NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F017698

Metagenome Family F017698

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F017698
Family Type Metagenome
Number of Sequences 239
Average Sequence Length 43 residues
Representative Sequence MRESLGNEIPDTAPYTEWLAIVGSIVVAVLVCAVLFSNGILT
Number of Associated Samples 140
Number of Associated Scaffolds 239

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 56.07 %
% of genes near scaffold ends (potentially truncated) 60.25 %
% of genes from short scaffolds (< 2000 bps) 83.68 %
Associated GOLD sequencing projects 131
AlphaFold2 3D model prediction Yes
3D model pTM-score0.50

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (71.967 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(26.778 % of family members)
Environment Ontology (ENVO) Unclassified
(42.678 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(48.536 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 37.14%    β-sheet: 0.00%    Coil/Unstructured: 62.86%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.50
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 239 Family Scaffolds
PF04519Bactofilin 42.26
PF12697Abhydrolase_6 3.35
PF00561Abhydrolase_1 2.09
PF04392ABC_sub_bind 1.67
PF00498FHA 1.67
PF13458Peripla_BP_6 0.42
PF13432TPR_16 0.42
PF12071DUF3551 0.42
PF09834DUF2061 0.42
PF12728HTH_17 0.42
PF06724DUF1206 0.42
PF06537DHOR 0.42
PF00589Phage_integrase 0.42
PF02265S1-P1_nuclease 0.42
PF13414TPR_11 0.42
PF00296Bac_luciferase 0.42
PF07690MFS_1 0.42
PF14525AraC_binding_2 0.42
PF01544CorA 0.42
PF02899Phage_int_SAM_1 0.42
PF13924Lipocalin_5 0.42

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 239 Family Scaffolds
COG1664Cytoskeletal protein CcmA, bactofilin familyCytoskeleton [Z] 42.26
COG2984ABC-type uncharacterized transport system, periplasmic componentGeneral function prediction only [R] 1.67
COG0598Mg2+ and Co2+ transporter CorAInorganic ion transport and metabolism [P] 0.42
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 0.42
COG3488Uncharacterized conserved protein with two CxxC motifs, DUF1111 familyGeneral function prediction only [R] 0.42
COG4973Site-specific recombinase XerCReplication, recombination and repair [L] 0.42
COG4974Site-specific recombinase XerDReplication, recombination and repair [L] 0.42


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms71.97 %
UnclassifiedrootN/A28.03 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459019|G14TP7Y01EQBWSNot Available712Open in IMG/M
3300000550|F24TB_11156596All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium813Open in IMG/M
3300000580|AF_2010_repII_A01DRAFT_1064929Not Available556Open in IMG/M
3300000597|AF_2010_repII_A1DRAFT_10019789All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1849Open in IMG/M
3300000597|AF_2010_repII_A1DRAFT_10082123All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium806Open in IMG/M
3300000597|AF_2010_repII_A1DRAFT_10085648Not Available786Open in IMG/M
3300000597|AF_2010_repII_A1DRAFT_10114846Not Available659Open in IMG/M
3300000651|AP72_2010_repI_A10DRAFT_1018675All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria887Open in IMG/M
3300000655|AF_2010_repII_A100DRAFT_1088660Not Available543Open in IMG/M
3300000793|AF_2010_repII_A001DRAFT_10028854Not Available1307Open in IMG/M
3300000793|AF_2010_repII_A001DRAFT_10065662All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium790Open in IMG/M
3300000793|AF_2010_repII_A001DRAFT_10086364Not Available667Open in IMG/M
3300002906|JGI25614J43888_10137440All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium645Open in IMG/M
3300002907|JGI25613J43889_10139084All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium623Open in IMG/M
3300003505|JGIcombinedJ51221_10198335All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium815Open in IMG/M
3300004463|Ga0063356_103626701All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium665Open in IMG/M
3300004633|Ga0066395_10200811All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1043Open in IMG/M
3300005186|Ga0066676_10752299Not Available663Open in IMG/M
3300005332|Ga0066388_100523076All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1819Open in IMG/M
3300005332|Ga0066388_100630164All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1690Open in IMG/M
3300005332|Ga0066388_101472799All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1188Open in IMG/M
3300005332|Ga0066388_101493317All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1181Open in IMG/M
3300005332|Ga0066388_102367265All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium962Open in IMG/M
3300005332|Ga0066388_102979035All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria865Open in IMG/M
3300005332|Ga0066388_105245854Not Available657Open in IMG/M
3300005332|Ga0066388_106741972All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium578Open in IMG/M
3300005436|Ga0070713_101480745All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium659Open in IMG/M
3300005445|Ga0070708_100355922All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1380Open in IMG/M
3300005445|Ga0070708_101292911All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium681Open in IMG/M
3300005468|Ga0070707_100367888All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 211397Open in IMG/M
3300005468|Ga0070707_100560568All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae1104Open in IMG/M
3300005468|Ga0070707_101400799All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium666Open in IMG/M
3300005471|Ga0070698_100084620All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3159Open in IMG/M
3300005471|Ga0070698_100124200All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2538Open in IMG/M
3300005471|Ga0070698_100542131All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1102Open in IMG/M
3300005471|Ga0070698_100567541All Organisms → cellular organisms → Bacteria1074Open in IMG/M
3300005518|Ga0070699_100136435All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2164Open in IMG/M
3300005518|Ga0070699_100499804All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1104Open in IMG/M
3300005518|Ga0070699_101632850All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium590Open in IMG/M
