Basic Information | |
---|---|
Family ID | F017687 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 239 |
Average Sequence Length | 39 residues |
Representative Sequence | EVLAIAEKWRPYRSLATSYLFSAAFEPTEAPPAAPHET |
Number of Associated Samples | 185 |
Number of Associated Scaffolds | 239 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 1.27 % |
% of genes near scaffold ends (potentially truncated) | 98.33 % |
% of genes from short scaffolds (< 2000 bps) | 87.87 % |
Associated GOLD sequencing projects | 168 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.27 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (82.845 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (20.921 % of family members) |
Environment Ontology (ENVO) | Unclassified (22.176 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (39.331 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 33.33% β-sheet: 0.00% Coil/Unstructured: 66.67% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.27 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 239 Family Scaffolds |
---|---|---|
PF02148 | zf-UBP | 9.62 |
PF03807 | F420_oxidored | 9.21 |
PF07992 | Pyr_redox_2 | 3.77 |
PF00196 | GerE | 3.35 |
PF07859 | Abhydrolase_3 | 2.51 |
PF02518 | HATPase_c | 2.09 |
PF07690 | MFS_1 | 2.09 |
PF00248 | Aldo_ket_red | 1.26 |
PF12681 | Glyoxalase_2 | 1.26 |
PF06772 | LtrA | 1.26 |
PF03061 | 4HBT | 1.26 |
PF12680 | SnoaL_2 | 0.84 |
PF13006 | Nterm_IS4 | 0.84 |
PF00589 | Phage_integrase | 0.84 |
PF00857 | Isochorismatase | 0.84 |
PF13193 | AMP-binding_C | 0.84 |
PF00106 | adh_short | 0.84 |
PF00501 | AMP-binding | 0.84 |
PF13561 | adh_short_C2 | 0.84 |
PF14833 | NAD_binding_11 | 0.84 |
PF00456 | Transketolase_N | 0.84 |
PF13462 | Thioredoxin_4 | 0.84 |
PF04075 | F420H2_quin_red | 0.84 |
PF02604 | PhdYeFM_antitox | 0.42 |
PF01557 | FAA_hydrolase | 0.42 |
PF00582 | Usp | 0.42 |
PF06314 | ADC | 0.42 |
PF00149 | Metallophos | 0.42 |
PF03795 | YCII | 0.42 |
PF12802 | MarR_2 | 0.42 |
PF01946 | Thi4 | 0.42 |
PF08281 | Sigma70_r4_2 | 0.42 |
PF13556 | HTH_30 | 0.42 |
PF00107 | ADH_zinc_N | 0.42 |
PF00903 | Glyoxalase | 0.42 |
PF01636 | APH | 0.42 |
PF06267 | DUF1028 | 0.42 |
PF12418 | AcylCoA_DH_N | 0.42 |
PF00011 | HSP20 | 0.42 |
PF13302 | Acetyltransf_3 | 0.42 |
PF01609 | DDE_Tnp_1 | 0.42 |
PF04972 | BON | 0.42 |
PF00392 | GntR | 0.42 |
PF00271 | Helicase_C | 0.42 |
PF00890 | FAD_binding_2 | 0.42 |
PF01323 | DSBA | 0.42 |
PF00005 | ABC_tran | 0.42 |
PF03069 | FmdA_AmdA | 0.42 |
PF03446 | NAD_binding_2 | 0.42 |
PF00144 | Beta-lactamase | 0.42 |
PF13460 | NAD_binding_10 | 0.42 |
PF02322 | Cyt_bd_oxida_II | 0.42 |
PF09922 | DUF2154 | 0.42 |
PF00893 | Multi_Drug_Res | 0.42 |
PF03352 | Adenine_glyco | 0.42 |
PF01022 | HTH_5 | 0.42 |
PF13358 | DDE_3 | 0.42 |
PF13520 | AA_permease_2 | 0.42 |
PF00753 | Lactamase_B | 0.42 |
PF13340 | DUF4096 | 0.42 |
PF01266 | DAO | 0.42 |
PF04014 | MazE_antitoxin | 0.42 |
PF01544 | CorA | 0.42 |
PF02589 | LUD_dom | 0.42 |
PF00326 | Peptidase_S9 | 0.42 |
PF09587 | PGA_cap | 0.42 |
PF00561 | Abhydrolase_1 | 0.42 |
COG ID | Name | Functional Category | % Frequency in 239 Family Scaffolds |
---|---|---|---|
COG5207 | Uncharacterized Zn-finger protein, UBP-type | General function prediction only [R] | 9.62 |
COG0657 | Acetyl esterase/lipase | Lipid transport and metabolism [I] | 2.51 |
COG4292 | Low temperature requirement protein LtrA (function unknown) | Function unknown [S] | 1.26 |
COG0021 | Transketolase | Carbohydrate transport and metabolism [G] | 0.84 |
COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 0.84 |
COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.84 |
COG3959 | Transketolase, N-terminal subunit | Carbohydrate transport and metabolism [G] | 0.84 |
COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 0.42 |
COG0598 | Mg2+ and Co2+ transporter CorA | Inorganic ion transport and metabolism [P] | 0.42 |
COG1294 | Cytochrome bd-type quinol oxidase, subunit 2 | Energy production and conversion [C] | 0.42 |
COG1635 | Thiazole synthase/Archaeal ribulose 1,5-bisphosphate synthetase | Carbohydrate transport and metabolism [G] | 0.42 |
COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.42 |
COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.42 |
COG2076 | Multidrug transporter EmrE and related cation transporters | Defense mechanisms [V] | 0.42 |
COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 0.42 |
COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.42 |
COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.42 |
COG2421 | Acetamidase/formamidase | Energy production and conversion [C] | 0.42 |
COG2818 | 3-methyladenine DNA glycosylase Tag | Replication, recombination and repair [L] | 0.42 |
COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.42 |
COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.42 |
COG3342 | Uncharacterized conserved protein, Ntn-hydrolase superfamily | General function prediction only [R] | 0.42 |
COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.42 |
COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 0.42 |
COG4689 | Acetoacetate decarboxylase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.42 |
COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.42 |
COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.42 |
COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.42 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 82.85 % |
Unclassified | root | N/A | 17.15 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002906|JGI25614J43888_10039536 | All Organisms → cellular organisms → Bacteria | 1468 | Open in IMG/M |
3300003505|JGIcombinedJ51221_10379769 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
3300004479|Ga0062595_100433027 | All Organisms → cellular organisms → Bacteria | 958 | Open in IMG/M |
3300005332|Ga0066388_105453149 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
3300005434|Ga0070709_10176925 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1495 | Open in IMG/M |
3300005434|Ga0070709_10720194 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Thermogemmatisporales → Thermogemmatisporaceae → Thermogemmatispora → Thermogemmatispora carboxidivorans | 778 | Open in IMG/M |
3300005435|Ga0070714_100060008 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3263 | Open in IMG/M |
3300005435|Ga0070714_100197656 | All Organisms → cellular organisms → Bacteria | 1838 | Open in IMG/M |
3300005435|Ga0070714_100836191 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
3300005436|Ga0070713_100035548 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4012 | Open in IMG/M |
3300005437|Ga0070710_11360798 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
3300005441|Ga0070700_101664231 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
3300005456|Ga0070678_101088405 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
3300005457|Ga0070662_100472030 | All Organisms → cellular organisms → Bacteria | 1044 | Open in IMG/M |
