NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F017228

Metagenome Family F017228

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F017228
Family Type Metagenome
Number of Sequences 242
Average Sequence Length 37 residues
Representative Sequence VSSLAYLAAVNVVVWVGLFLYLWRLDRRISERERNR
Number of Associated Samples 190
Number of Associated Scaffolds 242

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 68.05 %
% of genes near scaffold ends (potentially truncated) 11.16 %
% of genes from short scaffolds (< 2000 bps) 80.17 %
Associated GOLD sequencing projects 181
AlphaFold2 3D model prediction Yes
3D model pTM-score0.47

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (98.760 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(10.744 % of family members)
Environment Ontology (ENVO) Unclassified
(26.033 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(34.298 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 53.12%    β-sheet: 0.00%    Coil/Unstructured: 46.88%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.47
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 242 Family Scaffolds
PF03100CcmE 47.93
PF01578Cytochrom_C_asm 13.22
PF08281Sigma70_r4_2 2.89
PF16327CcmF_C 2.48
PF09364XFP_N 2.07
PF09699Paired_CXXCH_1 2.07
PF03379CcmB 1.65
PF12706Lactamase_B_2 1.24
PF02852Pyr_redox_dim 0.83
PF13462Thioredoxin_4 0.83
PF16576HlyD_D23 0.83
PF00005ABC_tran 0.83
PF01041DegT_DnrJ_EryC1 0.41
PF07992Pyr_redox_2 0.41
PF01040UbiA 0.41
PF08309LVIVD 0.41
PF00115COX1 0.41
PF13517FG-GAP_3 0.41
PF02979NHase_alpha 0.41
PF13463HTH_27 0.41
PF07676PD40 0.41
PF00691OmpA 0.41
PF14686fn3_3 0.41
PF07690MFS_1 0.41
PF04028DUF374 0.41
PF04014MazE_antitoxin 0.41
PF13557Phenol_MetA_deg 0.41
PF00376MerR 0.41
PF13185GAF_2 0.41

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 242 Family Scaffolds
COG2332Cytochrome c biogenesis protein CcmEPosttranslational modification, protein turnover, chaperones [O] 47.93
COG2386ABC-type transport system involved in cytochrome c biogenesis, permease componentPosttranslational modification, protein turnover, chaperones [O] 1.65
COG0399dTDP-4-amino-4,6-dideoxygalactose transaminaseCell wall/membrane/envelope biogenesis [M] 0.41
COG0436Aspartate/methionine/tyrosine aminotransferaseAmino acid transport and metabolism [E] 0.41
COG0520Selenocysteine lyase/Cysteine desulfuraseAmino acid transport and metabolism [E] 0.41
COG0626Cystathionine beta-lyase/cystathionine gamma-synthaseAmino acid transport and metabolism [E] 0.41
COG1104Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS familyAmino acid transport and metabolism [E] 0.41
COG2121Uncharacterized conserved protein, lysophospholipid acyltransferase (LPLAT) superfamilyFunction unknown [S] 0.41
COG2873O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependentAmino acid transport and metabolism [E] 0.41
COG5276Uncharacterized secreted protein, contains LVIVD repeats, choice-of-anchor domainFunction unknown [S] 0.41


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.76 %
UnclassifiedrootN/A1.24 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908032|Perma_A_C_ConsensusfromContig147637All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum808Open in IMG/M
2162886012|MBSR1b_contig_7298227All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium982Open in IMG/M
2162886013|SwBSRL2_contig_2847455All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum1263Open in IMG/M
2162886013|SwBSRL2_contig_9305598All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1062Open in IMG/M
2209111007|2215194924All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium511Open in IMG/M
3300005328|Ga0070676_11055421All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium612Open in IMG/M
3300005332|Ga0066388_105831813All Organisms → cellular organisms → Bacteria623Open in IMG/M
3300005526|Ga0073909_10080851All Organisms → cellular organisms → Bacteria1248Open in IMG/M
3300005526|Ga0073909_10493964All Organisms → cellular organisms → Bacteria591Open in IMG/M
3300005543|Ga0070672_100002320All Organisms → cellular organisms → Bacteria12024Open in IMG/M
3300005545|Ga0070695_100517510All Organisms → cellular organisms → Bacteria925Open in IMG/M
3300005548|Ga0070665_100036253All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum4962Open in IMG/M
3300005549|Ga0070704_100643956All Organisms → cellular organisms → Bacteria935Open in IMG/M
3300005561|Ga0066699_10255060All Organisms → cellular organisms → Bacteria1239Open in IMG/M
3300005563|Ga0068855_100691556All Organisms → cellular organisms → Bacteria1092Open in IMG/M
3300005568|Ga0066703_10549881All Organisms → cellular organisms → Bacteria679Open in IMG/M
3300005598|Ga0066706_11372290All Organisms → cellular organisms → Bacteria533Open in IMG/M
3300005618|Ga0068864_101323687All Organisms → cellular organisms → Bacteria721Open in IMG/M
3300005719|Ga0068861_100379836All Organisms → cellular organisms → Bacteria1248Open in IMG/M
3300005764|Ga0066903_100079506All Organisms → cellular organisms → Bacteria4269Open in IMG/M
3300005764|Ga0066903_101047097All Organisms → cellular organisms → Bacteria → Acidobacteria1498Open in IMG/M
3300005764|Ga0066903_102031849All Organisms → cellular organisms → Bacteria1105Open in IMG/M
3300005764|Ga0066903_102232507All Organisms → cellular organisms → Bacteria1056Open in IMG/M
3300005764|Ga0066903_103277923All Organisms → cellular organisms → Bacteria875Open in IMG/M
3300005764|Ga0066903_106109410All Organisms → cellular organisms → Bacteria630Open in IMG/M
3300005836|Ga0074470_11622583All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium861Open in IMG/M
3300005843|Ga0068860_101598639All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium674Open in IMG/M
3300005937|Ga0081455_10010664All Organisms → cellular organisms → Bacteria9296Open in IMG/M
3300005938|Ga0066795_10056941All Organisms → cellular organisms → Bacteria1154Open in IMG/M
3300005993|Ga0080027_10152203All Organisms → cellular organisms → Bacteria889Open in IMG/M
3300005994|Ga0066789_10459782All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300005995|Ga0066790_10147546All Organisms → cellular organisms → Bacteria1007Open in IMG/M
3300006046|Ga0066652_100970072All Organisms → cellular organisms → Bacteria808Open in IMG/M
3300006163|Ga0070715_11044867All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300006173|Ga0070716_100976366All Organisms → cellular organisms → Bacteria668Open in IMG/M
3300006237|Ga0097621_100308804All Organisms → cellular organisms → Bacteria1399Open in IMG/M
3300006796|Ga0066665_10345651All Organisms → cellular organisms → Bacteria1212Open in IMG/M
3300006852|Ga0075433_10324758All Organisms → cellular organisms → Bacteria1361Open in IMG/M
3300006852|Ga0075433_11837676All Organisms → cellular organisms → Bacteria520Open in IMG/M
3300006854|Ga0075425_100534107All Organisms → cellular organisms → Bacteria1350Open in IMG/M
3300006854|Ga0075425_100673447All Organisms → cellular organisms → Bacteria1189Open in IMG/M
3300006854|Ga0075425_101378807All Organisms → cellular organisms → Bacteria798Open in IMG/M
3300006871|Ga0075434_101937433All Organisms → cellular organisms → Bacteria595Open in IMG/M
3300006876|Ga0079217_10092927All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum1336Open in IMG/M
3300006881|Ga0068865_100054162All Organisms → cellular organisms → Bacteria → Acidobacteria2786Open in IMG/M
3300006894|Ga0079215_11271802All Organisms → cellular organisms → Bacteria566Open in IMG/M