3300005536|Ga0070697_101152637All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria690Open in IMG/M
3300005554|Ga0066661_10581490Not Available667Open in IMG/M
3300005554|Ga0066661_10804093Not Available550Open in IMG/M
3300005555|Ga0066692_10928886Not Available533Open in IMG/M
3300005556|Ga0066707_10585553Not Available715Open in IMG/M
3300005559|Ga0066700_10425456All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium935Open in IMG/M
3300005562|Ga0058697_10060583All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1477Open in IMG/M
3300005568|Ga0066703_10775440Not Available549Open in IMG/M
3300005598|Ga0066706_10730493Not Available786Open in IMG/M
3300005618|Ga0068864_101691873All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium637Open in IMG/M
3300005713|Ga0066905_100157926All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1643Open in IMG/M
3300005713|Ga0066905_100440178Not Available1068Open in IMG/M
3300005713|Ga0066905_100442528All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1066Open in IMG/M
3300005713|Ga0066905_100952584Not Available754Open in IMG/M
3300005713|Ga0066905_101369100Not Available639Open in IMG/M
3300005713|Ga0066905_101726722All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium576Open in IMG/M
3300005713|Ga0066905_102109513Not Available524Open in IMG/M
3300005764|Ga0066903_100563271All Organisms → cellular organisms → Bacteria → Proteobacteria1959Open in IMG/M
3300005764|Ga0066903_100798407All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1687Open in IMG/M
3300005764|Ga0066903_101294312All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1361Open in IMG/M
3300005764|Ga0066903_103074594All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium903Open in IMG/M
3300005764|Ga0066903_106378877Not Available615Open in IMG/M
3300005764|Ga0066903_109119370All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium501Open in IMG/M
3300006028|Ga0070717_10241041All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1595Open in IMG/M
3300006028|Ga0070717_10297883All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1433Open in IMG/M
3300006028|Ga0070717_10378289Not Available1269Open in IMG/M
3300006028|Ga0070717_10554894All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1040Open in IMG/M
3300006028|Ga0070717_10700162Not Available920Open in IMG/M
3300006028|Ga0070717_11160360All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium703Open in IMG/M
3300006038|Ga0075365_10014765All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria4705Open in IMG/M
3300006173|Ga0070716_101636967All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium530Open in IMG/M
3300006175|Ga0070712_100561651All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria962Open in IMG/M
3300006791|Ga0066653_10094878All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1347Open in IMG/M
3300006797|Ga0066659_11552292Not Available555Open in IMG/M
3300006800|Ga0066660_11208691Not Available593Open in IMG/M
3300006845|Ga0075421_102613681Not Available524Open in IMG/M
3300006846|Ga0075430_100028336All Organisms → cellular organisms → Bacteria4759Open in IMG/M
3300006854|Ga0075425_100187286All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2377Open in IMG/M
3300006871|Ga0075434_101932393Not Available596Open in IMG/M
3300006880|Ga0075429_101454305All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium597Open in IMG/M
3300007076|Ga0075435_100916035All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium765Open in IMG/M
3300009100|Ga0075418_10729812All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1069Open in IMG/M
3300009100|Ga0075418_12775210Not Available535Open in IMG/M
3300009162|Ga0075423_10080630All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3390Open in IMG/M
3300009168|Ga0105104_10240090All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales989Open in IMG/M
3300009168|Ga0105104_10578089Not Available638Open in IMG/M
3300010043|Ga0126380_10019901All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3202Open in IMG/M
3300010043|Ga0126380_11038101All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium693Open in IMG/M
3300010047|Ga0126382_11375221All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium642Open in IMG/M
3300010047|Ga0126382_12277586Not Available523Open in IMG/M
3300010323|Ga0134086_10266564All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium656Open in IMG/M
3300010361|Ga0126378_11354255Not Available805Open in IMG/M
3300010361|Ga0126378_11920066All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium674Open in IMG/M
3300010361|Ga0126378_11976681Not Available664Open in IMG/M
3300010361|Ga0126378_13455311All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium501Open in IMG/M
3300010366|Ga0126379_10692678All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1112Open in IMG/M
3300010863|Ga0124850_1000623All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria8274Open in IMG/M
3300011120|Ga0150983_11206269All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium736Open in IMG/M
3300012021|Ga0120192_10125488Not Available542Open in IMG/M
3300012201|Ga0137365_10007351All Organisms → cellular organisms → Bacteria8782Open in IMG/M
3300012202|Ga0137363_10325858All Organisms → cellular organisms → Bacteria1266Open in IMG/M
3300012202|Ga0137363_10699793Not Available858Open in IMG/M
3300012202|Ga0137363_11637006All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium536Open in IMG/M
3300012205|Ga0137362_10895976All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria758Open in IMG/M
3300012205|Ga0137362_11639411All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium530Open in IMG/M
3300012207|Ga0137381_11264775Not Available631Open in IMG/M
3300012209|Ga0137379_11229580All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium656Open in IMG/M
3300012211|Ga0137377_10186161All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1994Open in IMG/M
3300012211|Ga0137377_10799077All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes876Open in IMG/M
3300012361|Ga0137360_10389540Not Available1173Open in IMG/M
3300012362|Ga0137361_10216419Not Available1737Open in IMG/M
3300012362|Ga0137361_10825514All Organisms → cellular organisms → Bacteria843Open in IMG/M