3300005471|Ga0070698_100324059 | All Organisms → cellular organisms → Bacteria | 1472 | Open in IMG/M |
3300005518|Ga0070699_101361710 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 651 | Open in IMG/M |
3300005561|Ga0066699_10349745 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1056 | Open in IMG/M |
3300005610|Ga0070763_10939852 | Not Available | 516 | Open in IMG/M |
3300005617|Ga0068859_101832991 | Not Available | 670 | Open in IMG/M |
3300005764|Ga0066903_103304758 | Not Available | 871 | Open in IMG/M |
3300005950|Ga0066787_10067145 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
3300006028|Ga0070717_10109504 | All Organisms → cellular organisms → Bacteria | 2354 | Open in IMG/M |
3300006028|Ga0070717_11134971 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 712 | Open in IMG/M |
3300006028|Ga0070717_11770937 | Not Available | 558 | Open in IMG/M |
3300006058|Ga0075432_10225075 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
3300006175|Ga0070712_101717306 | Not Available | 549 | Open in IMG/M |
3300006176|Ga0070765_100574293 | All Organisms → cellular organisms → Bacteria | 1062 | Open in IMG/M |
3300006176|Ga0070765_101473672 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
3300006176|Ga0070765_102244145 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 509 | Open in IMG/M |
3300006755|Ga0079222_12105745 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 558 | Open in IMG/M |
3300006804|Ga0079221_11279630 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
3300006844|Ga0075428_101030227 | All Organisms → cellular organisms → Bacteria | 871 | Open in IMG/M |
3300006845|Ga0075421_102103028 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 599 | Open in IMG/M |
3300006847|Ga0075431_100349611 | All Organisms → cellular organisms → Bacteria | 1486 | Open in IMG/M |
3300006852|Ga0075433_10122584 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2309 | Open in IMG/M |
3300006852|Ga0075433_10691648 | All Organisms → cellular organisms → Bacteria | 893 | Open in IMG/M |
3300006852|Ga0075433_10993319 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 731 | Open in IMG/M |
3300006852|Ga0075433_11780995 | Not Available | 529 | Open in IMG/M |
3300006854|Ga0075425_100300322 | All Organisms → cellular organisms → Bacteria | 1848 | Open in IMG/M |
3300006854|Ga0075425_100673571 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia → Nocardia miyunensis | 1188 | Open in IMG/M |
3300006854|Ga0075425_100919928 | All Organisms → cellular organisms → Bacteria | 1000 | Open in IMG/M |
3300006854|Ga0075425_101867480 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
3300006854|Ga0075425_102179774 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
3300006854|Ga0075425_102486364 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
3300006893|Ga0073928_10239337 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1395 | Open in IMG/M |
3300006903|Ga0075426_10348914 | All Organisms → cellular organisms → Bacteria | 1087 | Open in IMG/M |
3300006903|Ga0075426_10797040 | Not Available | 710 | Open in IMG/M |
3300006904|Ga0075424_102736902 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 514 | Open in IMG/M |
3300006914|Ga0075436_100931057 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
3300006954|Ga0079219_10804867 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → unclassified Conexibacter → Conexibacter sp. S30A1 | 739 | Open in IMG/M |
3300006954|Ga0079219_11896371 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
3300006969|Ga0075419_10378909 | All Organisms → cellular organisms → Bacteria | 966 | Open in IMG/M |
3300007076|Ga0075435_101717868 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
3300009088|Ga0099830_10458366 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1036 | Open in IMG/M |
3300009089|Ga0099828_10799183 | All Organisms → cellular organisms → Bacteria | 845 | Open in IMG/M |
3300009089|Ga0099828_11948056 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 515 | Open in IMG/M |
3300009090|Ga0099827_11580535 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 571 | Open in IMG/M |
3300009094|Ga0111539_10885472 | Not Available | 1038 | Open in IMG/M |
3300009098|Ga0105245_10098538 | All Organisms → cellular organisms → Bacteria | 2701 | Open in IMG/M |
3300009147|Ga0114129_11268720 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia | 914 | Open in IMG/M |
3300009162|Ga0075423_12971505 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 519 | Open in IMG/M |
3300009520|Ga0116214_1320747 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 596 | Open in IMG/M |
3300009545|Ga0105237_11123406 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
3300009551|Ga0105238_10203359 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 1956 | Open in IMG/M |
3300009551|Ga0105238_10516550 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1197 | Open in IMG/M |
3300009623|Ga0116133_1076230 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
3300009672|Ga0116215_1025896 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2713 | Open in IMG/M |
3300009700|Ga0116217_10011825 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 7178 | Open in IMG/M |
3300009792|Ga0126374_10058109 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2004 | Open in IMG/M |
3300010037|Ga0126304_11210861 | Not Available | 518 | Open in IMG/M |
3300010043|Ga0126380_10017596 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3363 | Open in IMG/M |
3300010043|Ga0126380_11308730 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 631 | Open in IMG/M |
3300010048|Ga0126373_12135398 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
3300010048|Ga0126373_12321966 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
3300010303|Ga0134082_10483950 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 538 | Open in IMG/M |
3300010360|Ga0126372_11511383 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 708 | Open in IMG/M |
3300010361|Ga0126378_10808402 | All Organisms → cellular organisms → Bacteria | 1047 | Open in IMG/M |
3300010361|Ga0126378_11479672 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 770 | Open in IMG/M |
3300010361|Ga0126378_11511274 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 761 | Open in IMG/M |
3300010366|Ga0126379_10906628 | Not Available | 984 | Open in IMG/M |
3300010375|Ga0105239_12074623 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
3300010376|Ga0126381_102610791 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 723 | Open in IMG/M |
3300010376|Ga0126381_103995721 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 574 | Open in IMG/M |
3300010379|Ga0136449_103938256 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces xylophagus | 556 | Open in IMG/M |
3300010396|Ga0134126_12068113 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia autotrophica | 622 | Open in IMG/M |
3300010868|Ga0124844_1001648 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3099 | Open in IMG/M |