3300006904|Ga0075424_100768475All Organisms → cellular organisms → Bacteria1028Open in IMG/M
3300009012|Ga0066710_100439847All Organisms → cellular organisms → Bacteria1953Open in IMG/M
3300009012|Ga0066710_102299339All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium784Open in IMG/M
3300009029|Ga0066793_10015235All Organisms → cellular organisms → Bacteria4123Open in IMG/M
3300009038|Ga0099829_11458174All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium565Open in IMG/M
3300009053|Ga0105095_10163166All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1218Open in IMG/M
3300009089|Ga0099828_10038341All Organisms → cellular organisms → Bacteria3910Open in IMG/M
3300009090|Ga0099827_10329232All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1296Open in IMG/M
3300009147|Ga0114129_10065768All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum5060Open in IMG/M
3300009157|Ga0105092_10006724All Organisms → cellular organisms → Bacteria → Acidobacteria6057Open in IMG/M
3300009157|Ga0105092_10263698All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium969Open in IMG/M
3300009168|Ga0105104_10484564All Organisms → cellular organisms → Bacteria695Open in IMG/M
3300009174|Ga0105241_12119171All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium556Open in IMG/M
3300009792|Ga0126374_10106465All Organisms → cellular organisms → Bacteria1605Open in IMG/M
3300009803|Ga0105065_1026211All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum721Open in IMG/M
3300010043|Ga0126380_12271626All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium503Open in IMG/M
3300010046|Ga0126384_10218801All Organisms → cellular organisms → Bacteria1520Open in IMG/M
3300010046|Ga0126384_10457250All Organisms → cellular organisms → Bacteria1091Open in IMG/M
3300010336|Ga0134071_10180316All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum1036Open in IMG/M
3300010358|Ga0126370_10821916All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium831Open in IMG/M
3300010358|Ga0126370_11645498All Organisms → cellular organisms → Bacteria → Acidobacteria616Open in IMG/M
3300010359|Ga0126376_10909683All Organisms → cellular organisms → Bacteria871Open in IMG/M
3300010360|Ga0126372_11014495All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium842Open in IMG/M
3300010361|Ga0126378_10775235All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1069Open in IMG/M
3300010361|Ga0126378_12304831All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium615Open in IMG/M
3300010391|Ga0136847_11298733All Organisms → cellular organisms → Bacteria12501Open in IMG/M
3300010398|Ga0126383_11553863All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium751Open in IMG/M
3300010398|Ga0126383_13304911All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium527Open in IMG/M
3300010401|Ga0134121_10145594All Organisms → cellular organisms → Bacteria2017Open in IMG/M
3300010937|Ga0137776_1167388All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum3166Open in IMG/M
3300011270|Ga0137391_10226559All Organisms → cellular organisms → Bacteria → Acidobacteria1623Open in IMG/M
3300011270|Ga0137391_10817669All Organisms → cellular organisms → Bacteria → Acidobacteria767Open in IMG/M
3300011414|Ga0137442_1134602All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium547Open in IMG/M
3300012164|Ga0137352_1071602All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium688Open in IMG/M
3300012201|Ga0137365_10081276All Organisms → cellular organisms → Bacteria2442Open in IMG/M
3300012204|Ga0137374_10034630All Organisms → cellular organisms → Bacteria5451Open in IMG/M
3300012204|Ga0137374_10152316All Organisms → cellular organisms → Bacteria → Acidobacteria2062Open in IMG/M
3300012206|Ga0137380_10097660All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum2683Open in IMG/M
3300012206|Ga0137380_11147258All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium661Open in IMG/M
3300012209|Ga0137379_11435178All Organisms → cellular organisms → Bacteria → Acidobacteria593Open in IMG/M
3300012209|Ga0137379_11624417All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium545Open in IMG/M
3300012210|Ga0137378_10463933All Organisms → cellular organisms → Bacteria1172Open in IMG/M
3300012211|Ga0137377_10447964All Organisms → cellular organisms → Bacteria → Acidobacteria1229Open in IMG/M
3300012285|Ga0137370_10873972All Organisms → cellular organisms → Bacteria → Acidobacteria557Open in IMG/M
3300012350|Ga0137372_10588239All Organisms → cellular organisms → Bacteria → Acidobacteria818Open in IMG/M
3300012353|Ga0137367_10131817All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum1831Open in IMG/M
3300012353|Ga0137367_10313388All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum1121Open in IMG/M
3300012354|Ga0137366_10068762All Organisms → cellular organisms → Bacteria → Acidobacteria2699Open in IMG/M
3300012354|Ga0137366_10782267All Organisms → cellular organisms → Bacteria678Open in IMG/M
3300012355|Ga0137369_10466491All Organisms → cellular organisms → Bacteria898Open in IMG/M
3300012357|Ga0137384_10725982All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium806Open in IMG/M
3300012358|Ga0137368_10164789All Organisms → cellular organisms → Bacteria1619Open in IMG/M
3300012360|Ga0137375_10074533All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium3566Open in IMG/M
3300012360|Ga0137375_11158525All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium595Open in IMG/M
3300012361|Ga0137360_11546837All Organisms → cellular organisms → Bacteria568Open in IMG/M
3300012493|Ga0157355_1030291All Organisms → cellular organisms → Bacteria → Acidobacteria556Open in IMG/M
3300012931|Ga0153915_10298112All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1799Open in IMG/M
3300012948|Ga0126375_11086738All Organisms → cellular organisms → Bacteria658Open in IMG/M
3300012951|Ga0164300_10467673All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium712Open in IMG/M
3300012957|Ga0164303_10620360All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi715Open in IMG/M
3300012957|Ga0164303_11074929All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium579Open in IMG/M
3300012960|Ga0164301_10300619All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1080Open in IMG/M
3300012961|Ga0164302_10831128All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium701Open in IMG/M
3300012971|Ga0126369_10307508All Organisms → cellular organisms → Bacteria → Acidobacteria1589Open in IMG/M
3300012972|Ga0134077_10249858All Organisms → cellular organisms → Bacteria734Open in IMG/M
3300012989|Ga0164305_11043456All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium698Open in IMG/M
3300013306|Ga0163162_11854602All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium690Open in IMG/M
3300013764|Ga0120111_1162857All Organisms → cellular organisms → Bacteria → Acidobacteria504Open in IMG/M
3300014154|Ga0134075_10548354All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium521Open in IMG/M
3300014326|Ga0157380_12776715All Organisms → cellular organisms → Bacteria556Open in IMG/M
3300014882|Ga0180069_1186710All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium504Open in IMG/M
3300014969|Ga0157376_12045849All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium611Open in IMG/M
3300015085|Ga0167632_1047998All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium532Open in IMG/M
3300015090|Ga0167634_1021662All Organisms → cellular organisms → Bacteria920Open in IMG/M