3300012917|Ga0137395_10496001All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium879Open in IMG/M
3300012930|Ga0137407_10777629All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium904Open in IMG/M
3300012948|Ga0126375_10136595All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1523Open in IMG/M
3300012951|Ga0164300_10083092All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1363Open in IMG/M
3300012961|Ga0164302_10970430All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium659Open in IMG/M
3300012971|Ga0126369_10568908Not Available1200Open in IMG/M
3300012971|Ga0126369_11533976Not Available756Open in IMG/M
3300012971|Ga0126369_12222410Not Available636Open in IMG/M
3300015359|Ga0134085_10435728All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria592Open in IMG/M
3300016270|Ga0182036_11111306All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium655Open in IMG/M
3300016294|Ga0182041_10245888All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1453Open in IMG/M
3300016294|Ga0182041_10393975All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1176Open in IMG/M
3300016294|Ga0182041_10418456All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1144Open in IMG/M
3300016357|Ga0182032_11086436Not Available686Open in IMG/M
3300016387|Ga0182040_11538838All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium565Open in IMG/M
3300016422|Ga0182039_11540843All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium606Open in IMG/M
3300017657|Ga0134074_1061825All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1269Open in IMG/M
3300018078|Ga0184612_10076970All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1740Open in IMG/M
3300018431|Ga0066655_10116671All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1525Open in IMG/M
3300018433|Ga0066667_11917236All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium541Open in IMG/M
3300020579|Ga0210407_10724019Not Available771Open in IMG/M
3300021405|Ga0210387_10304228All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1403Open in IMG/M
3300021444|Ga0213878_10075120All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1348Open in IMG/M
3300025910|Ga0207684_10143839All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2051Open in IMG/M
3300025910|Ga0207684_10719413All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium847Open in IMG/M
3300025910|Ga0207684_11202328All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium627Open in IMG/M
3300025922|Ga0207646_10316177All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1411Open in IMG/M
3300025939|Ga0207665_11305717All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium578Open in IMG/M
3300026319|Ga0209647_1176874All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7824Open in IMG/M
3300027643|Ga0209076_1073717All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium971Open in IMG/M
3300028878|Ga0307278_10046625All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1966Open in IMG/M
3300028878|Ga0307278_10062182All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1686Open in IMG/M
3300031474|Ga0170818_101756980All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium591Open in IMG/M
3300031543|Ga0318516_10009756All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales4599Open in IMG/M
3300031543|Ga0318516_10024171All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium3145Open in IMG/M
3300031543|Ga0318516_10805575Not Available530Open in IMG/M
3300031544|Ga0318534_10041556All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2553Open in IMG/M
3300031544|Ga0318534_10113848All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1553Open in IMG/M
3300031544|Ga0318534_10653846Not Available595Open in IMG/M
3300031545|Ga0318541_10043826All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2274Open in IMG/M
3300031545|Ga0318541_10191814All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1129Open in IMG/M
3300031546|Ga0318538_10011264All Organisms → cellular organisms → Bacteria → Proteobacteria3731Open in IMG/M
3300031546|Ga0318538_10284119All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium891Open in IMG/M
3300031564|Ga0318573_10010887All Organisms → cellular organisms → Bacteria3836Open in IMG/M
3300031564|Ga0318573_10500112Not Available654Open in IMG/M
3300031573|Ga0310915_10315010All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1106Open in IMG/M
3300031640|Ga0318555_10064221All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1886Open in IMG/M
3300031640|Ga0318555_10122465Not Available1382Open in IMG/M
3300031640|Ga0318555_10326571Not Available831Open in IMG/M
3300031640|Ga0318555_10405517All Organisms → cellular organisms → Bacteria738Open in IMG/M
3300031668|Ga0318542_10129136All Organisms → cellular organisms → Bacteria → Proteobacteria1242Open in IMG/M
3300031679|Ga0318561_10424052Not Available731Open in IMG/M
3300031680|Ga0318574_10090856All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1679Open in IMG/M
3300031680|Ga0318574_10324794All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → unclassified Bradyrhizobiaceae → Bradyrhizobiaceae bacterium895Open in IMG/M
3300031681|Ga0318572_10050867All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2230Open in IMG/M
3300031681|Ga0318572_10931391All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium516Open in IMG/M
3300031682|Ga0318560_10041626All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2228Open in IMG/M
3300031713|Ga0318496_10344960Not Available823Open in IMG/M
3300031719|Ga0306917_10032291All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Variibacter → Variibacter gotjawalensis3374Open in IMG/M
3300031719|Ga0306917_10058155All Organisms → cellular organisms → Bacteria2631Open in IMG/M
3300031719|Ga0306917_10067840All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2462Open in IMG/M
3300031719|Ga0306917_10113603All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1962Open in IMG/M
3300031719|Ga0306917_10229793Not Available1415Open in IMG/M
3300031719|Ga0306917_11553262All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium508Open in IMG/M
3300031724|Ga0318500_10323554All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium758Open in IMG/M