3300012198|Ga0137364_10868564 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
3300012203|Ga0137399_11739483 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
3300012349|Ga0137387_10882720 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 647 | Open in IMG/M |
3300012351|Ga0137386_10752369 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 700 | Open in IMG/M |
3300012351|Ga0137386_11010105 | Not Available | 591 | Open in IMG/M |
3300012353|Ga0137367_10109733 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2030 | Open in IMG/M |
3300012353|Ga0137367_10958297 | Not Available | 586 | Open in IMG/M |
3300012359|Ga0137385_10160116 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 1978 | Open in IMG/M |
3300012519|Ga0157352_1099963 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
3300012938|Ga0162651_100067608 | Not Available | 584 | Open in IMG/M |
3300012986|Ga0164304_11806183 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 511 | Open in IMG/M |
3300012989|Ga0164305_11787722 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
3300012989|Ga0164305_11845742 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
3300013104|Ga0157370_11496657 | Not Available | 607 | Open in IMG/M |
3300013307|Ga0157372_12789596 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 560 | Open in IMG/M |
3300015371|Ga0132258_10685653 | All Organisms → cellular organisms → Bacteria | 2578 | Open in IMG/M |
3300016294|Ga0182041_10438063 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1120 | Open in IMG/M |
3300016341|Ga0182035_10159431 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1743 | Open in IMG/M |
3300016357|Ga0182032_10244362 | All Organisms → cellular organisms → Bacteria | 1391 | Open in IMG/M |
3300016357|Ga0182032_11651178 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 558 | Open in IMG/M |
3300016387|Ga0182040_10941276 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
3300016445|Ga0182038_10835200 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 809 | Open in IMG/M |
3300017932|Ga0187814_10142433 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Microtetraspora → Microtetraspora niveoalba | 892 | Open in IMG/M |
3300017946|Ga0187879_10261177 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 964 | Open in IMG/M |
3300017946|Ga0187879_10487729 | Not Available | 683 | Open in IMG/M |
3300017965|Ga0190266_10447660 | Not Available | 734 | Open in IMG/M |
3300017999|Ga0187767_10257742 | Not Available | 577 | Open in IMG/M |
3300018028|Ga0184608_10506444 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 516 | Open in IMG/M |
3300018058|Ga0187766_11138874 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Hamadaea → Hamadaea flava | 562 | Open in IMG/M |
3300018476|Ga0190274_13676706 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 518 | Open in IMG/M |
3300018481|Ga0190271_11036318 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 945 | Open in IMG/M |
3300019259|Ga0184646_1379946 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 515 | Open in IMG/M |
3300019279|Ga0184642_1015746 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2885 | Open in IMG/M |
3300019279|Ga0184642_1060412 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 535 | Open in IMG/M |
3300020003|Ga0193739_1002923 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 4701 | Open in IMG/M |
3300020076|Ga0206355_1504652 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
3300020580|Ga0210403_10159234 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1848 | Open in IMG/M |
3300020580|Ga0210403_11128420 | Not Available | 608 | Open in IMG/M |
3300020581|Ga0210399_11324092 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 566 | Open in IMG/M |
3300020581|Ga0210399_11468595 | Not Available | 530 | Open in IMG/M |
3300020583|Ga0210401_10233967 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1696 | Open in IMG/M |
3300021088|Ga0210404_10565569 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 645 | Open in IMG/M |
3300021363|Ga0193699_10268837 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 710 | Open in IMG/M |
3300021406|Ga0210386_11371613 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 593 | Open in IMG/M |
3300021407|Ga0210383_11140381 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 657 | Open in IMG/M |
3300021432|Ga0210384_11890926 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 503 | Open in IMG/M |
3300021433|Ga0210391_10151905 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1824 | Open in IMG/M |
3300021477|Ga0210398_10530532 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 958 | Open in IMG/M |
3300021559|Ga0210409_11005263 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 708 | Open in IMG/M |
3300021559|Ga0210409_11070214 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
3300021560|Ga0126371_12632759 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
3300022534|Ga0224452_1108606 | All Organisms → cellular organisms → Bacteria | 850 | Open in IMG/M |
3300022713|Ga0242677_1086806 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. 7K534 | 512 | Open in IMG/M |
3300025633|Ga0208480_1044843 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1176 | Open in IMG/M |
3300025898|Ga0207692_10578114 | Not Available | 720 | Open in IMG/M |
3300025915|Ga0207693_10420299 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1045 | Open in IMG/M |
3300025915|Ga0207693_10933798 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 665 | Open in IMG/M |
3300025916|Ga0207663_10011942 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 4679 | Open in IMG/M |
3300025916|Ga0207663_11738212 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea → Nonomuraea aurantiaca | 502 | Open in IMG/M |
3300025929|Ga0207664_10242380 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1570 | Open in IMG/M |
3300025933|Ga0207706_10940138 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
3300025938|Ga0207704_10897365 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. SOSP1-52 | 745 | Open in IMG/M |
3300025938|Ga0207704_11636980 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 553 | Open in IMG/M |
3300025939|Ga0207665_10447348 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 991 | Open in IMG/M |
3300025939|Ga0207665_10953771 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 682 | Open in IMG/M |
3300026358|Ga0257166_1056280 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 564 | Open in IMG/M |
3300027110|Ga0208488_1062911 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
3300027604|Ga0208324_1001117 | All Organisms → cellular organisms → Bacteria | 10614 | Open in IMG/M |
3300027725|Ga0209178_1234780 | Not Available | 659 | Open in IMG/M |
3300027725|Ga0209178_1333984 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 564 | Open in IMG/M |
3300027775|Ga0209177_10488727 | Not Available | 511 | Open in IMG/M |