3300015371|Ga0132258_10067372All Organisms → cellular organisms → Bacteria8285Open in IMG/M
3300015371|Ga0132258_10162926All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum5364Open in IMG/M
3300015371|Ga0132258_10824244All Organisms → cellular organisms → Bacteria2340Open in IMG/M
3300015372|Ga0132256_100689422All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum1137Open in IMG/M
3300015373|Ga0132257_100270584All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum2034Open in IMG/M
3300015374|Ga0132255_101382891All Organisms → cellular organisms → Bacteria1063Open in IMG/M
3300015374|Ga0132255_103603561All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum658Open in IMG/M
3300017654|Ga0134069_1316374All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium556Open in IMG/M
3300017927|Ga0187824_10037966All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1465Open in IMG/M
3300017930|Ga0187825_10066347All Organisms → cellular organisms → Bacteria1229Open in IMG/M
3300017944|Ga0187786_10197715All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium762Open in IMG/M
3300017947|Ga0187785_10256684All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium786Open in IMG/M
3300017959|Ga0187779_10041268All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum2676Open in IMG/M
3300017961|Ga0187778_10416537All Organisms → cellular organisms → Bacteria883Open in IMG/M
3300017961|Ga0187778_10806240All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium641Open in IMG/M
3300017961|Ga0187778_11074386All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium560Open in IMG/M
3300017966|Ga0187776_10126143All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum1551Open in IMG/M
3300017974|Ga0187777_10007260All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum6976Open in IMG/M
3300017974|Ga0187777_10110342All Organisms → cellular organisms → Bacteria → Acidobacteria1814Open in IMG/M
3300017997|Ga0184610_1254196All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium584Open in IMG/M
3300018000|Ga0184604_10078052All Organisms → cellular organisms → Bacteria982Open in IMG/M
3300018027|Ga0184605_10436873All Organisms → cellular organisms → Bacteria → Acidobacteria579Open in IMG/M
3300018031|Ga0184634_10064793All Organisms → cellular organisms → Bacteria1540Open in IMG/M
3300018031|Ga0184634_10202445All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium904Open in IMG/M
3300018031|Ga0184634_10218230All Organisms → cellular organisms → Bacteria871Open in IMG/M
3300018052|Ga0184638_1053061All Organisms → cellular organisms → Bacteria1476Open in IMG/M
3300018052|Ga0184638_1137304All Organisms → cellular organisms → Bacteria888Open in IMG/M
3300018053|Ga0184626_10214205All Organisms → cellular organisms → Bacteria814Open in IMG/M
3300018056|Ga0184623_10023269All Organisms → cellular organisms → Bacteria2762Open in IMG/M
3300018058|Ga0187766_10012283All Organisms → cellular organisms → Bacteria4900Open in IMG/M
3300018058|Ga0187766_10939519All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium612Open in IMG/M
3300018059|Ga0184615_10002968All Organisms → cellular organisms → Bacteria9118Open in IMG/M
3300018060|Ga0187765_11255544All Organisms → cellular organisms → Bacteria → Acidobacteria522Open in IMG/M
3300018061|Ga0184619_10349300All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium675Open in IMG/M
3300018063|Ga0184637_10103414All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1754Open in IMG/M
3300018068|Ga0184636_1206108All Organisms → cellular organisms → Bacteria697Open in IMG/M
3300018071|Ga0184618_10505326All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium506Open in IMG/M
3300018074|Ga0184640_10432411All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium588Open in IMG/M
3300018077|Ga0184633_10047024All Organisms → cellular organisms → Bacteria2191Open in IMG/M
3300018082|Ga0184639_10026363All Organisms → cellular organisms → Bacteria2940Open in IMG/M
3300018084|Ga0184629_10007960All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum4031Open in IMG/M
3300018084|Ga0184629_10214507All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum998Open in IMG/M
3300018422|Ga0190265_10178205All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum2113Open in IMG/M
3300018431|Ga0066655_11134570All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium549Open in IMG/M
3300018468|Ga0066662_10658983All Organisms → cellular organisms → Bacteria991Open in IMG/M
3300018482|Ga0066669_10002074All Organisms → cellular organisms → Bacteria8088Open in IMG/M
3300021073|Ga0210378_10018278All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum2851Open in IMG/M
3300021081|Ga0210379_10015516All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2834Open in IMG/M
3300021445|Ga0182009_10112099All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1258Open in IMG/M
3300021476|Ga0187846_10035929All Organisms → cellular organisms → Bacteria2230Open in IMG/M
3300021478|Ga0210402_10003815All Organisms → cellular organisms → Bacteria13976Open in IMG/M
3300021560|Ga0126371_10426531All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum1470Open in IMG/M
3300021560|Ga0126371_10555006All Organisms → cellular organisms → Bacteria → Acidobacteria1297Open in IMG/M
3300021560|Ga0126371_11306952All Organisms → cellular organisms → Bacteria → Acidobacteria859Open in IMG/M
3300023069|Ga0247751_1059155All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium652Open in IMG/M
3300025324|Ga0209640_10022321All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum5521Open in IMG/M
3300025324|Ga0209640_10927842All Organisms → cellular organisms → Bacteria676Open in IMG/M
3300025551|Ga0210131_1092261All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium524Open in IMG/M
3300025899|Ga0207642_10306793All Organisms → cellular organisms → Bacteria922Open in IMG/M
3300025904|Ga0207647_10552896All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium638Open in IMG/M
3300025910|Ga0207684_10002282All Organisms → cellular organisms → Bacteria19506Open in IMG/M
3300025910|Ga0207684_10036474All Organisms → cellular organisms → Bacteria → Acidobacteria4173Open in IMG/M
3300025922|Ga0207646_10393796All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum1251Open in IMG/M
3300025922|Ga0207646_10494197All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1103Open in IMG/M
3300025922|Ga0207646_11585030All Organisms → cellular organisms → Bacteria → Acidobacteria565Open in IMG/M
3300025936|Ga0207670_10931402All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium729Open in IMG/M
3300025939|Ga0207665_10630593All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium839Open in IMG/M
3300025942|Ga0207689_11493625All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium564Open in IMG/M
3300025960|Ga0207651_11242840All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium669Open in IMG/M
3300026067|Ga0207678_10369807All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum1238Open in IMG/M
3300026089|Ga0207648_11295157All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium685Open in IMG/M
3300026281|Ga0209863_10086186All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium926Open in IMG/M
3300026294|Ga0209839_10097331All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1007Open in IMG/M
3300026320|Ga0209131_1210010Not Available882Open in IMG/M
3300026350|Ga0256823_1037420All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium510Open in IMG/M