3300031724|Ga0318500_10382725All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium698Open in IMG/M
3300031724|Ga0318500_10483324Not Available621Open in IMG/M
3300031744|Ga0306918_10083440Not Available2230Open in IMG/M
3300031744|Ga0306918_10279314All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1281Open in IMG/M
3300031744|Ga0306918_10874486All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium700Open in IMG/M
3300031744|Ga0306918_11042481All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium634Open in IMG/M
3300031747|Ga0318502_10801262All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria571Open in IMG/M
3300031748|Ga0318492_10035190All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2271Open in IMG/M
3300031751|Ga0318494_10163671Not Available1257Open in IMG/M
3300031763|Ga0318537_10238737All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium675Open in IMG/M
3300031765|Ga0318554_10801491Not Available526Open in IMG/M
3300031777|Ga0318543_10027525All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2183Open in IMG/M
3300031777|Ga0318543_10255954Not Available781Open in IMG/M
3300031778|Ga0318498_10143109All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1088Open in IMG/M
3300031779|Ga0318566_10065968All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1743Open in IMG/M
3300031780|Ga0318508_1192628All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium583Open in IMG/M
3300031781|Ga0318547_10190079Not Available1223Open in IMG/M
3300031782|Ga0318552_10055168All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1891Open in IMG/M
3300031782|Ga0318552_10204209Not Available1000Open in IMG/M
3300031793|Ga0318548_10516442Not Available583Open in IMG/M
3300031821|Ga0318567_10086504All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1679Open in IMG/M
3300031833|Ga0310917_10034815All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3003Open in IMG/M
3300031835|Ga0318517_10125986All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1135Open in IMG/M
3300031859|Ga0318527_10182303All Organisms → cellular organisms → Bacteria886Open in IMG/M
3300031879|Ga0306919_10050839All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2741Open in IMG/M
3300031879|Ga0306919_10658179All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium807Open in IMG/M
3300031879|Ga0306919_10914208All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium672Open in IMG/M
3300031890|Ga0306925_11473941All Organisms → cellular organisms → Bacteria667Open in IMG/M
3300031896|Ga0318551_10852967Not Available531Open in IMG/M
3300031897|Ga0318520_10861867All Organisms → cellular organisms → Bacteria → Proteobacteria569Open in IMG/M
3300031910|Ga0306923_10099392All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3282Open in IMG/M
3300031910|Ga0306923_10121746All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria2960Open in IMG/M
3300031910|Ga0306923_10452341Not Available1456Open in IMG/M
3300031910|Ga0306923_10664458All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1163Open in IMG/M
3300031912|Ga0306921_10093799All Organisms → cellular organisms → Bacteria3470Open in IMG/M
3300031912|Ga0306921_12323643Not Available561Open in IMG/M
3300031941|Ga0310912_10038154All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3314Open in IMG/M
3300031941|Ga0310912_10069321All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2534Open in IMG/M
3300031942|Ga0310916_10059424All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2954Open in IMG/M
3300031945|Ga0310913_10088799All Organisms → cellular organisms → Bacteria2073Open in IMG/M
3300031945|Ga0310913_10173436Not Available1499Open in IMG/M
3300031945|Ga0310913_10269376All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1198Open in IMG/M
3300031946|Ga0310910_10167469All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1690Open in IMG/M
3300031954|Ga0306926_10026075All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria6801Open in IMG/M
3300031954|Ga0306926_10648911All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1284Open in IMG/M
3300031954|Ga0306926_11753808Not Available706Open in IMG/M
3300031954|Ga0306926_12255633Not Available604Open in IMG/M
3300031959|Ga0318530_10097546All Organisms → cellular organisms → Bacteria1165Open in IMG/M
3300032001|Ga0306922_10198884All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2151Open in IMG/M
3300032010|Ga0318569_10368702All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria669Open in IMG/M
3300032043|Ga0318556_10144641Not Available1224Open in IMG/M
3300032068|Ga0318553_10200433All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1040Open in IMG/M
3300032076|Ga0306924_10089629All Organisms → cellular organisms → Bacteria → Proteobacteria3460Open in IMG/M
3300032076|Ga0306924_10157843All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2598Open in IMG/M
3300032076|Ga0306924_10408741Not Available1553Open in IMG/M
3300032076|Ga0306924_10671245All Organisms → cellular organisms → Bacteria1166Open in IMG/M
3300032091|Ga0318577_10235061All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium877Open in IMG/M
3300032091|Ga0318577_10409708Not Available647Open in IMG/M
3300032261|Ga0306920_100301766All Organisms → cellular organisms → Bacteria2385Open in IMG/M
3300032261|Ga0306920_101341273All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1027Open in IMG/M
3300032261|Ga0306920_101350461All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1023Open in IMG/M
3300032261|Ga0306920_103697331All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium561Open in IMG/M
3300033290|Ga0318519_10949686Not Available532Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil26.78%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil16.74%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere11.30%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil9.62%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil6.69%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil5.44%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.60%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil4.60%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere3.77%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.09%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.67%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.26%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.84%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.84%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.42%
Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil0.42%
TerrestrialEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial0.42%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.42%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.42%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.42%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere0.42%
AgaveHost-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave0.42%
Switchgrass, Maize And Mischanthus LitterEngineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter0.42%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459019Litter degradation MG4EngineeredOpen in IMG/M
3300000550Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemlyEnvironmentalOpen in IMG/M
3300000580Forest soil microbial communities from Amazon forest - 2010 replicate II A01EnvironmentalOpen in IMG/M
3300000597Forest soil microbial communities from Amazon forest - 2010 replicate II A1EnvironmentalOpen in IMG/M
3300000651Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A10EnvironmentalOpen in IMG/M
3300000655Forest soil microbial communities from Amazon forest - 2010 replicate II A100EnvironmentalOpen in IMG/M
3300000793Forest soil microbial communities from Amazon forest - 2010 replicate II A001EnvironmentalOpen in IMG/M
3300002906Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cmEnvironmentalOpen in IMG/M
3300002907Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cmEnvironmentalOpen in IMG/M
3300003505Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924)EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004633Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBioEnvironmentalOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005554Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110EnvironmentalOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005559Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149EnvironmentalOpen in IMG/M
3300005562Agave microbial communities from Guanajuato, Mexico - As.Ma.eHost-AssociatedOpen in IMG/M
3300005568Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006038Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5Host-AssociatedOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006791Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009168Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010323Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010863Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (PacBio error correction)EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300012021Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - T1EnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300015359Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015EnvironmentalOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300017657Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015EnvironmentalOpen in IMG/M
3300018078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coexEnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021444Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026319Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes)EnvironmentalOpen in IMG/M
3300027643Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes)EnvironmentalOpen in IMG/M
3300028878Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117EnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031763Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031777Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24EnvironmentalOpen in IMG/M
3300031778Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24EnvironmentalOpen in IMG/M
3300031779Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22EnvironmentalOpen in IMG/M
3300031780Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031782Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20EnvironmentalOpen in IMG/M
3300031793Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031835Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21EnvironmentalOpen in IMG/M
3300031859Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031959Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032010Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032091Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
4MG_045633102170459019Switchgrass, Maize And Mischanthus LitterMRQSLGNEIPDTAPYTEWLAIVGSIGVAVLVCAVLFSNGVLT
F24TB_1115659623300000550SoilMRQSLGNEIPDTAPYTEWLAIVGSIVVAVLVCAVLFSNGVLT*
AF_2010_repII_A01DRAFT_106492923300000580Forest SoilMRESVGNEIPDTAPYTEWLALVGSIVVAVLVCAVVFSNGIVT*
AF_2010_repII_A1DRAFT_1001978923300000597Forest SoilMRESLEIPDTAAHVEWLAFVCAIVVAALFCAVLFSNGVLI*
AF_2010_repII_A1DRAFT_1008212323300000597Forest SoilEPLPMRESLKSQIPDTAPHIEWLAFVCAIVVAVLFCAVLFSNGVLT*
AF_2010_repII_A1DRAFT_1008564823300000597Forest SoilMADRRRKGGAMRESLGNEISAPYTEWLAVVGFIVVGCGLRVLFSNDILTRLHWSRH*
AF_2010_repII_A1DRAFT_1011484613300000597Forest SoilMRESLGNEIPDTAPYTEWLAIVGSIVLAVLVCAVLFSNGILT*
AP72_2010_repI_A10DRAFT_101867533300000651Forest SoilVGAAMRESVGNEIPDTAPYTEWLALVGSIVVAVLVCAVVFSNGIVT*
AF_2010_repII_A100DRAFT_108866013300000655Forest SoilMRESVGNEIPDTAPYTEWLALVGSIVVAVLVCAVVFSNGIVT
AF_2010_repII_A001DRAFT_1002885433300000793Forest SoilMRESLGNEIPDTAPYTEWLAIVGSILVAVVVCAVLFSNGILT*
AF_2010_repII_A001DRAFT_1006566223300000793Forest SoilEPLPMRESLEIPDTAAHVEWLAFVCAIVVAALFCAVLFSNGVLI*
AF_2010_repII_A001DRAFT_1008636423300000793Forest SoilMRESLGNEIPDTAPYTEWLALVGSIVVAVLVCAVLFSNGIVT*
JGI25614J43888_1013744023300002906Grasslands SoilMRESLESQIPDTAAYTEWLAIVCSIVVAALFCAVLFSNGALT*
JGI25613J43889_1013908413300002907Grasslands SoilPVPMRESLESQIPDTAAYTEWLAIVCSIVVAALFCAVLFSNGALT*
JGIcombinedJ51221_1019833523300003505Forest SoilMRASLGNEIPDTAPYTEWLALVGSIVVAVLVCAVLFSNGILT*
Ga0063356_10362670123300004463Arabidopsis Thaliana RhizosphereDTGPGADARIVGKIPDTAPYIEWLAIVCAIVVAVLFCAVLFSNGVLT*
Ga0066395_1020081123300004633Tropical Forest SoilMRESLRHEIPDTAPYTEWLAIVGSIIVAVVVCAVLFSNGILT*
Ga0066676_1075229923300005186SoilMRQSLGNEIPDTAPYTEWLAIVGSIGVAVLVCAVLFSNGVLT*