3300027842|Ga0209580_10614614 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
3300027862|Ga0209701_10469408 | Not Available | 689 | Open in IMG/M |
3300027875|Ga0209283_10800124 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
3300027884|Ga0209275_10175283 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1148 | Open in IMG/M |
3300027903|Ga0209488_10487653 | All Organisms → cellular organisms → Bacteria | 905 | Open in IMG/M |
3300028380|Ga0268265_12318632 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
3300028587|Ga0247828_10239374 | All Organisms → cellular organisms → Bacteria | 969 | Open in IMG/M |
3300028587|Ga0247828_10564063 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
3300028787|Ga0307323_10026084 | Not Available | 2018 | Open in IMG/M |
3300028799|Ga0307284_10002913 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4570 | Open in IMG/M |
3300028801|Ga0302226_10076928 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. T1317-0309 | 1520 | Open in IMG/M |
3300028807|Ga0307305_10043061 | All Organisms → cellular organisms → Bacteria | 2077 | Open in IMG/M |
3300028819|Ga0307296_10114729 | All Organisms → cellular organisms → Bacteria | 1446 | Open in IMG/M |
3300028828|Ga0307312_10134884 | All Organisms → cellular organisms → Bacteria | 1556 | Open in IMG/M |
3300028881|Ga0307277_10458774 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 571 | Open in IMG/M |
3300028906|Ga0308309_11625753 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 550 | Open in IMG/M |
3300030494|Ga0310037_10106317 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1298 | Open in IMG/M |
3300030760|Ga0265762_1118567 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 603 | Open in IMG/M |
3300030903|Ga0308206_1073016 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
3300031028|Ga0302180_10152066 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1282 | Open in IMG/M |
3300031058|Ga0308189_10201969 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
3300031231|Ga0170824_101387285 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 538 | Open in IMG/M |
3300031234|Ga0302325_12686082 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
3300031543|Ga0318516_10284510 | All Organisms → cellular organisms → Bacteria | 956 | Open in IMG/M |
3300031543|Ga0318516_10769379 | Not Available | 545 | Open in IMG/M |
3300031544|Ga0318534_10195427 | All Organisms → cellular organisms → Bacteria | 1168 | Open in IMG/M |
3300031544|Ga0318534_10304823 | Not Available | 918 | Open in IMG/M |
3300031544|Ga0318534_10497778 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
3300031546|Ga0318538_10233789 | All Organisms → cellular organisms → Bacteria | 985 | Open in IMG/M |
3300031549|Ga0318571_10096938 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 960 | Open in IMG/M |
3300031549|Ga0318571_10287090 | Not Available | 615 | Open in IMG/M |
3300031572|Ga0318515_10055448 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales | 2004 | Open in IMG/M |
3300031640|Ga0318555_10529037 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
3300031668|Ga0318542_10739092 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
3300031681|Ga0318572_10253747 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1035 | Open in IMG/M |
3300031682|Ga0318560_10257073 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 938 | Open in IMG/M |
3300031708|Ga0310686_105378322 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 717 | Open in IMG/M |
3300031713|Ga0318496_10782221 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
3300031719|Ga0306917_10072292 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2396 | Open in IMG/M |
3300031744|Ga0306918_11022506 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
3300031751|Ga0318494_10046641 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2276 | Open in IMG/M |
3300031770|Ga0318521_10023221 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2931 | Open in IMG/M |
3300031770|Ga0318521_10732110 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
3300031771|Ga0318546_10490552 | All Organisms → cellular organisms → Bacteria | 862 | Open in IMG/M |
3300031796|Ga0318576_10144570 | Not Available | 1107 | Open in IMG/M |
3300031799|Ga0318565_10482987 | Not Available | 599 | Open in IMG/M |
3300031805|Ga0318497_10046782 | All Organisms → cellular organisms → Bacteria | 2219 | Open in IMG/M |
3300031819|Ga0318568_10933197 | Not Available | 537 | Open in IMG/M |
3300031832|Ga0318499_10358450 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
3300031879|Ga0306919_11426849 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
3300031890|Ga0306925_11888839 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
3300031890|Ga0306925_12070716 | Not Available | 534 | Open in IMG/M |
3300031893|Ga0318536_10523298 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 595 | Open in IMG/M |
3300031893|Ga0318536_10697222 | Not Available | 506 | Open in IMG/M |
3300031912|Ga0306921_12311421 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
3300031912|Ga0306921_12388845 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 552 | Open in IMG/M |
3300031941|Ga0310912_10978529 | Not Available | 649 | Open in IMG/M |
3300031942|Ga0310916_11280437 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces xylophagus | 604 | Open in IMG/M |
3300031946|Ga0310910_11055142 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
3300031954|Ga0306926_10954738 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1023 | Open in IMG/M |
3300031954|Ga0306926_13034957 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 500 | Open in IMG/M |
3300031959|Ga0318530_10296042 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 669 | Open in IMG/M |
3300032008|Ga0318562_10427246 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 770 | Open in IMG/M |
3300032010|Ga0318569_10034527 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides | 2126 | Open in IMG/M |
3300032043|Ga0318556_10094175 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales | 1509 | Open in IMG/M |
3300032065|Ga0318513_10195331 | All Organisms → cellular organisms → Bacteria | 974 | Open in IMG/M |
3300032065|Ga0318513_10520205 | Not Available | 582 | Open in IMG/M |
3300032066|Ga0318514_10557518 | Not Available | 610 | Open in IMG/M |
3300032180|Ga0307471_101298984 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Hamadaea → Hamadaea flava | 890 | Open in IMG/M |
3300032180|Ga0307471_101570188 | Not Available | 815 | Open in IMG/M |
3300032180|Ga0307471_104214969 | Not Available | 508 | Open in IMG/M |
3300032205|Ga0307472_100555535 | All Organisms → cellular organisms → Bacteria | 1003 | Open in IMG/M |
3300032261|Ga0306920_101920162 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
3300032261|Ga0306920_102868918 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 654 | Open in IMG/M |
3300032261|Ga0306920_103575212 | Not Available | 573 | Open in IMG/M |