3300026538|Ga0209056_10253571All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1249Open in IMG/M
3300027252|Ga0209973_1033602All Organisms → cellular organisms → Bacteria → Acidobacteria732Open in IMG/M
3300027665|Ga0209983_1090689All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium688Open in IMG/M
3300027667|Ga0209009_1000200All Organisms → cellular organisms → Bacteria24371Open in IMG/M
3300027722|Ga0209819_10028293All Organisms → cellular organisms → Bacteria1884Open in IMG/M
3300027821|Ga0209811_10237205All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium694Open in IMG/M
3300027902|Ga0209048_10000689All Organisms → cellular organisms → Bacteria35713Open in IMG/M
3300027902|Ga0209048_10028650All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum4743Open in IMG/M
3300028379|Ga0268266_10998522All Organisms → cellular organisms → Bacteria810Open in IMG/M
3300028381|Ga0268264_12603839All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium510Open in IMG/M
3300030606|Ga0299906_10514200All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium916Open in IMG/M
3300030620|Ga0302046_10360295All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1195Open in IMG/M
3300031235|Ga0265330_10120740All Organisms → cellular organisms → Bacteria1117Open in IMG/M
3300031238|Ga0265332_10232226All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium764Open in IMG/M
3300031640|Ga0318555_10397113All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium747Open in IMG/M
3300031716|Ga0310813_11630297All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium603Open in IMG/M
3300031720|Ga0307469_10078180All Organisms → cellular organisms → Bacteria2228Open in IMG/M
3300031720|Ga0307469_10595025All Organisms → cellular organisms → Bacteria988Open in IMG/M
3300031720|Ga0307469_12257155Not Available530Open in IMG/M
3300031740|Ga0307468_100194040All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1365Open in IMG/M
3300031740|Ga0307468_100297655All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1169Open in IMG/M
3300031820|Ga0307473_10893334All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium641Open in IMG/M
3300031820|Ga0307473_11011063All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium608Open in IMG/M
3300031834|Ga0315290_10486189All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1078Open in IMG/M
3300032059|Ga0318533_11410511All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium509Open in IMG/M
3300032174|Ga0307470_11253965All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium605Open in IMG/M
3300032180|Ga0307471_100161897All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2174Open in IMG/M
3300032180|Ga0307471_100974726All Organisms → cellular organisms → Bacteria1015Open in IMG/M
3300032180|Ga0307471_101369858All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium868Open in IMG/M
3300032180|Ga0307471_104062307All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium517Open in IMG/M
3300032205|Ga0307472_100217561All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1468Open in IMG/M
3300032205|Ga0307472_102251607All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium551Open in IMG/M
3300032770|Ga0335085_10030367All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae7544Open in IMG/M
3300032783|Ga0335079_10444478All Organisms → cellular organisms → Bacteria1391Open in IMG/M
3300032828|Ga0335080_10557996All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum1209Open in IMG/M
3300033004|Ga0335084_10104325All Organisms → cellular organisms → Bacteria2945Open in IMG/M
3300033004|Ga0335084_11985818All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium567Open in IMG/M
3300033408|Ga0316605_10937556All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium829Open in IMG/M
3300033480|Ga0316620_11565592All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium652Open in IMG/M
3300033513|Ga0316628_100059774All Organisms → cellular organisms → Bacteria → Acidobacteria4025Open in IMG/M
3300033550|Ga0247829_10483901All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum1024Open in IMG/M
3300033550|Ga0247829_10754890All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium810Open in IMG/M
3300033803|Ga0314862_0148203All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium567Open in IMG/M
3300033814|Ga0364930_0151294All Organisms → cellular organisms → Bacteria792Open in IMG/M
3300033815|Ga0364946_152610All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium535Open in IMG/M
3300034176|Ga0364931_0328924All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium509Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil10.74%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment8.26%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil7.02%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil5.79%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland4.96%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.55%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.13%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.31%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere3.31%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.48%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.48%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere2.48%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment2.07%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.65%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil1.65%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.65%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.65%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil1.24%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.24%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.24%
Prmafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil1.24%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment1.24%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.24%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.83%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment0.83%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.83%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.83%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.83%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.83%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil0.83%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.83%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.83%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.83%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.83%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.41%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment0.41%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.41%
SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment0.41%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.41%
SedimentEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment0.41%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)0.41%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.41%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.41%
Unplanted SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil0.41%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.41%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.41%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Soil0.41%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.41%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.41%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.41%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand0.41%
BiofilmEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm0.41%
Speleothem And Rock Wall SurfacesEnvironmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Speleothem And Rock Wall Surfaces0.41%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere0.41%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.41%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.41%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.41%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.41%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.41%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.41%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.41%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.41%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908032Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Perma_allEnvironmentalOpen in IMG/M
2162886012Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1Host-AssociatedOpen in IMG/M
2162886013Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
2209111007Cave microbial community (Dry rock wall)EnvironmentalOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005568Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005836Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBBEnvironmentalOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005937Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300005938Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191EnvironmentalOpen in IMG/M
3300005993Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046EnvironmentalOpen in IMG/M
3300005994Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049EnvironmentalOpen in IMG/M
3300005995Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006876Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200EnvironmentalOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006894Agricultural soil microbial communities from Utah to study Nitrogen management - NC ControlEnvironmentalOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009029Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009053Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009157Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009168Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015EnvironmentalOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300009803Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_40_50EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010336Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010391Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010937Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139EnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300011414Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT266_2EnvironmentalOpen in IMG/M
3300012164Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT730_2EnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012353Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012355Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012358Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012493Unplanted soil (control) microbial communities from North Carolina - M.Soil.10.yng.090610EnvironmentalOpen in IMG/M
3300012931Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaGEnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012972Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013764Permafrost microbial communities from Nunavut, Canada - A28_35cm_6MEnvironmentalOpen in IMG/M
3300014154Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015EnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014882Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT231B'_16_10DEnvironmentalOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015085Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G4B, Ice margin, adjacent to proglacial lake)EnvironmentalOpen in IMG/M
3300015090Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G5A, Northern proglacial tributary margin, adjacent to top of river)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017654Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300017927Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4EnvironmentalOpen in IMG/M
3300017930Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5EnvironmentalOpen in IMG/M
3300017944Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MGEnvironmentalOpen in IMG/M
3300017947Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MGEnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300017961Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MGEnvironmentalOpen in IMG/M
3300017966Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MGEnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300017997Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coexEnvironmentalOpen in IMG/M
3300018000Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coexEnvironmentalOpen in IMG/M
3300018027Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coexEnvironmentalOpen in IMG/M
3300018031Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1EnvironmentalOpen in IMG/M
3300018052Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2EnvironmentalOpen in IMG/M
3300018053Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1EnvironmentalOpen in IMG/M
3300018056Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1EnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018059Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coexEnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018061Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1EnvironmentalOpen in IMG/M
3300018063Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2EnvironmentalOpen in IMG/M
3300018068Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_b2EnvironmentalOpen in IMG/M
3300018071Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1EnvironmentalOpen in IMG/M
3300018074Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2EnvironmentalOpen in IMG/M
3300018077Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1EnvironmentalOpen in IMG/M
3300018082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2EnvironmentalOpen in IMG/M
3300018084Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1EnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300021073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redoEnvironmentalOpen in IMG/M
3300021081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redoEnvironmentalOpen in IMG/M
3300021445Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaGEnvironmentalOpen in IMG/M
3300021476Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2)EnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300023069Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S049-202B-5EnvironmentalOpen in IMG/M
3300025324Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes)EnvironmentalOpen in IMG/M
3300025551Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025904Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026281Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 (SPAdes)EnvironmentalOpen in IMG/M
3300026294Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes)EnvironmentalOpen in IMG/M
3300026320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026350Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 7-17 PU6EnvironmentalOpen in IMG/M