Ga0066388_10052307633300005332Tropical Forest SoilMRESLESQIPDTAAHVEWLAFVSAIVVAALFCAVLFSNGVLI*
Ga0066388_10063016433300005332Tropical Forest SoilMRESLECQIPDTAPHIEWLAFVCAIVVAALFCAVLFSNGVLT*
Ga0066388_10147279923300005332Tropical Forest SoilMRESLGNEIPDTTPYTEWLTMVGSIVVAAVICAVLFSNGILT*
Ga0066388_10149331733300005332Tropical Forest SoilMRESLGNEIPDTAPYTEWLAIVGSIVVAVLVCAVLFSNGILT*
Ga0066388_10236726523300005332Tropical Forest SoilMADLRYAAMRESVGNEIPDTAPYTEWLALVGSIVVAVLVCAVLFSNSILT*
Ga0066388_10297903523300005332Tropical Forest SoilMRESLANEIPDTAPYTEWLAIVGSIIVAVLVCAVLFSNGILT*
Ga0066388_10524585423300005332Tropical Forest SoilMRESLGNEIPDTAPYTEWLALVGSIVVAVLVCAVLFSNGVLT*
Ga0066388_10674197223300005332Tropical Forest SoilVEVGAAMRESLGNEIPDTAAYTEWLALVGSIVVAVLVCAVLFSNGVLT*
Ga0070713_10148074513300005436Corn, Switchgrass And Miscanthus RhizosphereMRASLGNEIPDTAPYTEWLALVGSIVVAVLICAVLLSNGVLT*
Ga0070708_10035592223300005445Corn, Switchgrass And Miscanthus RhizosphereMRVSSGNEIPDTASQWLAIVGSILVAVLVCAVLFSNGILT*
Ga0070708_10129291123300005445Corn, Switchgrass And Miscanthus RhizosphereEVGAAMRESLGNEIPDTAAYTEWLALVGSIVVAVLVCAVLFSNGVLT*
Ga0070707_10036788853300005468Corn, Switchgrass And Miscanthus RhizosphereVGAAMRESLGNEIPDTAAYTEWLALVGSIVVAVLVCAVLFSNGVLT*
Ga0070707_10056056813300005468Corn, Switchgrass And Miscanthus RhizosphereRVSSGNEIPDTASQWLAIVGSILVAVMVCAVLFSNGIVT*
Ga0070707_10140079923300005468Corn, Switchgrass And Miscanthus RhizosphereSLGNEIPDTAPYTEWLALVGSIVVAVLICAVLLSNGVLT*
Ga0070698_10008462013300005471Corn, Switchgrass And Miscanthus RhizosphereDGRLKVEVGAAMRESLGNEIPDTAPYTEWLALVGSIVVAVLVCAVLFSNGILT*
Ga0070698_10012420023300005471Corn, Switchgrass And Miscanthus RhizosphereMRESLGNEIPDTAAYTEWLALVGSIVVAVLVCAVLFSNGVLT*
Ga0070698_10054213123300005471Corn, Switchgrass And Miscanthus RhizosphereMADLSRRGGAMRESSGNEIPDTAPYTEWLAIVGSIVVAVLVCAVLFSNGILT*
Ga0070698_10056754123300005471Corn, Switchgrass And Miscanthus RhizosphereVDAAMRESLGNEIPDTAAYTEWLALVGSIAVAVLVCAVLFSNGILT*
Ga0070699_10013643533300005518Corn, Switchgrass And Miscanthus RhizosphereGGAMRQSLGNEIPDTAPYTEWLAIVGSIGVAVLVCAVLFSNGVLT*
Ga0070699_10049980413300005518Corn, Switchgrass And Miscanthus RhizosphereMRASLRNEIPDTAPYTEWLALVGSIVVAVLVCAVLLSNGILT*
Ga0070699_10163285023300005518Corn, Switchgrass And Miscanthus RhizosphereGGAMRQSLGNEIPDTAPYTEWLAIVGSIGVAVLVCAVLF*
Ga0070697_10115263713300005536Corn, Switchgrass And Miscanthus RhizosphereMGGAMRGSLGNEIPDTTPYTEWLAIVGSIVVAVLVCAVLFSNGVLT*
Ga0066661_1058149023300005554SoilMRQSLGNEIPDTAPYTEWLAIVGSIVVAVLVCAVLFSDSILT*
Ga0066661_1080409313300005554SoilMREPLESQIPDTAPYIEWLAMAGSIIVAVLFCAALFSNS
Ga0066692_1092888623300005555SoilMRESLGNEIPDTAPYTEWLALVGSIVVAVLVCAVLLSNGILT*
Ga0066707_1058555313300005556SoilMRQSLGNEIPDTAPYTEWLAIVGSIVVAVLVCAVLFSNGILT*
Ga0066700_1042545613300005559SoilVGAAMRESLGNEIPDTAPYTEWLALVGSIVVAVLVCAVLFSNGILT*
Ga0058697_1006058313300005562AgaveMRETLGNESPDTAPCTEWLAIVGSIVVAVLVCAVLFSNGILT*
Ga0066703_1077544013300005568SoilMRESLESQIPDTAAYTEWLAIVCSIVVAALFCAVLFSNGA
Ga0066706_1073049313300005598SoilMRESLESQIPDTTPYIEWLAIVCSIVVAALFCAVLFS
Ga0068864_10169187323300005618Switchgrass RhizosphereMRESLGNEIPDMAAYTEWLALVGSIVVAVLVCAVLFSNGILT*
Ga0066905_10015792653300005713Tropical Forest SoilMRESLESQIPDTAPHTEWLAFVCAVVVAVLFCAVLFSNGALT*
Ga0066905_10044017823300005713Tropical Forest SoilMRESLECQIPDTAPHIEWLAFVCAIVVAVLFCAVLFSNGVLT*
Ga0066905_10044252823300005713Tropical Forest SoilMRESSENEIPDTAPYTEWLAIVGSIVVAVLVCAVLFSNGILT*
Ga0066905_10095258433300005713Tropical Forest SoilMRESLGNEIPDTAPYTEWLAMVGSIVVAAVICAVLFSNGILT*
Ga0066905_10136910013300005713Tropical Forest SoilMRESWGNQIPDTAPYTEWLAIVGSIVLAVLVCAVLFSN
Ga0066905_10172672223300005713Tropical Forest SoilMRESLGNEIPDTTPYTEWLAIVGSIVVAALFCAVLFSNGVLT*
Ga0066905_10210951323300005713Tropical Forest SoilMRESLGNEITDTAPYTEWLALVGSIVVAVLVCTVLFSNGILT*
Ga0066903_10056327123300005764Tropical Forest SoilMADLGRKGGAMRELSGNEIPDTALYTEWLAIVGSIVVAAVVCAVLFSNGILT*
Ga0066903_10079840723300005764Tropical Forest SoilVRESSGNEIPDTAPYTEWLAIVGSIVVAVLVCAVLFSNGILT*
Ga0066903_10129431223300005764Tropical Forest SoilMRESLGNEIPDTAPYTEWLAIVGSIVVAVAVCAVLFSNGILT*
Ga0066903_10307459413300005764Tropical Forest SoilMRESSGNEIPDTAPYTEWLAIVGSIVAAVLVCAVLFSNGILT*
Ga0066903_10637887713300005764Tropical Forest SoilMRESLGNEIPDTAPYTEWLAIVGSIVVAAVICAVLFSNGILT*
Ga0066903_10911937013300005764Tropical Forest SoilGNEIPDTAPYTEWLAIVGSIVLAVLVCAVLFSNGILT*
Ga0070717_1024104123300006028Corn, Switchgrass And Miscanthus RhizosphereMDTGTVPMRESLESQIPDTAAYTEWLAIVCSIVVAALFCAVLFSNGALT*
Ga0070717_1029788323300006028Corn, Switchgrass And Miscanthus RhizosphereMRESSGNEIPDTAPYTEWLAIVGSIIVAVLVCAVLFSNGILT*
Ga0070717_1037828923300006028Corn, Switchgrass And Miscanthus RhizosphereMRASLGNEIPDTAPYTEWLALVGSIVVAVLVCAVL
Ga0070717_1055489423300006028Corn, Switchgrass And Miscanthus RhizosphereMRASLGNEIPDTAPYTEWLALVGSIVVAVLVCAVLLSNGILT*
Ga0070717_1070016233300006028Corn, Switchgrass And Miscanthus RhizosphereMADLVGAVMRESVGNEIPDTAPYTEWLALVGSIVVAVLVCAVL
Ga0070717_1116036023300006028Corn, Switchgrass And Miscanthus RhizosphereMRESLRSEIPDTAPYTEWLAIVCSIVMAALFCAAMFSKGVLT*
Ga0075365_1001476563300006038Populus EndosphereMLEELEREIRDTAPYEEWLGVVGSIVVAALVCAVLFSGGILT*
Ga0070716_10163696723300006173Corn, Switchgrass And Miscanthus RhizosphereMREALESQIPDTAPYIEWLAMVGSIIVAVLFCAALFSNSILT*
Ga0070712_10056165123300006175Corn, Switchgrass And Miscanthus RhizosphereMRESLESQIPDTTPYIEWLAMVGSIIVAVLFCAALFSNSILT*
Ga0066653_1009487823300006791SoilMRESSGNEIPDTAPYTEWLAIVGSIVVAVLVCAVLFSDSILT*
Ga0066659_1155229213300006797SoilMRESLESQIPDTTPYIEWLAIVCSIVVAALFCAVLFSNGA
Ga0066660_1120869123300006800SoilMRESLGNEIPDTTPYTEWLAIVGSIVVAVLVCAVLFSNGVLT*
Ga0075421_10261368113300006845Populus RhizosphereMRETLGNETPDTAPYTEWLAIVGSIVVAVLVCAVLFSNGILT*
Ga0075430_10002833633300006846Populus RhizosphereMAHTQMGDAMRDSWGSGIPDTELYTEWLTIVGSIVLAVLLCGVLFSQGALT*
Ga0075425_10018728623300006854Populus RhizosphereMRESLGNEIPDTAPYTEWLAIVGSILVAVLVCAVLFSNGILT*
Ga0075434_10193239323300006871Populus RhizosphereMRESLGHELPDTAPYTEWLAIVGSIVVAVLVCAVLFSNGILT*
Ga0075429_10145430523300006880Populus RhizosphereMRESSGNEIPDTAPYTEWLAIVGSIVVAVLVCAVLFSNGILT*
Ga0075435_10091603523300007076Populus RhizosphereVGAAMRESVGNEIPDTAPYTEWLAIVGSIVVAVLVCAVLFSNGILT*
Ga0075418_1072981213300009100Populus RhizosphereMLEELEREIRDTAPYEEWLGVVGSIVVAALVCAVLFSDGILT*