3300032783|Ga0335079_11459429 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 677 | Open in IMG/M |
3300032805|Ga0335078_10213730 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2664 | Open in IMG/M |
3300032898|Ga0335072_10189096 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2459 | Open in IMG/M |
3300032954|Ga0335083_10183918 | Not Available | 1931 | Open in IMG/M |
3300034664|Ga0314786_130164 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 571 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 20.92% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 9.62% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.95% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.53% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.53% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.28% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.44% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.93% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.51% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.51% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.09% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.67% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.67% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.67% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.26% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.26% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.26% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.26% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.84% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.84% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.84% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.84% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.84% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.84% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.84% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.42% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.42% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.42% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.42% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.42% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.42% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.42% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.42% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.42% |
Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.42% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.42% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.42% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.42% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.42% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.42% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.42% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.42% |
Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.42% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.42% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.42% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.42% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002906 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm | Environmental | Open in IMG/M |
3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005950 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-047 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
3300009623 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 | Environmental | Open in IMG/M |
3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010868 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction) | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012519 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.7.yng.070610 | Environmental | Open in IMG/M |
3300012938 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t2i015 | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
3300019259 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019279 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300020003 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a2 | Environmental | Open in IMG/M |
3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021363 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2 | Environmental | Open in IMG/M |
3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022534 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1 | Environmental | Open in IMG/M |
3300022713 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300025633 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-1 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026358 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-14-B | Environmental | Open in IMG/M |
3300027110 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF001 (SPAdes) | Environmental | Open in IMG/M |
3300027604 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes) | Environmental | Open in IMG/M |
3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
3300028801 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_3 | Environmental | Open in IMG/M |
3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030903 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_369 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031028 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2 | Environmental | Open in IMG/M |
3300031058 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
3300034664 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI25614J43888_100395361 | 3300002906 | Grasslands Soil | DYLPSQQEVLAIAEKWRPCRSLATSYLFSAAFEPAEAPPVARHGSA* |
JGIcombinedJ51221_103797692 | 3300003505 | Forest Soil | PSQQEVLAIAEKWRPYRSLATSYLFSAAFEPTETPPAAPGAV* |
Ga0062595_1004330274 | 3300004479 | Soil | TQQEVLAIADKWLPYRSLATSYLFSATFAQAKTSPAAQRKT* |
Ga0066388_1054531492 | 3300005332 | Tropical Forest Soil | AQQEVLDIAEKWRPYRSLATSYLFSAAFEPAGAPPVAPPEV* |
Ga0070709_101769251 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | LPTQQEVLDIAEKWRPYRSLATSYLFSAAYEPAGAPPVA* |
Ga0070709_107201941 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | DHLPTQQEVLAIACKWRPYRSLATSYLFTATFALAKAPPAAP* |
Ga0070714_1000600081 | 3300005435 | Agricultural Soil | QQEVLDIAEKWRPYRSLATSYLFSAAFEPADAPVAPLEP* |
Ga0070714_1001976561 | 3300005435 | Agricultural Soil | PTQQEVLAIADKWRPYRSLATSYLFSATFTQTQTPAAQRKT* |
Ga0070714_1008361913 | 3300005435 | Agricultural Soil | PTQQEVLAIADKWRPYRSLATSYLFSATFAQAKTPPAAQRKT* |
Ga0070713_1000355481 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | QQDVLAIAGKWRPYRSLATSYLFSATFAQARTPPAAQRKT* |
Ga0070710_113607981 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | LPTQQEVLDIAEKWRPYRSLATSYLFSAAAEPAGAPPVA* |
Ga0070700_1016642311 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | QQEVLAIADKWRPYRSLATSYLFSATFAQAKTPPAAQRKT* |
Ga0070678_1010884051 | 3300005456 | Miscanthus Rhizosphere | PTQQEVLAIADKWRPYRSLATSYLFSATFAQAKTPLAAQRKT* |