3300026538Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)EnvironmentalOpen in IMG/M
3300027252Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027665Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027667Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027722Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027821Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027902Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes)EnvironmentalOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300030606Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT145D125EnvironmentalOpen in IMG/M
3300030620Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111EnvironmentalOpen in IMG/M
3300031235Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaGHost-AssociatedOpen in IMG/M
3300031238Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaGHost-AssociatedOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031834Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033408Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCTEnvironmentalOpen in IMG/M
3300033480Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_BEnvironmentalOpen in IMG/M
3300033513Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_CEnvironmentalOpen in IMG/M
3300033550Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4EnvironmentalOpen in IMG/M
3300033803Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_0_10EnvironmentalOpen in IMG/M
3300033814Sediment microbial communities from East River floodplain, Colorado, United States - 55_j17EnvironmentalOpen in IMG/M
3300033815Sediment microbial communities from East River floodplain, Colorado, United States - 31_s17EnvironmentalOpen in IMG/M
3300034176Sediment microbial communities from East River floodplain, Colorado, United States - 21_j17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Perma_A_C_026308802124908032SoilTMSSLAFLASVNAVIWVGLFFYLWRLDRRISARERER
MBSR1b_0482.000004402162886012Miscanthus RhizosphereVSSLAYLAAVNVVVWVGLFLYLWRLDRRISERERTR
SwBSRL2_0317.000046202162886013Switchgrass RhizosphereFVSSLAYLAAVNVVVWVGLFLYLWRLDRRISERERTR
SwBSRL2_0524.000036102162886013Switchgrass RhizosphereVSSLAFLAVVNIVIWAGLFLYVWRLDRRLAEMEKNR
22142703582209111007Speleothem And Rock Wall SurfacesTRIMSALGYLAAVNVVIWVGLFFYLWRLDRRISERERSR
Ga0070676_1105542123300005328Miscanthus RhizosphereFGVVPRQTEPVSSLAYLALVNVVVWVGLFLYLWRLERRISEQERNR*
Ga0066388_10583181323300005332Tropical Forest SoilVSSLGFLAAVNVVVWVGLFLYLWRLDRRISEAERERPKG*
Ga0070698_10094347813300005471Corn, Switchgrass And Miscanthus RhizosphereETGSVRSLGYLAAVNVVIWVGLFLYLWRLDRRISEAERKP*
Ga0073909_1008085133300005526Surface SoilVSSLAFLATVNLVIWAGLFFYLWRLDRRISARERER*
Ga0073909_1049396413300005526Surface SoilVNSLAFLATVNVVIWAGLFFYLWRLDRRIAARERER*
Ga0070672_100002320123300005543Miscanthus RhizosphereVSSLGYLAAVNVVVWVGLFFYLWRLDRRIEQLDRRR*
Ga0070695_10051751033300005545Corn, Switchgrass And Miscanthus RhizosphereVSSLGCLAAVNVVVWVGLFLYLWRLDRRITEREKEAGALRR*
Ga0070665_10003625353300005548Switchgrass RhizosphereMTSLGYLAAVNVVIWIGLFVYLWRLDRRVSEKERSR*
Ga0070704_10064395613300005549Corn, Switchgrass And Miscanthus RhizosphereVIHRQTAPVSSLAYLAAVNVVVWVGLFLYLWRLDRRISEQERNR*
Ga0066699_1025506023300005561SoilMRSLGYLAAVNVVIWVGLFFYLWRLDRRISEKERSR*
Ga0068855_10069155623300005563Corn RhizosphereVSSLAYLAAVNVVVWVGLFLYLWRLDRRISERERTR*
Ga0066703_1054988123300005568SoilVSSLGFLAAVNIVIWIGLFFYVWRLDRRLTERERDR*
Ga0066706_1137229013300005598SoilPRMSLVFLAAVNVIIWTGLFVYLWRLDRRISAREKEQ*
Ga0068864_10132368723300005618Switchgrass RhizosphereMNSLGYLAAVNVVIWVGLFAYLWRLDRRVSERERS*
Ga0068861_10037983613300005719Switchgrass RhizosphereVGSLGYLAAVNVVVWVGLFLYLWRLDRRLAEAEKKELR*
Ga0066903_10007950653300005764Tropical Forest SoilVNSLAFLAAVNVVIWVGLFFYLWRLDRRVTEREREK*
Ga0066903_10104709733300005764Tropical Forest SoilVGSLGYLAAVNVVIWVGLFVYLWRLDRRVSDVERKS*
Ga0066903_10203184933300005764Tropical Forest SoilVNSLGYLAAVNLVIWAGLFFYVWRLDRRISEKEREP*
Ga0066903_10223250723300005764Tropical Forest SoilVSSLAYLAAVNLVIWVGLFFYLWRLDRRISQKGDQ*
Ga0066903_10327792323300005764Tropical Forest SoilVSSLGYLAAVNVVVWFGLFFYLWRLDRRIDRLDRRRQETR*
Ga0066903_10610941023300005764Tropical Forest SoilVNSLAYLAAVNILIWVGLFAYLWRLDRRLGLLEAERERKR*
Ga0074470_1162258323300005836Sediment (Intertidal)MSSLGYLAAVNVVIWVGLFFYLWRLDRRLTESERKS*
Ga0068860_10159863913300005843Switchgrass RhizosphereMSSLGFLAVVNGVIWGGLFFHLWRLDRRIAGKGTEK*
Ga0081455_1001066453300005937Tabebuia Heterophylla RhizosphereVGSLGYLAAVNVVIWVGLFLYLWRLDRRISEAERKP*
Ga0066795_1005694123300005938SoilMSSLAFLASVNAVIWVGLFFYLWRLDRRISARERER*
Ga0080027_1015220323300005993Prmafrost SoilVNSLAFLAAVNVVIWVGLFVYLWRLDRRISERERDR*
Ga0066789_1045978223300005994SoilMSSLGYLAAVNVVIWVGLFAYLWRLDRRLADGEGGR*
Ga0066790_1014754633300005995SoilMNSLAFLAAVNLVIWLGLFLFLWRLDRKISERERNR*
Ga0066652_10097007213300006046SoilVSLVFLAAVNVIIWTGLFVYLWRLDRRISAREKEQ*
Ga0070715_1104486713300006163Corn, Switchgrass And Miscanthus RhizosphereVSSLGYLAAVNLVIWAGLFFYVWRLDRRISEKEREP*
Ga0070716_10097636623300006173Corn, Switchgrass And Miscanthus RhizosphereVNSSLAFLAAVNLVIWAGLFAYLWRLDRRISERERER*
Ga0097621_10030880433300006237Miscanthus RhizosphereVSSLGYLAAVNVVVWFGLFFFLWRLDRRIEQLDRRR*
Ga0066665_1034565123300006796SoilVNSLFFLAAVNVVIWVGLFFYLWRLDRRISAREGER*
Ga0075433_1032475833300006852Populus RhizosphereVNSLAFLAAVNLVIWAGLFFYLWRLDRQLSERERQE*
Ga0075433_1183767623300006852Populus RhizosphereVSSLAYLAIVNIVIWAGLFLYLWRLDRRLTERERNR*
Ga0075425_10053410723300006854Populus RhizosphereVHSLRYLAAVNVVVWAGLFFYLWRLDRRVSERERRDGEES*
Ga0075425_10067344713300006854Populus RhizosphereMTSLGYLAAVNIVIWIGLFVYLWRLDRRVSEKERSR*
Ga0075425_10137880723300006854Populus RhizosphereVRSLAYLAAVNVVIWVGLFLYLWRLDRRISERESSR*
Ga0075434_10193743323300006871Populus RhizosphereVNSLAFLAAVNVIIWAGLFFYLWRLDQRIARKEKER*
Ga0079217_1009292733300006876Agricultural SoilVNSLAFLATVNVVVWAGLFLYLWRLDRRITERERNR*
Ga0068865_10005416243300006881Miscanthus RhizosphereVSSLGYLAAVNVVVCVGLFFYLWRLDRRIEQLDRRR*
Ga0079215_1127180213300006894Agricultural SoilVNSLAFLATVNVVVWAGLFLYLWRLDRRIAERERNR*
Ga0075424_10076847513300006904Populus RhizosphereVSSLAYLAAVNLVIWVGLFYYLWRLDRRISQKGGDQ*
Ga0066710_10043984733300009012Grasslands SoilMNSLAFLATVNVVIWVGLFFYLWRLDRRISARERER
Ga0066710_10229933923300009012Grasslands SoilVNSLVFLAGVNVVIWAGLFFYLWRLDRRISAREEER
Ga0066793_1001523513300009029Prmafrost SoilQERNNRTMSSLAFLASVNAVIWVGLFFYLWRLDRRISTRERER*
Ga0099829_1145817423300009038Vadose Zone SoilVSSLGFLAAVNVVIWVGLFFYLWRIDRRIAEKERES*
Ga0105095_1016316623300009053Freshwater SedimentVKSLGYLAAVNVVIWVGLYFYLWRLDRRLTESERKP*
Ga0099828_1003834133300009089Vadose Zone SoilVSSLGFLAAVNVVIWVGLFFYLWRIDRRIAEKERER*
Ga0099827_1032923223300009090Vadose Zone SoilVNSLAFLAAVNVVIWVGLFFYLWRIDRRIAEKEQGR*
Ga0114129_1006576833300009147Populus RhizosphereVSSLAYLAAVNIVIWIGLFFYVWRLDRRLTERERNR*
Ga0105092_1000672453300009157Freshwater SedimentVGSLGYLAAVNVVIWVGLFVYLWRLDRRISEAERKS*
Ga0105092_1026369833300009157Freshwater SedimentVSSLGYLAAVNVVVWAGLFFYLWRLDRRLSEKEREP*
Ga0105104_1048456423300009168Freshwater SedimentMSSLGYLAAVNVVIWVGLFAYLWRLDRRLSEKESGR*
Ga0105241_1211917113300009174Corn RhizospherePLVSLVFLAAVNVIIWIGLFAYLWRLDRRISARERER*
Ga0126374_1010646533300009792Tropical Forest SoilVSSLAFLATVNVVIWAGLFFYLWRLDRRIAARERER*
Ga0105065_102621123300009803Groundwater SandVRSLGYLAAVNVVIWVGLFLYLWRLDRRIAESERER*
Ga0126380_1227162623300010043Tropical Forest SoilVSSLAYLAAVNVVIWVGLFFYLWRLDRRISQKGGDQ*
Ga0126384_1021880123300010046Tropical Forest SoilMNSLFFLAAVNVVIWVGLFFYIWRLDRRLAERERER*