Ga0075418_1277521013300009100Populus RhizosphereMRETLGNETPDTTPYTEWLAIVGSIVVAVLVCAVLFSNGILT*
Ga0075423_1008063053300009162Populus RhizosphereLESQIPDTAPHIEWLAFVCAIMVAVLFCAVLFSNGVLT*
Ga0105104_1024009013300009168Freshwater SedimentGVLGAAMREFEGSGTPDTEPYAEWLAFVGSIVVAVLLCAVVFTQSSLT*
Ga0105104_1057808913300009168Freshwater SedimentMGGAMRESLESEIPDTAPYKEWLAVVGSIAVAVLIFVVLISNGVVVT*
Ga0126380_1001990153300010043Tropical Forest SoilMHEWLGSQIPDTAPYIEWLAIVCSVMAVLFCTVLFSHGVLT*
Ga0126380_1103810123300010043Tropical Forest SoilEWTQEPLPMRESLESQIPDTAAHVEWLAFVCAIVVAALFCAVLFSNGVLI*
Ga0126382_1137522113300010047Tropical Forest SoilGGAMRESLGNEIPDTAPYTEWLAPVGSIVVAVLVCAVLFSNGILT*
Ga0126382_1227758613300010047Tropical Forest SoilMRESLGNEIPGTAPYTEWLALVGSIVVAVLVCAVLFSNGILT
Ga0134086_1026656423300010323Grasslands SoilQIPDTAAYTEWLAIVCSIVVAALFCAVLFSNGVLT*
Ga0126378_1135425513300010361Tropical Forest SoilMRESLGNEIPDTAPYTEWLAIVGSIVLEVLVCAVL
Ga0126378_1192006613300010361Tropical Forest SoilRLKVEVGAAMRESLGNEIPDTAPYTEWLALVSSIVVAVLVCAVLFSNGILT*
Ga0126378_1197668123300010361Tropical Forest SoilMRESLESQIPDTAPHIEWLAFVCAIMVAVLFCAVLKCRPN
Ga0126378_1345531113300010361Tropical Forest SoilRGGAMRESSGNEIPDTAPYTEWLAIVGSIVLAVLVCAVLFSNGILT*
Ga0126379_1069267813300010366Tropical Forest SoilEVGAAMRESVGNEIPDTAPYTEWLALVGSIVVAVLVCAVLFSDGIVT*
Ga0124850_1000623103300010863Tropical Forest SoilMAAKVEVGATMRESVGNEIPDTAPYTESLALVGSIIVAVLVC
Ga0150983_1120626923300011120Forest SoilEGGCDARIVGNEIPDTAPYTEWLAIVGSIIVAVLVCAVLFSNGILT*
Ga0120192_1012548823300012021TerrestrialVHHVVDDVGGVGMGGAMRDTLDKRIPDTAPYKEWLAIVGSIAVAVLIFVVLFSNGVVVT*
Ga0137365_10007351123300012201Vadose Zone SoilMRKSSGSEIPDTAPYVEWLAIVGSIVAAVLLCAVLFPNGVLT*
Ga0137363_1032585823300012202Vadose Zone SoilMRESLESQIPDTAAYTEWLAIVCSIVVAALFCAVLFSNGAL
Ga0137363_1069979313300012202Vadose Zone SoilMRESLGSEIPDTAPYTEWLAIVGSIVVAVLVCAVLFSNGILT*
Ga0137363_1163700623300012202Vadose Zone SoilEVADKVEGGGAMRGSSGNEIPDTAPYTEWLALVGSIVVAVLVCAVLFSNGILT*
Ga0137362_1089597623300012205Vadose Zone SoilMRESLGSEIPDTAPYMEWLAIVCSIVVAALFCVVLFSNGVLT*
Ga0137362_1163941113300012205Vadose Zone SoilTQEPVPMRKSSGSEIPDTAPYVEWLAIVGSIVAAVLLCAVLFPNGVLT*
Ga0137381_1126477513300012207Vadose Zone SoilMRQSLGNEIPDTAPYTEWLAIVASIVVAVVVCAVLFSNGIL
Ga0137379_1122958013300012209Vadose Zone SoilSLGSEIPDTAPYTEWLAIVCSIVVAILVCAALFSNGALT*
Ga0137377_1018616113300012211Vadose Zone SoilSLGNEIPDTTPYTEWLAIVGSIVVAVLVCAVLFSNGVLT*
Ga0137377_1079907713300012211Vadose Zone SoilMRKSLGSQIPDTAPYMEWLAIVCSIVVAGLFCAVLFSNVVLT
Ga0137360_1038954033300012361Vadose Zone SoilMRESLGNEIPDTAPYTEWLALVGSIVVAVLVCAVL
Ga0137361_1021641923300012362Vadose Zone SoilMRESLGSEIPDTAPYTEWLAIVCSIVVAILVCAALFSNGALT*
Ga0137361_1082551423300012362Vadose Zone SoilMRESLGNEIPDTTPYTEWLAIVGSIVVAVLVCAVLFSNG
Ga0137395_1049600113300012917Vadose Zone SoilRTGEVADKVEGGGAMRVSSGNEIPDTAPYTQWLAIVGSIRVAVLVCAVLFSNGILT*
Ga0137407_1077762923300012930Vadose Zone SoilGNEIPDTAAYTEWLALVGSIVVAVLVCAVLFSNGVLT*
Ga0126375_1013659533300012948Tropical Forest SoilMRESLESQIPDTAPHIEWLAFVCAIVVAVLFCAVLFSNGVLT*
Ga0164300_1008309213300012951SoilMRESLESQIADTAAYTEWLAIVCSIVVAALFCAVLFSNGALT*
Ga0164302_1097043013300012961SoilSLGNEIPDTAAYTEWLALVGSIVVAVLVCAVLFSNGVLT*
Ga0126369_1056890813300012971Tropical Forest SoilMRESLGNEIPDTAPYTEWLALVGSIVVAVLVCAVLFSNG
Ga0126369_1153397613300012971Tropical Forest SoilMLEWSGSQIPDMAPYIEWLAIVCSLNGGTVLFSHGVLT
Ga0126369_1222241013300012971Tropical Forest SoilMRASLGNEIPDTAPYTEWLAIVSSIVVAVLVCAVLFSNGIL
Ga0134085_1043572813300015359Grasslands SoilNEIPDTAPYTEWLALVGSIVVAVLVCAVLFSNGILT*
Ga0182036_1111130623300016270SoilGNEIPDTAPYTEWLAIVGSIVVAVLVCAVLFSNGILT
Ga0182041_1024588833300016294SoilGDGRLKVEVGAAMRESVGNEIPDTAPYTEWLALVGSIVVAVLVCAVLFSNGIVT
Ga0182041_1039397533300016294SoilRESSENEIPDTAPYTEWLAIVGSIVVAVLVCAVLFSNGILI
Ga0182041_1041845613300016294SoilRRGGAMRESLGNEIPDTAPYTEWLAIVGSIVVAAVVCAVLFSNGILT
Ga0182032_1108643613300016357SoilMRESVGNEIPDTAPYTEWLALVGSIVVAVLVCAVLF
Ga0182040_1153883823300016387SoilWTQDPVPMRESLGSQIPDTAPYTEWLAIVCSIVVAALFCAVLFSNGVLT
Ga0182039_1154084323300016422SoilGNEIPDTAPYMEWLAIVGSILVAVLVCAVLFSNGILT
Ga0134074_106182513300017657Grasslands SoilHREQQMRESLESQIPDTAAYTEWLAIVCSIVVAALFCAVLFSNGALT
Ga0184612_1007697043300018078Groundwater SedimentMRESLGSGIPDTEPYTEWLAIVGSIVLAVLVCAIL
Ga0066655_1011667123300018431Grasslands SoilMRESLESQIPDTTPYIEWLAIVCSIVVAALFCAVLFSNGALT
Ga0066667_1191723613300018433Grasslands SoilMRESLESQIPDTAAYTEWLAIVCSIVVAALFCAVLFSNGALT
Ga0210407_1072401913300020579SoilVGAAMRASLGNEIPDTAPYTEWLALVGSIVVAVLICAVLLSNGV
Ga0210387_1030422823300021405SoilMRESLESQIPHTTPYIEWLAMVGSIIVAVLFCAALFSNSILT
Ga0213878_1007512033300021444Bulk SoilHCAERKGGGAMRESLGNEVSDTAPYTEWLALVGSIVVAVLVCAVLFSNGMLT
Ga0207684_1014383933300025910Corn, Switchgrass And Miscanthus RhizosphereMRESLRSEIPDTAPFTEWLAIVCSIVMAALFCAAMFSKGVLT
Ga0207684_1071941323300025910Corn, Switchgrass And Miscanthus RhizosphereRWYKLIRMGGAMRESLGNEIPDTAPYTEWLAIVGSIVVAVLVCAVLFSNGVLT
Ga0207684_1120232813300025910Corn, Switchgrass And Miscanthus RhizosphereLKVEVGAAMRASLGNEIPDTAPYTEWLALVGSIVVAVLVCAVLLSNGILT
Ga0207646_1031617723300025922Corn, Switchgrass And Miscanthus RhizosphereMRESLGNEIPDTAAYTEWLALVGSIVVAVLVCAVLFSNGVLT
Ga0207665_1130571713300025939Corn, Switchgrass And Miscanthus RhizosphereVGAVMRESLGNEIPDTAPYTEWLALVGSIVVAVLVCAVLFSNGILT
Ga0209647_117687433300026319Grasslands SoilMRESLESQIPDTAAYTEWLAIVCSIVVAALFCAVLFS
Ga0209076_107371713300027643Vadose Zone SoilGHRPVPMRESLESQIPDTAAYTEWLAIVCSIVVAALFCAVLFSNGALT
Ga0307278_1004662523300028878SoilMRESSGSEIPDTAPYMEWLAFVCSIVVAALFCAVLFSNVVLT
Ga0307278_1006218233300028878SoilMRESLGSEIPDTAPYMEWLAIVCSIAVAALFCAVLFSNGVLT
Ga0170818_10175698013300031474Forest SoilGRLKVEVGAAMRASLGNEIPDTAPYTEWLALVGSIVVAVLVCAVLFSNGILT
Ga0318516_1000975633300031543SoilMRESLGNEIPDTAPYTEWLAIVGSIVVAAVVCAVLFSNGILT
Ga0318516_1002417153300031543SoilMRESLESQIPDTAPHIEWLAFVCAIVVAVLFCAVLFSNAS
Ga0318516_1080557513300031543SoilMRESSENEIPDTAPYTEWLAIVGSIVVAVLVCAVLFSNGILT
Ga0318534_1004155613300031544SoilMRKSSGSEIPDTAPYVEWLAIVGSIVVAVLLCAVLFSNGVLT
Ga0318534_1011384813300031544SoilGSAMRESSGNEIPDTAPYTEWLAIVGSIVVAALVCAVLFSNGILT
Ga0318534_1065384623300031544SoilMRESLGNEIPDTAPYTEWLALVGSIVVAVVVCAVLF
Ga0318541_1004382613300031545SoilMRELSGNEIPDTAPYMEWLAIVGSILVAVLVCAVLFSNGILT