Ga0070662_1004720303 | 3300005457 | Corn Rhizosphere | QQELLAIAEEWRPYHRLATRYVGSAAFVPAEVPLVARLRSA* |
Ga0070698_1003240592 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | EEVLAIAEKWRPYRGLATSYLFSAAFEPAGAPPVARLGSA* |
Ga0070699_1013617101 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | LPTQQEVVSIAAKWRPYRSLATSYLFTATFAQAKTPRAAPRRT* |
Ga0066699_103497452 | 3300005561 | Soil | IADKWRPYRSLATSYLFSAAYEPAQAPPVPPRQTEQ* |
Ga0070763_109398522 | 3300005610 | Soil | IAEKWRPYRSLATSYLFSAAFEPAEAPPAARGEA* |
Ga0068859_1018329911 | 3300005617 | Switchgrass Rhizosphere | QEVLAIADKWRPYRSLATSYLFSATFAQAKTPPAAHRKT* |
Ga0066903_1033047583 | 3300005764 | Tropical Forest Soil | EVAAIAENWRPYRSLATSYLFSAAFDPAQAPPAGPRKT* |
Ga0066787_100671451 | 3300005950 | Soil | LAIAEKWRPYRSLATSYLFSAAFEQTGAPPVARLGSACP* |
Ga0070717_101095041 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | QQEVLAIAEKWRPYRSLATSYLFSAAFEPADRPA* |
Ga0070717_111349713 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | KWRPYRSLATSYPFAAAYERAEAPPAGSPMPAHP* |
Ga0070717_117709372 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | AIADKWRPYRSLATSYLFSATFAQAKTPPAAQRKT* |
Ga0075432_102250751 | 3300006058 | Populus Rhizosphere | QQEVLAIAEKWRPYRSLATSYLFSAAFERTEAPPVAPHET* |
Ga0070712_1017173061 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | DIAEKWRPYRSLATSYLFSAAFEPAPAQASRVPPRHSSPGTP* |
Ga0070765_1005742931 | 3300006176 | Soil | EEVLAIAEKWRPYRSLATSYLFSAAFEPADPPPAARLGSV* |
Ga0070765_1014736722 | 3300006176 | Soil | QEEVLAIAEKWRPYRSLATSYLFSSAFEPAEAPPVAQHGSI* |
Ga0070765_1022441452 | 3300006176 | Soil | QEEVLAIAEKWRPYRSLATSYLFSSAFEPAEAPPVAQHGNA* |
Ga0079222_121057451 | 3300006755 | Agricultural Soil | ILDIADKWRPYRSRATSYLFSAAYESAEAPPVASPALSHP* |
Ga0079221_112796301 | 3300006804 | Agricultural Soil | QQEVLDIAEKWRPYRSLATSYLFSAAFDPAGAPPAAPAEP* |
Ga0075428_1010302272 | 3300006844 | Populus Rhizosphere | QEVLAIAEKWRPYRSLATSYLFSAAFEPTNTPPIVPSEM* |
Ga0075421_1021030281 | 3300006845 | Populus Rhizosphere | IAEKWRPYRSLATSYLFSAAIEHTETPPIAPRET* |
Ga0075431_1003496111 | 3300006847 | Populus Rhizosphere | AIAEKWRPYRSLATSYLFSAAFEPTEAPPAARLGSA* |
Ga0075433_101225841 | 3300006852 | Populus Rhizosphere | HLPTQQEVLAIADKWRPYRSLATSYLFSATFAQAKTPPAAQRKT* |
Ga0075433_106916483 | 3300006852 | Populus Rhizosphere | LPTQPEVLAIAEKWRPYRSLATSYLFSAAFERTEAPPVAPHET* |
Ga0075433_109933192 | 3300006852 | Populus Rhizosphere | IAEKWRPYRSLATSYLFSATFDRAERPTTASHEL* |
Ga0075433_117809951 | 3300006852 | Populus Rhizosphere | DIAENWRPYRSLATSYLFSAAFAQAEAPPAARDKSA* |
Ga0075425_1003003223 | 3300006854 | Populus Rhizosphere | PTQGEVLAIADKWRPYRSLATSYLFSATFAQAKKPPAAPRKT* |
Ga0075425_1006735711 | 3300006854 | Populus Rhizosphere | LAIADKWRPYRSLATSYLFSATFAQAKTPPAAQRKT* |
Ga0075425_1009199281 | 3300006854 | Populus Rhizosphere | AIAERWRPYRSLATSYLFSAAFEPAGVPPAARLGSA* |
Ga0075425_1018674801 | 3300006854 | Populus Rhizosphere | LPTQQEVLAIADKWRPYRSLATSYLFSATFAQAKTPPAAHHKT* |
Ga0075425_1021797742 | 3300006854 | Populus Rhizosphere | PAPQEVLDIAENWRPYRSLATSYLFSAAFAQAEAPPAARDKSA* |
Ga0075425_1024863643 | 3300006854 | Populus Rhizosphere | LAIAEKWRPYRSLATSYLFSAGFEPAEVAPVARLGSA* |
Ga0073928_102393371 | 3300006893 | Iron-Sulfur Acid Spring | VPTQEEVLAIAEKWRPYRSLATSYLFSAAFEPTEAPPVARLGSA* |
Ga0075426_103489141 | 3300006903 | Populus Rhizosphere | LPTQQEVLAIAAKWRPYRSLATSYLFTAPFAQAKTPLAAPRRT* |
Ga0075426_107970401 | 3300006903 | Populus Rhizosphere | GEVLAIADKWRPYRSLATSYLFSATFAQAKKPPAAPRKT* |
Ga0075424_1027369022 | 3300006904 | Populus Rhizosphere | LPAPQEVLDIAENWRPYRSLATSYLFSAAFAQAEAPPAARDKSA* |
Ga0075436_1009310571 | 3300006914 | Populus Rhizosphere | QEVLDIAEKWRPYRSLATSYLFSAAFESAEAPPAAGHKSA* |
Ga0079219_108048671 | 3300006954 | Agricultural Soil | PSQQEVLDIAEKWRPHRSLATSYLFSAAFEPAGPPPVAPSET* |
Ga0079219_118963712 | 3300006954 | Agricultural Soil | QQEVLAIAEKWRPYRSLATSYLFSAAFEPAEAPPITSRET* |
Ga0075419_103789093 | 3300006969 | Populus Rhizosphere | EVLAIAEKWRPYRSLATSYLFSAAFEPTEAPPAAPHET* |
Ga0075435_1017178681 | 3300007076 | Populus Rhizosphere | QEVLDIAEKWRPYRSLATSYLFSAAFEPAGPPPR* |
Ga0099830_104583663 | 3300009088 | Vadose Zone Soil | IAEKWRPYRSLATSYLFSAAFEPAEAPPVARHRSA* |
Ga0099828_107991832 | 3300009089 | Vadose Zone Soil | AQQEVLAIAEKWRPYRSLATSYLFSAAFESPQAAPVAPVEA* |
Ga0099828_119480561 | 3300009089 | Vadose Zone Soil | SQQEVLAIAEKWRPYRSLATSYLFSAAFEQTGAPPVARLGSV* |
Ga0099827_115805351 | 3300009090 | Vadose Zone Soil | EEVLAIAEKWRPYRSLATSYLFSAALESAEAPSVARLGSA* |
Ga0111539_108854721 | 3300009094 | Populus Rhizosphere | IAENWRPYRSLATSYLFSAAFEPTEAPPVVSHET* |
Ga0105245_100985381 | 3300009098 | Miscanthus Rhizosphere | EVVAIAEKWRTYRSLATSYLFYAAFDLTAAPSVVPRET* |
Ga0114129_112687203 | 3300009147 | Populus Rhizosphere | AIAEKWRPYRSLATSYLFSAAFERTEAPPVAPHET* |
Ga0075423_129715051 | 3300009162 | Populus Rhizosphere | LAIAEKWRPYRSLATSYLFSAAFERTEAPPVAPHET* |
Ga0116214_13207471 | 3300009520 | Peatlands Soil | MKAIAEKWRPYRSLATSYLFSAAFEPAEAPPVVGPRSA* |
Ga0105237_111234061 | 3300009545 | Corn Rhizosphere | QQEVLAIAEKWRPYRSLATSYLFSTAFEPTDAPAVVPSET* |
Ga0105238_102033591 | 3300009551 | Corn Rhizosphere | EVLAIADKWRPYRSLATSYLFSATFAQAKTPPAAQRKT* |
Ga0105238_105165502 | 3300009551 | Corn Rhizosphere | LAIAEKWRPYRSLATSYLFSTAFEPTDAPAVVPSET* |
Ga0116133_10762301 | 3300009623 | Peatland | AIAEKWRPYRSLATSYLFSAAFEPAEALPAGRHRSV* |
Ga0116215_10258961 | 3300009672 | Peatlands Soil | IAEKWRPYRSLATSYLFSAAFEPTEAPPVARLGSA* |
Ga0116217_100118251 | 3300009700 | Peatlands Soil | QEVLAVAENWRPYRSLATSYLFSAAFEPAEAPPVTPPET* |
Ga0126374_100581091 | 3300009792 | Tropical Forest Soil | VLAIAEKWRPYRSLATSYLFSAAFEPAGRPPAAP* |
Ga0126304_112108611 | 3300010037 | Serpentine Soil | QEVLAIAEKWRPYRSLATSYPFSAAFERTEAPPVVPHET* |
Ga0126380_100175961 | 3300010043 | Tropical Forest Soil | EVLAIAEKWRPYRSLATSYLFSAAFERPGTTPPAPNETS* |
Ga0126380_113087301 | 3300010043 | Tropical Forest Soil | AIAEKWRPYRSLATSYLFSAAFEPADSPPATREK* |
Ga0126373_121353982 | 3300010048 | Tropical Forest Soil | AGKWRPYRSLATSYLFSAAYESAEAAPAAPHASA* |
Ga0126373_123219662 | 3300010048 | Tropical Forest Soil | QEVLDIAEKWRPYRSLATSYLFSAAFEPAQAPPASRHRSASA* |
Ga0134082_104839501 | 3300010303 | Grasslands Soil | KWRPYRSLATSYLFSAAFEPAEAPPSPGTVTPQP* |
Ga0126372_115113831 | 3300010360 | Tropical Forest Soil | LPARQEVLDIAEKWRPYRSLATGYLFSAAFELAQAPPAAPPGSA* |
Ga0126378_108084021 | 3300010361 | Tropical Forest Soil | DIAGKWRPYRSLATSYLFSAAFEPAEAPPTAQHESAGTQRRLHAS* |
Ga0126378_114796723 | 3300010361 | Tropical Forest Soil | AIAEKWRPYRSLATGYLFSAAFELAQAPPAAPPGST* |
Ga0126378_115112742 | 3300010361 | Tropical Forest Soil | LDIAEKWRPYRSLATSYLFSAAFEPAEAPPVAPSES* |
Ga0126379_109066282 | 3300010366 | Tropical Forest Soil | VLAIAEKWRPYRSLATSYLFSAAFEPAGLPPAAQ* |
Ga0105239_120746232 | 3300010375 | Corn Rhizosphere | EVLAIAEKWRPYRSLATSYLFSTAFEPTDAPAVVPSET* |
Ga0126381_1026107912 | 3300010376 | Tropical Forest Soil | AGKWRPYRSLATSYLFSAAFEPAEAPPTAQTTTS* |
Ga0126381_1039957211 | 3300010376 | Tropical Forest Soil | QEVLDIAEKWRPYRSLATSYLFSAAFEPAEAPPVAPSES* |
Ga0136449_1039382562 | 3300010379 | Peatlands Soil | LAIAEKWRPYRSLATSYLFSAAFEPAEAPPVARHRND* |