Ga0126384_1045725023300010046Tropical Forest SoilMNSLAFLATVNVVIWVGLFLYLWRLDRRISARERER*
Ga0134071_1018031613300010336Grasslands SoilGLGEKDRRVSSLAYLAVVNIVIWAGLFLYLWRLDRRLTERERDR*
Ga0126370_1082191623300010358Tropical Forest SoilMNSLAFLAAVNVVIWVGLFFYLWRLDRRISARERER*
Ga0126370_1164549813300010358Tropical Forest SoilVSSLAYLAAVNLVIWVGLFFYLWRLDRRISQKGGDQ*
Ga0126376_1090968323300010359Tropical Forest SoilVGSLGYLAAVNVVIWVGLFVYLWRLDRRVSEGERKP*
Ga0126372_1101449523300010360Tropical Forest SoilVNSLAYLAAVNILIWVGLFAYLWRLDRRLALMEAEKEKER*
Ga0126378_1077523533300010361Tropical Forest SoilVSSLAYLALVNLVIWVGLFFYVWRLDRRVSRKESDQ*
Ga0126378_1230483123300010361Tropical Forest SoilVGSLGYLAAVNVVIWVGLFVYLWRLDRRVSDAERKP*
Ga0136847_11298733133300010391Freshwater SedimentVSSLAYLAAANVVIWVGLFLYLWRLDRRISSKEREP*
Ga0126383_1155386333300010398Tropical Forest SoilMTSLGYLAAVNVVIWVGLFVYLWRLDRRVSEKERSR*
Ga0126383_1330491113300010398Tropical Forest SoilVGSLGYLAAVNVVIWVGLFFYLWRLDRRIAEIEKTERSAR*
Ga0134121_1014559423300010401Terrestrial SoilVNSLAFLAAVNLVIWTGLFVYLWRLDGKISEREREH*
Ga0137776_116738833300010937SedimentVGSLGYLAAVNVVIWVGLFVYLWRLDRRLSDAERKS*
Ga0137391_1022655933300011270Vadose Zone SoilVNSLLFLAAVNVVIWVGLFFYLWRLDRRISAREGER*
Ga0137391_1081766923300011270Vadose Zone SoilMNSLFFLASVNVVIWVGLFFYLWRIDRRIAEKERGG*
Ga0137442_113460213300011414SoilVSSLAYLATVNVVVWVGLFVYLWRLDRRISERERNR*
Ga0137352_107160223300012164SoilVSSLAYLAAVNVVVWVGLFLYLWRIDRRIAEQERNR*
Ga0137365_1008127633300012201Vadose Zone SoilLVSSLAFLAAVNVVIWIGLFFYVWRLDRRLTERERNR*
Ga0137374_1003463023300012204Vadose Zone SoilMSSLAFLAAVNIVIWIGLFFYVWRLDRRLTQRERNR*
Ga0137374_1015231633300012204Vadose Zone SoilVNSLTFLAAVNVVIWVGLFGYLWWLDRRLTEREKQQ*
Ga0137380_1009766023300012206Vadose Zone SoilVSSLAFLAAVNVVIWIGLFFYVWRLDRRLTERERNR*
Ga0137380_1114725823300012206Vadose Zone SoilMNSLFFLASVNVVIWVGLFFYLWRIDRRIAEKERES*
Ga0137379_1143517823300012209Vadose Zone SoilMSSLAYLAVVNVVIWIGLFFYIWRLDRRVSRKESER*
Ga0137379_1162441713300012209Vadose Zone SoilMNSLFFLASVNVVIWVGLFFYLWRIDRRIAEKEREG*
Ga0137378_1046393323300012210Vadose Zone SoilMNSLFFLASVNVVIWVGLFFYLWRIDRRSAETEREG*
Ga0137377_1044796433300012211Vadose Zone SoilVNSLAFLAAVNVVIWVGLFFYLWRIDRRIAEKEKER*
Ga0137370_1087397213300012285Vadose Zone SoilVSSLAFLAAVNVVIWVGLFFYLWRIDRRIAEKEQER*
Ga0137372_1058823923300012350Vadose Zone SoilMSSLAFLAAVNAIIWVGLFFYLWRLDRRISARERER*
Ga0137367_1013181723300012353Vadose Zone SoilVSSLAFLAAVNIVIWIGLFFYVWRLDRRLAERERNR*
Ga0137367_1031338813300012353Vadose Zone SoilVSSLAFLAAVNIVIWIALFFYVWRLDRRLTQRERNR*
Ga0137366_1006876233300012354Vadose Zone SoilMSSLFFLAAVNVVIWVGLFFYLWRIDRRIAEKEQER*
Ga0137366_1078226713300012354Vadose Zone SoilMNSLAFLATVNVVIWVGLFFYLWRLDRRISARERER*
Ga0137369_1046649123300012355Vadose Zone SoilMSGLAFLATVNIVIWAGLFLYVWRLDRRLAERERNR*
Ga0137384_1072598223300012357Vadose Zone SoilMNSLFFLASVNVVIWVGLFFYLWRIDRRIAEKERER*
Ga0137368_1016478933300012358Vadose Zone SoilVSSLAFLAAVNIVVWVGLFFYVWRLDRRLTQRERNR*
Ga0137375_1007453313300012360Vadose Zone SoilNRSMSSLAFLAAVNIVIWIGLFFYVWRLDRRLTQRERNR*
Ga0137375_1115852513300012360Vadose Zone SoilSLAFLATVNVVIWVGLFFYLWRLDRRISTREREP*
Ga0137360_1154683723300012361Vadose Zone SoilVSLVFLAAVNVIIWIGLFAYLWRLDRRISARERER*
Ga0157355_103029123300012493Unplanted SoilVNNSLAFLAAVNLVIWTGLFLYMWRLDRRISERERER*
Ga0153915_1029811233300012931Freshwater WetlandsVSSLAYLAVVNIVIWAGLFLYLWRLDRRLTERERNR*
Ga0126375_1108673823300012948Tropical Forest SoilMNSLAFLATVNVVIWVGLFFYLWRLDRRISAQERER*
Ga0164300_1046767333300012951SoilVSLTFLAAVNVVIWIGLFVYLWRIDRRLSARERER*
Ga0164303_1062036013300012957SoilMSSLGFLAVVNGVIWAGLFDHLKRLDQRIAGKEGKQK*
Ga0164303_1107492923300012957SoilVSLTFLAAVNVVIWIGLFVYLWRLDRRISARERER*
Ga0164301_1030061933300012960SoilMNSLGYLAAVNVVIWVGLFLYLWRLDRRLAEREKGPSR*
Ga0164302_1083112823300012961SoilMSSLAFLAVVNGVIWAGLFFHLRQIDRRITESEGTRK*
Ga0126369_1030750833300012971Tropical Forest SoilVSSLGYLAAVNVVVWFGLFFYLWRLDRRIDQLDRRRQETR*
Ga0134077_1024985823300012972Grasslands SoilLGEKDRRVSSLAYLAVVNIVIWAGLFLYLWRLDRRLTERERDR*
Ga0164305_1104345623300012989SoilVSSLAYLAAVNVVVWVGLFLYLWRLDRRISERERSR*
Ga0163162_1185460213300013306Switchgrass RhizosphereMSSLGFLAVVNGVIWGGLFCHLWRLDRRIAGKGTEK*
Ga0120111_116285713300013764PermafrostVNSLGYLAAVNVVIWVGLFLYLWRLDRRISEGELREMKK*
Ga0134075_1054835423300014154Grasslands SoilLGLGEKDRRVSSLAYLAVVNIVIWAGLFLYLWRLDRRLTERERDR*
Ga0157380_1277671523300014326Switchgrass RhizosphereVSSLAYLALVNVVVWVGIFLYLWRLERRITEQERSR*
Ga0180069_118671023300014882SoilVSSLAFLAAVNVVVWVGLFLYLWRIDRRIAEQEQNR*
Ga0157376_1204584913300014969Miscanthus RhizospherePMNSLGYLAAVNVVIWVGLFAYLWRLDRRVSERERS*
Ga0167632_104799823300015085Glacier Forefield SoilMNSLGFLAAVNVVVWAGLFLYLWRLDRRISERERER*
Ga0167634_102166223300015090Glacier Forefield SoilMSSLAFLAAVNVVIWAGLFLYLWRLDRRISERERDR*
Ga0132258_1006737273300015371Arabidopsis RhizosphereVSSLGYLAAVNVVVWVGLFLYLWRLDRRIEQLDRRR*
Ga0132258_1016292633300015371Arabidopsis RhizosphereVSSLGYLAAVNVVIWVGLFFYLWRLDRRLTESERKP*
Ga0132258_1082424433300015371Arabidopsis RhizosphereVNSLAFLAAVNLVIWTGLFAYLWRLDRRISERERER*
Ga0132256_10068942213300015372Arabidopsis RhizosphereVSSLAFLATVNVVIWAGLFFYLWRLDRRISARERER*
Ga0132257_10027058413300015373Arabidopsis RhizosphereSLGYLAAVNVVIWVGLFLYLWRLDRRISEAERKP*
Ga0132255_10138289113300015374Arabidopsis RhizosphereLNSLAFLAAVNIVIWIGLFFYLWRLDRKLSEKGREP*
Ga0132255_10360356133300015374Arabidopsis RhizosphereSGVSSLAFLATVNLVIWAGLFFYLWRLDRRISARERER*
Ga0134069_131637423300017654Grasslands SoilVNSLVFLAAVNVVIWAGLFFYLWRLDRRISAREEER
Ga0187824_1003796623300017927Freshwater SedimentMTSLGYLAAVNVVIWIGLFVYLWRLDRRVSEKERSR
Ga0187825_1006634723300017930Freshwater SedimentMSSLAFLAAVNVVIWVGLFFYLWRLDRRVTEGERQK
Ga0187786_1019771523300017944Tropical PeatlandVSSLGYLAAVNVVIWVGLFLYLWRLDRRISGKEREP
Ga0187785_1025668433300017947Tropical PeatlandMTSLGYLAAVNVVIWVGLFAYLWRLDRRVSEKERSR
Ga0187779_1004126833300017959Tropical PeatlandVSSLAYLAAVNLVIWGGLFFYLWRLDRRISGKESGR
Ga0187778_1041653713300017961Tropical PeatlandVTSLAYLAAVNLVIWGGLFFYLWRLDRRISGKEGGR
Ga0187778_1080624013300017961Tropical PeatlandNNGPVTSLAYLAAVNLVIWGGLFFYLWRLDRRISGKESGR
Ga0187778_1107438613300017961Tropical PeatlandMGSLGYLAAVNVVIWVGLYLYLWRLDRRVSDAERKP
Ga0187776_1012614333300017966Tropical PeatlandVSSLGYLAAVNVVIWVGLFLYLRRLDRRISGKEREP
Ga0187777_1000726033300017974Tropical PeatlandVSSLAYLAVVNLVIWGGLFFYLWRLDRRISGKESGR
Ga0187777_1011034233300017974Tropical PeatlandMGSLGYLAAVNVVIWVGLFLYLWRLDRRVSDAERKP
Ga0184610_125419633300017997Groundwater SedimentPVSSLAYLAIVNVVVWVGLFFYLWRLDRRISERERNP
Ga0184604_1007805213300018000Groundwater SedimentVSSLAYLALVNVVVWVGLFLYLWRLDRRISEQERNR
Ga0184605_1043687323300018027Groundwater SedimentVNSLAFLAAVNVVIWVGLFFYLWRIDRRIAEKEQER
Ga0184634_1006479313300018031Groundwater SedimentMTSLAYLASVNVVIWAGLFFYLWRLDRRISEQERGR
Ga0184634_1020244513300018031Groundwater SedimentVRSLGYLAGVNVVIWVGLFFYLWRLDRRISELERKP
Ga0184634_1021823023300018031Groundwater SedimentVNSLAYLAAANVVIWVGLFFTLWRLDRRISEKERER
Ga0184638_105306133300018052Groundwater SedimentVSSLAYLATVNVVVWVGLFVYLWRLDRRISERERNQ
Ga0184638_113730423300018052Groundwater SedimentVSSLAFLAAVNIVIWIGLFFYVWRLDRRLTERERNR
Ga0184626_1021420523300018053Groundwater SedimentVLVSSLAYLATVNVVVWVGLFLYLWRLNRRISERELNR
Ga0184623_1002326923300018056Groundwater SedimentVSSLAYLAIVNVVVWVGLFFYLWRLDRRISERERNP
Ga0187766_1001228333300018058Tropical PeatlandMVSSLAYLALVNLVIWVGLFFYVWRLDRRVSRKEGDS
Ga0187766_1093951913300018058Tropical PeatlandVTSLAYLAAVNLVIWGGLFFYLWRLDRRISGKESGR
Ga0184615_1000296833300018059Groundwater SedimentVSSLAYLATVNVVVWVGLFVYLWRLDRRISEQERNR
