALPVFAPAIVVVLVLVVHHLRERRHWAE |
Ga0207657_113953731 | 3300025919 | Corn Rhizosphere | MTLPLAHHNAIVALPVFAPAIIICLVLFVHHLRERRHWDEEDADEGT |
Ga0207649_1000033341 | 3300025920 | Corn Rhizosphere | VILPLAHHNAIVALPVFAPALIVILFLLVHRMREKKRWEEEEAEN |
Ga0207650_100219597 | 3300025925 | Switchgrass Rhizosphere | VILPLAHHTAIVALPVFAPALIVIAVLVVHHLRERRHWDEEESEG |
Ga0207659_1000005438 | 3300025926 | Miscanthus Rhizosphere | VTLPLAHHNAIVALPVFAPALVVIVFLLVHRLRERRRWEEEEAAEASREIGPR |
Ga0207687_1000002750 | 3300025927 | Miscanthus Rhizosphere | VILPLAHHNAIVALPVFAPALVVILVLVVHHLRERRHWDDEEETEA |
Ga0207687_100299706 | 3300025927 | Miscanthus Rhizosphere | VILPLAHHNAIVALPVFAPAVVIVLVLVVHHLRERRHWDDEDEATTER |
Ga0207709_100060773 | 3300025935 | Miscanthus Rhizosphere | VILPLAHHSALVALPVFAPALVVILVLLVHRMREKRRWEEEEAEQS |
Ga0207704_1000009212 | 3300025938 | Miscanthus Rhizosphere | VILPLAHHNAIVALPVFAPALVVILVLIVHHLRERRHWDDEETEG |
Ga0207691_10000005125 | 3300025940 | Miscanthus Rhizosphere | VTLPLAHHSALVALPVFAPALVVVLVLLVHRMRERRRWEEEEAEG |
Ga0207711_10000019431 | 3300025941 | Switchgrass Rhizosphere | VILPLAHHNAIVALPVFAPALVVILVLVVHHLRERRHWDDEEETNA |
Ga0207711_106303873 | 3300025941 | Switchgrass Rhizosphere | VNLPLAHHIAIVALPVFAPALVVILVLLVHRLREGRHWDEEETDAS |
Ga0207661_100001555 | 3300025944 | Corn Rhizosphere | VNLPLAHHNAIVALPVFAPALVVIAFLLVHRLREKRRWEEEEAEG |
Ga0207661_100050355 | 3300025944 | Corn Rhizosphere | VNLPLAHHNAIVALPVFAPALVVILFLLVHRLRERKRWEEEEEAEG |
Ga0207661_100438372 | 3300025944 | Corn Rhizosphere | VILPLAHHSALVALPVFAPALVVILVLLVHRMREKRRWEEEEGGS |
Ga0207667_103201613 | 3300025949 | Corn Rhizosphere | VTLPLAHHSALVALPVFAPALIVILVLLVHRLREGRRWAEEEAETNS |
Ga0207668_112330961 | 3300025972 | Switchgrass Rhizosphere | VILPLAHHSALVALPVFAPALVVILVLLVHRLRESRHWDEGEADSNS |
Ga0207640_1000014034 | 3300025981 | Corn Rhizosphere | VILPLAHHNAIVALPVFAPAVVIVLVLIVHHLRERRHWDDEDEPATES |
Ga0207677_100127746 | 3300026023 | Miscanthus Rhizosphere | VILPLAHHSALVALPVFAPALVVILVLLVHRMRERKHWDEEEIEG |
Ga0207639_101021682 | 3300026041 | Corn Rhizosphere | VILPLAHHNAIVALPVFAPALVVILVLVVHHLRERRHWDEEESEG |
Ga0207702_1000319014 | 3300026078 | Corn Rhizosphere | VILPLAHHNAIVALPVFAPAIVVILVLIVHHLRERRHWD |
Ga0207702_1000965310 | 3300026078 | Corn Rhizosphere | VILPLAHHNAIVALPVFAPALIVILVLVVHHLRERKHWDDEETEA |
Ga0207674_101316032 | 3300026116 | Corn Rhizosphere | VTLPLAHHNAIMALPVFAPALVVILFLLIHRLRERRRWEEEDETLASEKSH |