Ga0134126_120681131 | 3300010396 | Terrestrial Soil | EVLAIAEKWRPYRSLATSYLFSAAFEPAEARPVAPDET* |
Ga0124844_10016486 | 3300010868 | Tropical Forest Soil | AEKWRPYRSLATSYLFSAAFEPAAGPRNHDDVAS* |
Ga0137364_108685643 | 3300012198 | Vadose Zone Soil | PAQEEVLAIAEKWRPYRSLATSYLFSAAFEPTEAPAVARLGSA* |
Ga0137399_117394831 | 3300012203 | Vadose Zone Soil | AQQEVLAIAEKWRPYRSLATSYLFSAALERTGTPPVVPRET* |
Ga0137387_108827201 | 3300012349 | Vadose Zone Soil | HLPTQQEVLVIADTWRPYRSLATSYLFSATFAQAKTPPAAQRKT* |
Ga0137386_107523692 | 3300012351 | Vadose Zone Soil | AIAEKWRPYRSLATSYLFSAAFEPAEAPVVRHRSA* |
Ga0137386_110101051 | 3300012351 | Vadose Zone Soil | AIAEKWRPYRSLATSYLFSAALERTDAPPVAPRET* |
Ga0137367_101097334 | 3300012353 | Vadose Zone Soil | EVLAIAEKWRPYRSLATSYLFSAAFEPTGAPPVTRLGSP* |
Ga0137367_109582971 | 3300012353 | Vadose Zone Soil | EVLAIAEKWRPYRSLATSYLFSAAFEHAEAPLVVPSET* |
Ga0137385_101601161 | 3300012359 | Vadose Zone Soil | HLPAQQEVLAIAEKWRPYRSRATSYLFSAAFERTETPPVAPRET* |
Ga0157352_10999631 | 3300012519 | Unplanted Soil | QPEVLAIAEKWRPYRSLATSYLFSAAFERTEAPPVAPHET* |
Ga0162651_1000676081 | 3300012938 | Soil | LAIAEKWRPYRSLATSYLFSAAFERTEAPPVVPRET* |
Ga0164304_118061833 | 3300012986 | Soil | AEKWRPYRSLATSYLFSAAFEPAEAPPVARLGSA* |
Ga0164305_117877221 | 3300012989 | Soil | LDQLPNEQEVLAIAEKWRPFRSLATSYLFASAFDRDQAEA* |
Ga0164305_118457422 | 3300012989 | Soil | PTQQEVLAIADKWRPYRSLATSYLFSSAFDRTEPTAPS* |
Ga0157370_114966571 | 3300013104 | Corn Rhizosphere | VLAIADKWRPYRSLATSYLFSATFAQAKTPPAAQRKT* |
Ga0157372_127895961 | 3300013307 | Corn Rhizosphere | IAERWRPYRSLATSYLFSATFEPVEPVAPVAPREA* |
Ga0132258_106856535 | 3300015371 | Arabidopsis Rhizosphere | LSIAEKWRPHRSLATSYLFSAAFEPAGTPPIAPSET* |
Ga0182041_104380631 | 3300016294 | Soil | IAEKWRPYRSLATSYLFSAAYEPAEAPPAAGGSKA |
Ga0182035_101594311 | 3300016341 | Soil | QEVLAIAEKWRPYRSLATSYLFSAAFERTGAPPARPGAAT |
Ga0182032_102443621 | 3300016357 | Soil | QQEVLAIAEKWRPYRSLATSYLFSAAFERTEAPVGTT |
Ga0182032_116511782 | 3300016357 | Soil | LAIAEKWRPYRSLATSYLFSAAFESTQASPVARLGNVARRGR |
Ga0182040_109412761 | 3300016387 | Soil | SQQEVLAIAEKWRPYRSLATSYLFSAAFERTGAPPARPGAAT |
Ga0182038_108352001 | 3300016445 | Soil | LAIAEKWRPYRSLATSYLFSAAFEAAEAPPVAPRDV |
Ga0187814_101424332 | 3300017932 | Freshwater Sediment | LAIAEKWRPYRSLATSYLFSAAFEQAEALPAARPGSA |
Ga0187879_102611772 | 3300017946 | Peatland | PSQQEVLAIAEKWRPYRSLATSYLFSAAFDPVEASPVARHRAIEL |
Ga0187879_104877292 | 3300017946 | Peatland | AEKWRPYRSLATSYLFSAAFEPVEASPVPLPRSES |
Ga0190266_104476601 | 3300017965 | Soil | QEVIAIAEKCRPYGSRARCYLFYDAFERPVAPSVVPRET |
Ga0187767_102577422 | 3300017999 | Tropical Peatland | QEVLAIAEKWRPYRSLATSYLFSAAFERTEAPVGTT |
Ga0184608_105064441 | 3300018028 | Groundwater Sediment | AGPSPSQQEVLAIAEEWRPYRSLATSYLDSAAFVPAEVPLVARLRSA |
Ga0187766_111388742 | 3300018058 | Tropical Peatland | LAIAEKWRPHRSLATSYLFSAAFEPAGAPPTARHRSAST |
Ga0190274_136767061 | 3300018476 | Soil | DIAEKWRPYRSLATSYLFSAAFDRTEAPPVVSPET |
Ga0190271_110363181 | 3300018481 | Soil | EVLDIAEKWRPYRSLATSYLFSAAFDRTEAPPVVSPET |
Ga0184646_13799463 | 3300019259 | Groundwater Sediment | EVLAIAEEWRPYRSLATSYLDSAAFVPAEVPLVARLRSA |
Ga0184642_10157461 | 3300019279 | Groundwater Sediment | HLPTPEEVLAIAEKWRPYRSLATSYLFSAAFEQAEAPPVVPSET |
Ga0184642_10604123 | 3300019279 | Groundwater Sediment | EVLAIAEEWRPYRSLATSYLDSAVFVPAEVPLVARLRSA |
Ga0193739_10029236 | 3300020003 | Soil | SQQEVLAIAEKWRPYRSLATSYLFSAAFERTEAPPVVPDTT |
Ga0206355_15046523 | 3300020076 | Corn, Switchgrass And Miscanthus Rhizosphere | ELLAIAEEWRHYHSLATRYVGSAAFVPAEVPLVARLRSA |
Ga0210403_101592343 | 3300020580 | Soil | AERWRPYRSLATSYLFSVAYEPAQAPPVPPRQTEQ |
Ga0210403_111284202 | 3300020580 | Soil | LDIADKWRPYRSLATSYLFSAAFEPAEAPPAARQRSAGT |
Ga0210399_113240922 | 3300020581 | Soil | TQEEVLAIAEKWRPYRSLATSYLFSAAFEPAGDPVRSA |
Ga0210399_114685951 | 3300020581 | Soil | LAIADKWRPYRSLATSYLFTATFAQAKTPPAAPRKT |
Ga0210401_102339675 | 3300020583 | Soil | TQQEVLAIADKWRPYRSLATSYLFSATFAQAKTPPAAQRKT |
Ga0210404_105655691 | 3300021088 | Soil | QEEVLAIAEKWRPYRSLATSYLFSAAFEPAGDPVRSA |
Ga0193699_102688371 | 3300021363 | Soil | LAIAEKWRPYRSLATSYLFSATFGPKDEPHVAPREA |
Ga0210386_113716131 | 3300021406 | Soil | PTQEEVLAIAGKWRPYRSLATSYLFSAAFEPAEAPPVARHTSA |
Ga0210383_111403811 | 3300021407 | Soil | VLDIAENWRPYRSLATSYLFSAAFEPAGAPPAAPSET |
Ga0210384_118909262 | 3300021432 | Soil | AIAERWRPYRSLATSYLFSVAYEPAQAPPVPPRQTEQ |
Ga0210391_101519051 | 3300021433 | Soil | PTPVEVLAIAEKWRPYRSVATRYLFSASPGEADSAT |
Ga0210398_105305322 | 3300021477 | Soil | QEDLAIADKWRPYRSLATSYLFSATFVPAKTPPAAQRKT |
Ga0210409_110052632 | 3300021559 | Soil | TQQEVLAIAEKWRPYRSLATSYLFSAAFERTEAPVGTT |
Ga0210409_110702143 | 3300021559 | Soil | EEVLAIAEKWRPYRSLATSYLFSAAFEQTGAPPVARLGSA |
Ga0126371_126327592 | 3300021560 | Tropical Forest Soil | DIADQWQPYRSLATSYLLSAAFEPTEAPPTAQHESAGT |
Ga0224452_11086063 | 3300022534 | Groundwater Sediment | EVLAIAEKWRPYRSLATSYLFSAAFEPAEAPPVARLGSA |
Ga0242677_10868061 | 3300022713 | Soil | AEKWRPYRSLATSYLFSAAFQPADAQSDLTDRKRSSGT |
Ga0208480_10448432 | 3300025633 | Arctic Peat Soil | LAIAEKWRPYRSLATSYLFSAAFEQTGAPPVARLGSA |
Ga0207692_105781141 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | LPTQQEVLAIAEKWRPYRSLATSYLFSAAFDRTEAPPVVPRDAG |
Ga0207693_104202992 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | LPTQQEVLDIAEKWRPYRSLATSYLFSAAYEPAGAPPVT |
Ga0207693_109337982 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | LPTQQEVLDIAEKWRPYRSLATSYLFSAAYEPAGAPPVA |
Ga0207663_100119424 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | PTQQEVLAIADKWRPYRSLATSYLFSATFAQAKTPPAAQRKT |
Ga0207663_117382122 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | QQEVLDIAEKWRPYRSLATSYLFSAAFEPAGPPPR |
Ga0207700_120176181 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | AAAYQLGHLPSEQEVLAIASKWRPYRSLATSYLFSSVLES |
Ga0207664_102423801 | 3300025929 | Agricultural Soil | PSQQEVLDIAEKWRPHRSLATSYLFSAAFEPSDTPPVAPRET |
Ga0207706_109401381 | 3300025933 | Corn Rhizosphere | VLAIAERWRPYRSLATSYLFSAAFEPAGVPPAARLGSA |
Ga0207704_108973652 | 3300025938 | Miscanthus Rhizosphere | QQEVLAIAEKWRPYRSLATSYLFSAAFERTAAPSVVPRET |
Ga0207704_116369801 | 3300025938 | Miscanthus Rhizosphere | AIAEEWRPYHRLATRYVGSAAFVPAEVPLVARLRSA |
Ga0207665_104473482 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | SQQEVLAIAEKWRPYRSLATSYLFSAAFERADAPVGTT |
Ga0207665_109537712 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | LPTLQEVRDIAENWRPYRSLATSYLFSAAYEPAGAPPVA |
Ga0257166_10562803 | 3300026358 | Soil | PTQEEVLAIAEKWRPYRSLATSYMFSAAFEPTEAPPVARLGSA |
Ga0208488_10629111 | 3300027110 | Forest Soil | PAEQEVLAIAEKWRPYRSLATSYLFSAAFERAEAPPATPSGRREQA |
Ga0208324_100111710 | 3300027604 | Peatlands Soil | PSQQEVLAIAENWRPYRSLATSYLFSAAFEPAEVPARST |
Ga0209178_12347801 | 3300027725 | Agricultural Soil | PTQQEVLAIAEKWRPYRSLATSYLFSAAFDRTEAPPVVPRDAG |
Ga0209178_13339842 | 3300027725 | Agricultural Soil | AQQEVLDIAEKWRPYRSLATSYLFSAAFDPAGAPPAAPAEP |
Ga0209177_104887271 | 3300027775 | Agricultural Soil | VLAIAENWRPYRSLATSYLFSAAFEPAEAPPVAPREV |