Ga0187765_1125554413300018060Tropical PeatlandVSSLGYLAAVNLVIWAGLFFYVWRLDRRISERERER
Ga0184619_1034930023300018061Groundwater SedimentVNSLAFLAAVNVVIWMGLFFYLWRIDRRIAEKEQER
Ga0184637_1010341423300018063Groundwater SedimentVNSLAYLASVNVVIWAGLFFYLWRLDRRISEQERGR
Ga0184636_120610823300018068Groundwater SedimentVSSLGYLATVNVVVWVGLFVYLWRLDRRISEQERNR
Ga0184618_1050532623300018071Groundwater SedimentVSSLAYLATVNVVVWVGLFLYLWRLDRRISERERNR
Ga0184640_1043241123300018074Groundwater SedimentVRSLGYLAGVNVVIWVGLFFYLWRLDRRISESERKP
Ga0184633_1004702433300018077Groundwater SedimentVNSLAYLAAANVVIWVGLFFYLWRPDRPISERERGR
Ga0184639_1002636333300018082Groundwater SedimentVNSLAYLAAANVVIWVGLFFYLWRLDRRISEREEGR
Ga0184629_1000796033300018084Groundwater SedimentVSSLAYLAAVNVVVWVGLFLYLWRIDRRIAEQERNR
Ga0184629_1021450723300018084Groundwater SedimentVSSLGYLATVNVVVWVGLFVYLWRLDQRISQRERNR
Ga0190265_1017820533300018422SoilVNSLVYLAAVNIVIWSGLFIYLWRLDRRIGEQERNR
Ga0066655_1113457023300018431Grasslands SoilLFRGGNNPVVNSLVFLAGVNVVIWAGLFFYLWRLDRRISAREEER
Ga0066662_1065898323300018468Grasslands SoilVSSLAYLAAVNIVIWIGLFFYVWRLDRRLTERERNR
Ga0066669_1000207473300018482Grasslands SoilVSSLGFLAAVNIVIWIGLFFYVWRLDRRLTERERDR
Ga0210378_1001827823300021073Groundwater SedimentVSSLAYLAAVNVVVWVGLFLYLWRLDRRISERERNR
Ga0210379_1001551623300021081Groundwater SedimentMTSLGYLAAVNVVIWIGLFAYLWRLDRRLTEKEGGR
Ga0182009_1011209933300021445SoilVGSLGYLAAVNVVIWVGLFLYLWRLDRRLAERERGERPLKG
Ga0187846_1003592923300021476BiofilmMAVNSLAYLAAANVVIWVGLFLYLWRLDRRISEAERRK
Ga0210402_1000381543300021478SoilMSSLGYLAAVNVVIWIGLFAYIWRLDRRVSEKERS
Ga0126371_1042653133300021560Tropical Forest SoilVGSLGYLAAVNVVIWVGLFVYLWRLDRRVSDAERKP
Ga0126371_1055500633300021560Tropical Forest SoilVNSLAFLAAVNVVIWVGLFFYLWRLDRRVTEREREK
Ga0126371_1130695233300021560Tropical Forest SoilVGSLGYLAAVNVVIWVGLFVYLWRLDRRVSDVERKS
Ga0247751_105915523300023069SoilVGSLGYLAAVNVVVWVGLFLYLWRLDRRLAEAEKKELR
Ga0209640_1002232143300025324SoilVSSLASLAIVNVVIWSGLFLYLWRLDRRVSERERDR
Ga0209640_1092784223300025324SoilVSSLAYLAVVNIVIWAGLFLYLWRLDRRLTERERER
Ga0210131_109226123300025551Natural And Restored WetlandsMSSLGYLAAVNVVIWVGLFAYLWRLDRRVSEKERP
Ga0207642_1030679323300025899Miscanthus RhizosphereVSSLGYLAAVNVVVWVGLFFYLWRLDRRIEQLDRRR
Ga0207647_1055289613300025904Corn RhizosphereTGSVRSLGYLAAVNVVIWVGLFLYLWRLDRRISEAERKP
Ga0207684_10002282193300025910Corn, Switchgrass And Miscanthus RhizosphereMNSLFFLASVNVVIWVGLFFYLWRIDRRIAEKEGGR
Ga0207684_1003647433300025910Corn, Switchgrass And Miscanthus RhizosphereVNSLAFLAIVNVVIWVGLFFYLWRLDRRISARERER
Ga0207646_1039379623300025922Corn, Switchgrass And Miscanthus RhizosphereVTSLAYLAAVNIVIWIGLFFYVWRLDRRLTERERNR
Ga0207646_1049419723300025922Corn, Switchgrass And Miscanthus RhizosphereVRSLGYLAAVNVVIWVGLFFYLWRLDRRISEKERSR
Ga0207646_1158503023300025922Corn, Switchgrass And Miscanthus RhizosphereMSSLAFLAAVNVVIWVGLFFYLWRLDRRIAERERER
Ga0207670_1093140213300025936Switchgrass RhizosphereVSSLAYLAAVNVVVWVGLFLYLWRLDRRISARERTR
Ga0207665_1063059313300025939Corn, Switchgrass And Miscanthus RhizosphereVSSLAYLAAVNVVIWIGLFWYLWRLDRRISQKESDR
Ga0207689_1149362523300025942Miscanthus RhizosphereGSVRSLGYLAAVNVVIWVGLFLYLWRLDRRISEAERKP
Ga0207651_1124284013300025960Switchgrass RhizosphereGPGGNNHFVSSLAYLAAVNVVVWVGLFLYLWRLDRRISERERTR
Ga0207678_1036980733300026067Corn RhizosphereRLGGVGSLGYLAAVNVVIWVGLFLYLWRLDRRLAETEKRQG
Ga0207648_1129515723300026089Miscanthus RhizosphereVSSLAYLALVNVVVWVGLFLYLWRLERRISEQERNR
Ga0209863_1008618623300026281Prmafrost SoilVNSLAFLAAVNVVIWVGLFVYLWRLDRRISERERDR
Ga0209839_1009733123300026294SoilMNSLAFLAAVNLVIWLGLFLFLWRLDRKISERERNR
Ga0209131_121001023300026320Grasslands SoilVSLVFLAAVNVIIWIGLFAYLWRLDRRISARERER
Ga0256823_103742023300026350SedimentMSSLGYLAAVNVVIWIGLFAYLWRLDRRVSEKEQSR
Ga0209056_1025357123300026538SoilVNSLFFLAAVNVVIWVGLFFYLWRLDRRISAREGER
Ga0209973_103360213300027252Arabidopsis Thaliana RhizosphereVSSLAFLAVVNIVIWAGLFFYVWRLDRRLAEMEKNR
Ga0209983_109068923300027665Arabidopsis Thaliana RhizosphereVSSLAYLAVVNIVIWSGLFLYLWRLDRRVSDREKGR
Ga0209009_100020073300027667Forest SoilMSSLAFLASVNAVIWVGLFFYLWRLDRRISARERER
Ga0209819_1002829333300027722Freshwater SedimentVGSLGYLAAVNVVIWVGLFVYLWRLDRRISEAERKS
Ga0209811_1023720523300027821Surface SoilVSSLAFLATVNLVIWAGLFFYLWRLDRRISARERER
Ga0209048_10000689103300027902Freshwater Lake SedimentMSSLGYLAAVNVVIWIGLFAYLWRLDRRVSEKERSS
Ga0209048_1002865023300027902Freshwater Lake SedimentMSSLGYLAAVNVVIWVGLFAYLWRLDRRLTEKERAR
Ga0268266_1099852213300028379Switchgrass RhizosphereMTSLGYLAAVNVVIWIGLFVYLWRLDRRVSEKERAR
Ga0268264_1260383923300028381Switchgrass RhizosphereVSLTFLAAVNVVIWIGLFVYLWRIDRRLSARERER
Ga0299906_1051420023300030606SoilVSSLAYLAVVNIVIWAGLFLYLWRLDRRLTERERNR
Ga0302046_1036029533300030620SoilVSSLGFLAIVNIVIWAGLFVYVWRLDRRLTERERNR
Ga0265330_1012074023300031235RhizosphereMSSLGYLAAVNVVIWIGLFAYVWSLDRRVSEKERSR
Ga0265332_1023222633300031238RhizosphereTQPMSSLGYLAAVNVVIWIGLFAYVWSLDRRVSEKERSR
Ga0318555_1039711323300031640SoilMNSLAFLAAVNVVIWVGLFAYLWRIDRRLSEREKQP
Ga0310813_1163029733300031716SoilGNNHFVSSLAYLAAVNVVVWVGLFLYLWRLDRRISERERTR
Ga0307469_1007818053300031720Hardwood Forest SoilVSSLAYLAAVNLVIWVGLFFYLWRLDRRISQKGGDP
Ga0307469_1059502523300031720Hardwood Forest SoilMSSLAFLAGVNVVIWVGLFFYLWRLDRRISTREREP
Ga0307469_1225715523300031720Hardwood Forest SoilVSLVFLAAVNVIIWTGLFVYLWRLDRRISAREKER
Ga0307468_10019404023300031740Hardwood Forest SoilVSLVFLAAVNVIIWTGLFVYLWRLDRRISARERER
Ga0307468_10029765523300031740Hardwood Forest SoilVSSLGFLAAVNVVVWVGLFLYLWRLDRRISEAERERPRP
Ga0307473_1089333413300031820Hardwood Forest SoilNNSRVSLVFLAAVNVIIWTGLFVYLWRLDRRISARERER
Ga0307473_1101106313300031820Hardwood Forest SoilMSSLAFLATVNVVIWAGLFFYLWRLDRRISARERER
Ga0315290_1048618923300031834SedimentMTSLGYLAAVNVVIWIGLFAYLWRLDRRVSEKERS
Ga0318533_1141051123300032059SoilTLSVGSLGYLAAVNVVIWVGLFVYLWRLDRRVSDAERKP
Ga0307470_1125396523300032174Hardwood Forest SoilVSSLGYLAAVNLVIWAGLFFYVWRLDRRISEKEREP
Ga0307471_10016189723300032180Hardwood Forest SoilVSSLAYLAAVNLVIWVGLFFYLWRLDRRISQKGGDQ
Ga0307471_10097472623300032180Hardwood Forest SoilMSSLAFLAIVNMVIWAGLFFYVWRLDRRLAEREKGR
Ga0307471_10136985823300032180Hardwood Forest SoilVNSLAYLAAANVVIWLGLFFYLWRLDRRISAKERER
Ga0307471_10406230723300032180Hardwood Forest SoilVSSLGYLAAVNVVIWAGLFLYLWRLDRRIDQMERRR
Ga0307472_10021756123300032205Hardwood Forest SoilMASVNSLAFLAAVNVVIWIGLWAYLWRLDRRLSERERGK
Ga0307472_10225160723300032205Hardwood Forest SoilVHSLRYLAAVNVVVWAGLFFYLWRLDRRITERERRDGEES
Ga0335085_1003036743300032770SoilMNSLAFLAAVNVVIWVGLFAYLWRIDRRLSEREKQQ
Ga0335079_1044447823300032783SoilVSSLGYLAAVNLVIWGGLFFYVWRLDRRISEKEREP
Ga0335080_1055799613300032828SoilVGSLAYLAAVNVVIWVGLFVYLWRLDRRISDAERKP
Ga0335084_1010432533300033004SoilVGSLGYLAAVNLVIWAGLFFYVWRLDRRISEREREP
Ga0335084_1198581823300033004SoilVGSLGYLAAVNVVIWVGLFLYLWRLDRRITEAERKP
Ga0316605_1093755613300033408SoilVKSLGYLAAVNVVIWVGLFYYLWRLDRRLSESERKS
Ga0316620_1156559223300033480SoilMTSLGYLAAVNVVIWVGLFLYLWRLDRRIAEKERGR
Ga0316628_10005977433300033513SoilVSSLAYLAAVNVVIWAGLFFYLWRLDRRISGKEREP
Ga0247829_1048390113300033550SoilEGETSVSSLAFLAVVNIVIWAGLFLYVWRLDRRLAEMEKNR
Ga0247829_1075489023300033550SoilVSSLAYLAAVNVVIWVGLFLYLWRLDGRISAAESRKP
Ga0314862_0148203_111_2213300033803PeatlandVSSLGYLAAVNLVIWFGIFLYLWRLDRRIGEKERSR
Ga0364930_0151294_233_3433300033814SedimentMSSLAYLAVVNIVIWAGLFFYVWRLDRRIAERERDQ
Ga0364946_152610_216_3263300033815SedimentVSSLAYLATVNVVVWVGLFVYLWRLDRRISERERIR
Ga0364931_0328924_198_3083300034176SedimentVSSLAYLAVVNIVIWIGLFLYLWRLDRRLTERERNR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.