Ga0207683_100525302 | 3300026121 | Miscanthus Rhizosphere | VTLPLAHHSALVALPVFAPALVVILVLLVHRLRESRRWDEEEADG |
Ga0207698_100000141 | 3300026142 | Corn Rhizosphere | VILPLAHHNAIVALPVFAPALIVILVLVVHHLRERRHWD |
Ga0207698_100000441 | 3300026142 | Corn Rhizosphere | PRPRLPAGRRQVILPLAHHNAIVALPVFAPALIVILVLVVHHLRERRHWDDEEETQA |
Ga0207698_100277372 | 3300026142 | Corn Rhizosphere | VTLPLAHHSALVALPVFAPALIVILVILVHRLREGRHWDEEEAESNS |
Ga0209265_10326683 | 3300026308 | Soil | VILPLAHHNAIVALPVFAPAIVVVLVLVVHHLRERRHWDEEEETEA |
Ga0209152_1000027012 | 3300026325 | Soil | VILPLAHHSALVALPVFAPALVVILVLLVHRMREKRRWEEEEAER |
Ga0207451_1034812 | 3300026774 | Soil | MTLPLAHHSALVALPVFAPALVVILVLLVHRLREGRRWDEEEANGNN |
Ga0209073_103308732 | 3300027765 | Agricultural Soil | VILPLAHHSALVALPVFAPALVVILVLLVHRFREGRHWDEEETDSPS |
Ga0209177_102188662 | 3300027775 | Agricultural Soil | MTLPLAHHNTIVALPVFAPAIVVVIVLVVHHLRERRRWEDEEDGA |
Ga0268266_1000192019 | 3300028379 | Switchgrass Rhizosphere | MTLPLAHHSALVALPVFAPALVVILVLLVHRLREGRRWDEEEADNPS |
Ga0268266_100114955 | 3300028379 | Switchgrass Rhizosphere | MNLPLAHHAAVAALPVFAPALIIITVLTIRYLRERRHWDEEAE |
Ga0268266_100304706 | 3300028379 | Switchgrass Rhizosphere | VTLPLAHHALVLALPVFAPALVVILVICVHYLRERKRWEEEGEA |
Ga0268266_114139112 | 3300028379 | Switchgrass Rhizosphere | GRRQVILPLAHHSALVALPVFAPALVVILVLLVYRFREGRRWDEEEADANN |
Ga0307321_10036041 | 3300028704 | Soil | VNLPLAHHNAIVALPVFAPALVVIVFLLIHRLRERRR |
Ga0307285_1000000511 | 3300028712 | Soil | VILPLAHHSALVALPVFAPALIVIVFLLVHRMRERRRWEEEEAEG |
Ga0307313_101979302 | 3300028715 | Soil | VTLPLAHHNAIVALPVFAPALVVIVFLLVHRLREK |
Ga0307315_100130652 | 3300028721 | Soil | VILPPAHHNAIVALPVFAPAVVIVLVLVVHHLRERRHWDEEDEDAPEQ |
Ga0307315_100388862 | 3300028721 | Soil | VILPLAHHNAIVALPVFAPALIVILVLVVHHLRERRHWNDEEETQA |
Ga0307315_102483032 | 3300028721 | Soil | MILPLAHHNAIVALPVFAPAIVVCLVLIIHHLRERGRWEDEEGEA |
Ga0307319_1000001911 | 3300028722 | Soil | VTLPLAHHSALVALPVFAPALIVILVLLVHRLRERKRWEEEEAEG |
Ga0307297_100079502 | 3300028754 | Soil | VILPLAHHTAIVALPVFAPALIVIGVLVVHHLRERRHWDEEEETQA |
Ga0307280_1000001311 | 3300028768 | Soil | VTLPLAHHSALVALPVFAPALVVILVLLVHRLREGRRWDEEEADG |
Ga0307288_10000011123 | 3300028778 | Soil | VILPLAHHNAIVALPVFAPAIVVILVLIVHHLRERRHWDEEEEMEA |
Ga0307288_1000011534 | 3300028778 | Soil | VTLPLAHHSALVALPVFAPALVVILVLLVHRLRERRRWEEEEAEG |