Ga0209580_106146141 | 3300027842 | Surface Soil | HLPSQQEVLDIAEKWRPYRSLATSYLFSAALERVDEEEASAASP |
Ga0209701_104694081 | 3300027862 | Vadose Zone Soil | EQEVLTLAGKWRPYRSLATSYLFAAAYERAEAPPAASPVPAHP |
Ga0209283_108001241 | 3300027875 | Vadose Zone Soil | SQQEVLAIADKWRPYRSLATGYLFSAAFEPAEAPPAGRQGSA |
Ga0209275_101752831 | 3300027884 | Soil | EEEVLAIAEKWRPYRSLATSYLFSAAFEQNEAPATVPET |
Ga0209488_104876533 | 3300027903 | Vadose Zone Soil | LAIAEKWRPYRSLATSYLFSAAFERTETPPAAPRET |
Ga0268265_123186322 | 3300028380 | Switchgrass Rhizosphere | PTQQEVLAIAEKWRPYRSLATSYLFSTAFEPTDAPAVVPSET |
Ga0247828_102393743 | 3300028587 | Soil | QEVLAIAEKWRPYRSLATSYLFSAAFEQTEAPPVVPHET |
Ga0247828_105640631 | 3300028587 | Soil | QEVLAIAEKWRPYRSLATSYLFSAAFERTEAPPVAPHET |
Ga0307323_100260844 | 3300028787 | Soil | AIAEKWRPYRSLATSYLFSAAFERTEARPVAPHET |
Ga0307284_100029131 | 3300028799 | Soil | AIAEKWRPYRSLATSYLFSAAFEPAEAPPLAPREK |
Ga0302226_100769281 | 3300028801 | Palsa | TQEEVLAIAEKWRPYRSLATSYLFSAAFEPAEAPPVARQTNG |
Ga0307305_100430611 | 3300028807 | Soil | ILDIADKWRPYRSLATSYLFSAAFEPAGAPPAARHSNAGT |
Ga0307296_101147291 | 3300028819 | Soil | QEILDIADKWRPYRSLATSYLFSAAFEPAGAPPAARHSNAGT |
Ga0307312_101348841 | 3300028828 | Soil | EVLAIADSWRPYRSLATSYLFSAAFEESEAPRVVPPS |
Ga0307277_104587741 | 3300028881 | Soil | PSQQEVLAIAEKWRPYRSLATSYLFSAAFEPTEAPPAARLGSA |
Ga0308309_116257532 | 3300028906 | Soil | EVLTIAEKWRPYRSLATSYLFSAAFEPPPPSRLPA |
Ga0310037_101063173 | 3300030494 | Peatlands Soil | MKAIAEKWRPYRSLATSYLFSAAFEPAEAPPVVGPRSA |
Ga0265762_11185671 | 3300030760 | Soil | EKWRPYRSLATSYLFATAYETDQPGPEVPRTIDPIP |
Ga0308206_10730163 | 3300030903 | Soil | VLAIAEKWRPYRSLATSYLVSAAFEPAEVPLVARLGSA |
Ga0302180_101520661 | 3300031028 | Palsa | PTQEEVLAIAEKWRPYRSLATSYLFSAAFEPAEGPPVARQTNV |
Ga0308189_102019693 | 3300031058 | Soil | LAIAEEWRPYRSLATSYLDSAAFVPAEVPLVARLRSA |
Ga0170824_1013872853 | 3300031231 | Forest Soil | AQEEVLAIAEKWRPYRSLATSYLFSAAFEPAEAPPAVPHRSA |
Ga0302325_126860822 | 3300031234 | Palsa | MLTQQEVLAVAEKWRPYRSLATSYLFSAAFEPAEA |
Ga0318516_102845101 | 3300031543 | Soil | SQEEVLALAEPGRPYRSLANSYLFASAFEPAEAPPAAQHRSAGI |
Ga0318516_107693791 | 3300031543 | Soil | AIAEKWRPYRSLGTSYLFSAAFEGTEGPPPAPRGT |
Ga0318534_101954271 | 3300031544 | Soil | QEVLDIAHKWRPYRSLATSYLFSAAFEPAEAPPTAQQRSAGT |
Ga0318534_103048232 | 3300031544 | Soil | QEVLDIAEKWRPYRSLATSYLFSAAYEPAEGPQAAPRET |
Ga0318534_104977781 | 3300031544 | Soil | QEVLDIAGKWRPYRSLATSYLFSAAFEPAEAPPAAQHESAAT |
Ga0318538_102337891 | 3300031546 | Soil | HLPAEQEVLAIAEKWRPYRSLATSYLFSAAFERTADVPPSARP |
Ga0318571_100969383 | 3300031549 | Soil | QEVLDIAEKWRPYRSLATSYLFSAAFEPPETPQVAPSEP |
Ga0318571_102870901 | 3300031549 | Soil | GGQVVLAIAETWRPYRSLATSYLFSAAFGPAAAPPGSASAF |
Ga0318515_100554482 | 3300031572 | Soil | PQEVLDIAENWRPYRSLATSYLFSAAFEPAEAPPVAPREV |
Ga0318555_105290373 | 3300031640 | Soil | QQEVLDIAEKWRPYRSLATSYLFSAAFEPAETPQVAPPEP |
Ga0318542_107390921 | 3300031668 | Soil | LPTQQEVLDIAGKWRPYRSLATSYLFSAAFEPTDAPPVA |
Ga0318572_102537471 | 3300031681 | Soil | LPAQQEVLDIAEKWRPYRSLATSYLFSAAYEPAQAPPAPPRPDRS |
Ga0318560_102570731 | 3300031682 | Soil | QQEVLAIAEKWRPYRSLATSYLFSAAFEPAEAPPVTSRET |
Ga0310686_1053783221 | 3300031708 | Soil | EVLAIAEKWRPYRSLATSYLFSAAFEPTPPSGLPA |
Ga0318496_107822212 | 3300031713 | Soil | QQEVLAIAEKWRPYRSLATSYLFSAAFETAQAPPQG |
Ga0306917_100722924 | 3300031719 | Soil | AQQEVLAIAESWRPYRSLATSYLFSAAFEPASAPPAPSPP |
Ga0306918_110225061 | 3300031744 | Soil | EVLAIAEKWRPYRSLATSYLFSAAFEPAEAPPVTSRET |
Ga0318494_100466413 | 3300031751 | Soil | LDIAHKWRPYRSLATSYLFSAAFEPAEAPPTAQQRSAGT |
Ga0318521_100232211 | 3300031770 | Soil | GRAAIAEKWRPYRSLATSYLFSAAYEPAEAPPAAGGSKA |
Ga0318521_107321102 | 3300031770 | Soil | LPAQQEVLAIAEKWRPYRSLATSYLFSAAFESAGQP |
Ga0318546_104905521 | 3300031771 | Soil | LPTQPEVLAIAEKWRPYRSLATSYLFSAAYESTQALPVARLGNVARRGR |
Ga0318576_101445702 | 3300031796 | Soil | HLPAQQEVLDIAAKWRPYRSLATSYLFSTAYESAEAPPAAPRET |
Ga0318565_104829871 | 3300031799 | Soil | AENWRPYRSLATSYLFSAAYDPAGALPAAGRRSAGT |
Ga0318497_100467823 | 3300031805 | Soil | AQQEVLDIAEKWRPYRSLATSYLFSAAYEPAEPSQVAPRKP |
Ga0318568_109331971 | 3300031819 | Soil | VLAIAEKWRPYRSLATSYLFSAAYEPAGAPPPAPRET |
Ga0318499_103584502 | 3300031832 | Soil | PEVLAIAEKWRPYRSLATSYLFSAAFEPGQAPPVARLGSA |
Ga0306919_114268491 | 3300031879 | Soil | PTQQEVLAIADKWRPYRSLATSYLFSATFAEAKTPPAAQRKT |
Ga0306925_118888391 | 3300031890 | Soil | VLALAEPGRPYRSLANSYLFASAFEPAEAPPAAQHRSAGI |
Ga0306925_120707162 | 3300031890 | Soil | SQQEVLAIAEKWRPYRSLATSYLFSAAFEPAKAPSVTRLGSA |
Ga0318536_105232981 | 3300031893 | Soil | AIAEKWRPYRSLATSYLFSAAFEPAEAPPVTSRET |
Ga0318536_106972221 | 3300031893 | Soil | EEVLALAEPWRPYRSLATSYLFASAFEPAEAPPAAQHKSAGT |
Ga0306921_123114211 | 3300031912 | Soil | TEQEVLAIAEKWRPYRSLATSYLFSAAFEPAVAPPVAPRET |
Ga0306921_123888452 | 3300031912 | Soil | LPSQQEVLAIAKKWRPYRSLATSYLFSAAFERTGAPPARPGAAT |
Ga0310912_109785292 | 3300031941 | Soil | LDIAENWRPYRSLATSYLFSAAFEPAEAPPVAPREV |
Ga0310916_112804372 | 3300031942 | Soil | QEVLAIAEKWRPYRSLATSYLFSAAFEPAEAASAHP |
Ga0310910_110551422 | 3300031946 | Soil | PTEQEVLAIAEKWRPYRSLATSYLFSAAFEPAVAPPVAPRET |
Ga0306926_109547382 | 3300031954 | Soil | PSQQQVLAIAEKWRPYRSLATSYLFSAAFEPAGRPPAAP |
Ga0306926_130349571 | 3300031954 | Soil | LAIAEKWRPYRSLATSYLFSAAFERTADVPPSARP |
Ga0318530_102960421 | 3300031959 | Soil | QEVAAIAENWRPYRSLATSYMFSAAYEPGDEPPAAPRES |
Ga0318562_104272463 | 3300032008 | Soil | QPEVLAIAEKWRPYRSLATSYLFSAAFEPGQAPPVARLGSA |
Ga0318569_100345273 | 3300032010 | Soil | LDIAAKWRPYRSLATSYLFSTAYESAEAPPAAPRET |
Ga0318556_100941751 | 3300032043 | Soil | QEVLDIAENWRPYRSLATSYLFSAAFEPAEAPPVAPREV |
Ga0318513_101953313 | 3300032065 | Soil | PAQQEVLDIASKWRPYRSLATSYLFSAAFEQAGTPPAAPRQT |
Ga0318513_105202051 | 3300032065 | Soil | SQQEVLDIAEKWRPYRSLATSYLFSAAYEPAEGPQAAPRET |
Ga0318514_105575181 | 3300032066 | Soil | DIASKWRPYRSLATSYLFSAAFEPAGAPPTAQHGNAGT |
Ga0307471_1012989841 | 3300032180 | Hardwood Forest Soil | VLAIAEKWRPYRSLATSYLFSAAFESAGEPAAPRDP |
Ga0307471_1015701883 | 3300032180 | Hardwood Forest Soil | EVLAIAAKWRPYRSLATSYLFSATFAQAKTRRAAPRKT |
Ga0307471_1042149692 | 3300032180 | Hardwood Forest Soil | PTPQEVLDIADKWRPYRSLATSYLFSAAFEPAGAPPAARRGSAGA |
Ga0307472_1005555351 | 3300032205 | Hardwood Forest Soil | LAIAEEWRPYDSLATRYVGSAAFVPAEVPLVARLRSA |
Ga0306920_1019201621 | 3300032261 | Soil | LGHLPTQQEVIDIAEKWRPHRSLATSYLFSAAFEPAEAKPASPDG |
Ga0306920_1028689181 | 3300032261 | Soil | AIAEKWRPYRSLATSYLFSAAFEPAVAPPVAPRET |
Ga0306920_1035752122 | 3300032261 | Soil | LPAEQEVLAIAEKWRPYRSLATSYLFSAAFERPEAT |
Ga0335079_114594291 | 3300032783 | Soil | TAIAEPWRPYRSLATSYLFSAPGAEQAPPAPPVTPAP |
Ga0335078_102137304 | 3300032805 | Soil | QQEVLDIAEKWRPYRSLATSYLFSSAYEPAEAPAH |
Ga0335072_1001230011 | 3300032898 | Soil | QLPAPQQVLDIADKWRPYRSLATSYLFSAAFEPDH |
Ga0335072_101890961 | 3300032898 | Soil | LPAPEEVLAIADKWRPYRSLATSYLFSSAFEQTEA |
Ga0335083_101839182 | 3300032954 | Soil | AIADNWRPYRSLATSYLFSAAFDPAQPPPAAPRET |
Ga0314786_130164_3_122 | 3300034664 | Soil | ELLAIAEEWRPYHSLATRYVGSAAFVPAEVPLVARLRSA |
⦗Top⦘ |