Ga0307306_1000004126 | 3300028782 | Soil | MILPLAHHSAIVALPVFAPALIVILVIVVHYLRERRHWD |
Ga0307323_102021382 | 3300028787 | Soil | HHSALVALPVFAPALVIVAILVVHRLREGRRWNEEEAE |
Ga0307503_10000001263 | 3300028802 | Soil | VTLPLAHHAAVAALPVFLPALIVCAVLLVHFLRERRHWDEEGDGDSA |
Ga0307503_100000567 | 3300028802 | Soil | VILPLAHHSALVALPVFAPALVVILVLLVHRMRERRRWEEEDGQG |
Ga0307314_100000464 | 3300028872 | Soil | VTLPLAHHNAIVALPVFAPALVVIVFLLVHRLREKRRWEEEEAES |
Ga0307314_100058335 | 3300028872 | Soil | VTLPLAHHNAIVALPVFAPALVVIIVLAIHHLRERRRWQDEESEQSGS |
Ga0307501_100860663 | 3300031152 | Soil | AGRRQMILPLAHHSLVVALPVFAPALVVIAVLAIHHLRERRHWDEETGA |
Ga0307405_104275292 | 3300031731 | Rhizosphere | VILPLAHHPILVSLPVFAPALVIVLFLLVHRLRERRHWDEEEA |
Ga0308175_10000005629 | 3300031938 | Soil | VILPLAHHNAIVALPVFAPALIVILFLLIHRMREKKRWEEEEAEN |
Ga0326721_1000002766 | 3300032080 | Soil | VILPLAHHPILVSLPVFAPAVVIVLFLIVHRLREGRRWEEEEA |
Ga0315910_10000001193 | 3300032144 | Soil | MLPLAHHAAVAALPVFAPALIVILVLAVRYLRERRHWDDEEPAAN |
Ga0315912_100100282 | 3300032157 | Soil | MTLPLAHHAAVAALPVFAPAVIVVLVLAVRYLRERRHWDDEPAEN |
Ga0307472_1003637642 | 3300032205 | Hardwood Forest Soil | MILPLAHHNAIVALPVFAPAIVIIFVLVVHHLRERRHWN |
Ga0307472_1012614012 | 3300032205 | Hardwood Forest Soil | VILPLAHHAAVAALPVFAPAVLICLVLAIHHLRERRHWDEEEDGL |
Ga0335075_103255932 | 3300032896 | Soil | MTLPLAHHAAVAALPVFAPALIIIAVLSINYLRNRHHWDDEP |
Ga0334918_021059_41_178 | 3300034000 | Hypolithic Biocrust | VTLPLAHHSALVALPVFAPALVVIVVLLVHRLRERKRWEEEEAEG |
Ga0334944_059785_350_490 | 3300034009 | Sub-Biocrust Soil | MILPLAHHSALVALPVFAPALVIIAFLLVHRRREKRRWEAEESATD |
Ga0334915_000022_10258_10395 | 3300034132 | Hypolithic Biocrust | VILPFAHHSALVALPVFAPALVIILGLLAYRRRERRRWEQEEAQG |
Ga0334916_019694_496_636 | 3300034133 | Hypolithic Biocrust | VILPLAHHNAIVALPVFAPALVVLLVLLVHHLRERRQWEDEEETQV |
Ga0334962_043307_76_216 | 3300034144 | Sub-Biocrust Soil | MILPLAHHAAVVALPVFAPALIVIGVLVVHHLRERRHWGEEEETKA |
Ga0334925_013234_621_755 | 3300034173 | Hypolithic Biocrust | VILPLAHHSAIVALPVFAPALVVILVLVVYHLRERRHWDEEETG |
Ga0334925_031070_677_814 | 3300034173 | Hypolithic Biocrust | MILPLAHHSALVALPVFAPALVIVAVLVVHHLRERRHWDEEETEG |
Ga0334925_072992_548_700 | 3300034173 | Hypolithic Biocrust | VTLPLAHHSALVALPVFAPALIVIVVLLVHRLRERKRWEEEEAAANREPR |
Ga0334905_000302_6923_7060 | 3300034687 | Soil | VILPLAHHSALVALPVFAPALIVIAVLVVHHLRERRHWDQEESEG |
⦗Top⦘ |