Ga0318541_1019181413300031545SoilEIPDTAPYTEWLAIVGSIVVAVLVCAVLFSNGILI
Ga0318538_1001126413300031546SoilMRESLKSQIPDTAPHIEWLAFVCAIVVAVLFCAVLFSNAS
Ga0318538_1028411923300031546SoilMRESSENEIPDTAPYTEWLAIVGSIVVAVLVCAVLFSNGILI
Ga0318573_1001088773300031564SoilMRESLGNEIPDTAPYTEWLALVDSIVVAVLVCAVLFSNGILT
Ga0318573_1050011213300031564SoilAGQEMADLRSKGGAMRESLGNEIPDTAPYTEWLAIVGSIVVAVLVCAVLFSNGILT
Ga0310915_1031501033300031573SoilGGAMRESLGNELPDTAPYTEWLAIVGSIIVAVLVCAVLFSNGILT
Ga0318555_1006422113300031640SoilMRESLGNEIPDTAPYTEWLALVGSIVVAVLVCAVLFS
Ga0318555_1012246513300031640SoilMRKSSGSEIPDTAPYVEWLAIVGSIVVAVLLCAVLFSNGV
Ga0318555_1032657123300031640SoilMRESLGNEIPDTAPYPEWLAPVGSIVVAVLVCAVLFSNG
Ga0318555_1040551713300031640SoilMRESVGNEIPDTAPYTEWLALVGSIVVAVLVCAVLFSNGIVT
Ga0318542_1012913613300031668SoilMRESLGNEIPDTAPYTEWLAIVGSIVVAVLVCAVLFSN
Ga0318561_1042405213300031679SoilMRESSENEIPDTAPYTEWLAIVGSIVVAVLVCAVLF
Ga0318574_1009085613300031680SoilWQTQGRRGGAMRESLGNEIPDTEPYTEWLAIVGSIVVAVLVCAVLFSNGILT
Ga0318574_1032479413300031680SoilMRESLGNEIPDTAPYTEWLAIVGSIVVAVLVCAVLF
Ga0318572_1005086733300031681SoilMRESLGNEIPDTAPYTEWLAIVGSIVVAVLVCAVLFSNGILT
Ga0318572_1093139123300031681SoilCGSARAMRELSGNEIPDTAPYMEWLAIVGSILVAVLVCAVLFSNGILT
Ga0318560_1004162663300031682SoilGGAMRESLGNEIPDTAPYMEWLALVGSIVVAVVVCAVLFSNGILT
Ga0318496_1034496013300031713SoilMVDLRSKGGAMRESLGNEIPDTAPYTEWLAIVGSIVVAVLVCA
Ga0306917_1003229113300031719SoilMRESLGNEIPDTAPYTEWLAIVGSIIVAVLVCAVLFSNGILT
Ga0306917_1005815573300031719SoilRRKGGGAMRESLGNEIPDTAPYTEWLALVDSIVVAVLVCAVLFSNGILT
Ga0306917_1006784023300031719SoilMRESLGNEIPDTAPYTEWLAIVGSIVVAVVVCAVLFSNGILT
Ga0306917_1011360313300031719SoilRESSGNEIPDTAPYTEWLAIVGSIVVAVLVCAVLFSNGILT
Ga0306917_1022979313300031719SoilMRELSGNEIPDTAPYMEWLAIVGSILVAVLVCAVLFSNGI
Ga0306917_1155326223300031719SoilGGAAMRESVGNEIPDTAPYTEWLALVGSIVVAVLVCAVLFSNGIVT
Ga0318500_1032355413300031724SoilLKVIRGGGVMRESLGNEIPDTAPYTEWLAIVGSIIVAVLVCAVLFSNGILT
Ga0318500_1038272523300031724SoilEMADLRSKGGAMRESLGNEIPDTAPYTEWLAIVGSIVVAVLVCAVLFSNGILT
Ga0318500_1048332413300031724SoilMRESLGNEIPDTAPYTEWLAIVGSIVVAVLVCAVLFSNGIL
Ga0306918_1008344013300031744SoilMVDLRSKGGAMRESLGNEIPDTAPYTEWLAIVGSIVVAVLVCAV
Ga0306918_1027931443300031744SoilRESVGNEIPDTAPYTEWLAIVGSIVVAVLVCAVLFSNGILT
Ga0306918_1087448613300031744SoilESLGNEIPDTAPYTEWLALVGSIVVAVLVCAVLFSNGIVT
Ga0306918_1104248123300031744SoilSSENEIPDTAPYTEWLAIVGSIVVAVLVCAVLFSNGILT
Ga0318502_1080126223300031747SoilNEIPDTAPYTEWLALVGSIVVAVLVCAVLFSNGIVT
Ga0318492_1003519013300031748SoilMHEWLGSQIPDTAPYIEWLAIVCSVMAVLFCTVLF
Ga0318494_1016367133300031751SoilMRKSSGSEIPDTAPYVEWLAIVGSIVVAVLLCAVLFSNGVL
Ga0318537_1023873723300031763SoilRESLGNEIPDTAPYTEWLAIVGSIVVAVLVCAVLFSNGILT
Ga0318554_1080149123300031765SoilRKGGGAMRESLGNEIPDTAPYTEWLALVDSIVVAVLVCAVLFSNGILT
Ga0318543_1002752513300031777SoilMRESLGNEIPDTAPYTEWLALVGSIVVAALVCAVLFSNGILT
Ga0318543_1025595423300031777SoilMADLRSKGGAMRESLGNEIPDTAPYTEWLAIVGSIVVAVLVCA
Ga0318498_1014310913300031778SoilLRSKGGAMRESLGNEIPDTAPYTEWLAIVGSIVVAVLVCAVLFSNGILT
Ga0318566_1006596813300031779SoilMRESLGNEIPDTAPYMEWLALVGSIVVAVVVCAVLFSNGILT
Ga0318508_119262813300031780SoilRLKVIRGGGVMRESLGNEIPDTAPYTEWLAIVGSIIVAVLVCAVLFSNGILT
Ga0318547_1019007933300031781SoilMRESLGNEIPDTAPYTEWLAIVGSIIVAVVVCAVLFSNGILT
Ga0318552_1005516863300031782SoilLGNEIPDTAPYTEWLALVGSIVVAVVVCAVLFSNGILT
Ga0318552_1020420923300031782SoilMHNWLGSQIPDTAPYIEWLAIVCSVMAVLFCTVLFSLGVLT
Ga0318548_1051644213300031793SoilMRESLGNEIPDTAPYTEWLAIVGSIIVAVLVCAVLFSNGI
Ga0318567_1008650443300031821SoilMVDLRSKGGAMRESLGNEIPDTAPYTEWLAIVGSIVVAVLVCAVLFSNGILT
Ga0310917_1003481543300031833SoilMRESLGNEIPDTAPYTEWLALVGSIVAAVLVCAVLFSNGILT
Ga0318517_1012598633300031835SoilRESSGNEIPDTAPYTEWLAIVGSIVVAALVCAVLFSNGILT
Ga0318527_1018230313300031859SoilMRESLGNEIPDTAPYTEWLALVGSIVVAVVVCAVL
Ga0306919_1005083973300031879SoilEIPDTAPYTEWLALVGSIVVAVLVCAVLFSNGILT
Ga0306919_1065817913300031879SoilLSGNEIPDTAPYMEWLAIVGSILVAVLVCAVLFSNGILT
Ga0306919_1091420823300031879SoilESSENEIPDTAPYTEWLAIVGSIVVAVLVCAVLFSNGILT
Ga0306925_1147394113300031890SoilRLKVEVGAAMRESVGNEIPDTAPYTEWLALVGSIVVAVLVCAVLFSNGIVT
Ga0318551_1085296723300031896SoilNEIPDTAPYTEWLALVGSIVVAVLVCAVLFSNGILT
Ga0318520_1086186733300031897SoilMRESLGNEIPDTAPYTEWLALVGSIAVLVCAVLFSDGILT
Ga0306923_1009939213300031910SoilAMRESSENEIPDTAPYTEWLAIVGSIVVAVLVCAVLFSNGILT
Ga0306923_1012174633300031910SoilMADLRSKGGAMRESLGNEIPDTAPYTEWLAIVGSIVVAVLVCAVLFSNGILT
Ga0306923_1045234153300031910SoilMRESSENEIPDTAPYTEWLAIVGSIVVAVLVCAVLFSNGIL
Ga0306923_1066445813300031910SoilAMRESSENEIPDTAPYTEWLAIVGSIVVAVLVCAVLFSNGILI
Ga0306921_1009379913300031912SoilMRESLGNEIPDTAPYTEWLALVGSIVVAVLVCAVLFSNGILT
Ga0306921_1232364323300031912SoilMRESLGNEIPDTAPYTEWLALVGSIVVAVVVCAVLFSNGILT
Ga0310912_1003815453300031941SoilMRESSGNEIPDTAPYTEWLAIVGSIVVAVLVCAVLFSNGILT
Ga0310912_1006932113300031941SoilMHEWLGSQIPDTAPYIEWLAIVCSVMAVLFCTVLFSHGVLT
Ga0310916_1005942443300031942SoilMRESSGNEIPDTAPYTEWLAIVGSILVAVLVCAVLFSNGILT
Ga0310913_1008879943300031945SoilMRESLGNEIPDTAPYTEWLALVGSIVVAVLVCAALFSNGILT
Ga0310913_1017343643300031945SoilMADLRSKGGAMRESLGNEIPDTAPYTEWLAIVGSIVVAVL
Ga0310913_1026937613300031945SoilSSENEIPDTAPYTEWLAIVGSIVVAVLVCAVLFSNGILI
Ga0310910_1016746923300031946SoilMRESLGNELPDTAPYTEWLAIVGSIIVAVLVCAVLFSNGILT
Ga0306926_1002607583300031954SoilMRESLGNEIPDTEPYTEWLAIVGSIVVAVLVCAVLFSNGILT
Ga0306926_1064891113300031954SoilVPMRKSSGSEIPDTAPYVEWLAIVGSIVVAVLLCAVLFSNGVLT
Ga0306926_1175380813300031954SoilMRESLGNEIPDTAPYTEWLAIVGSIVVAVVVCAVL
Ga0306926_1225563323300031954SoilAMRESLGNEIPDTAPYTEWLAIVGSIVVAVLVCAVLFSNGILT
Ga0318530_1009754623300031959SoilMRESVGNEIPDTAPYTEWLALVGSIVVAVLVCAVLFSNGI
Ga0306922_1019888433300032001SoilMRESLGNEIPDTAPYTEWLAIVGSIVVALLVCAVLFSTAS
Ga0318569_1036870223300032010SoilMRESLGNEIPDTAPYTERLALVGSIVVAVLVCAVLF
Ga0318556_1014464123300032043SoilMHEWLGSQIPDTAPYIEWLAIVCSVRAVLFCTVLFSH
Ga0318553_1020043333300032068SoilEIPDTAPYTEWLAIVGSIVVAAVVCAVLFSNGILT
Ga0306924_1008962943300032076SoilVGAAMREPLGNEIPDTAPYTEWLTIVESIVVAVLVCAVLFSNGILT
Ga0306924_1015784313300032076SoilMRESSGNEIPDTAPYTEWLAIVGSIVVAALVCAVLFSNGILT
Ga0306924_1040874153300032076SoilMADLRSKGGAMRESLGNEIPDTAPYTEWLAIVGSIVVAVLVCAV
Ga0306924_1067124513300032076SoilMRESLGNEIPDTAPYTEWLAIVGSIVVAAVICAVLFSNGIL
Ga0318577_1023506123300032091SoilGQEMADLRSKGGAMRESLGNEIPDTAPYTEWLAIVGSIVVAVLVCAVLFSNGILT
Ga0318577_1040970813300032091SoilMRESVGNEIPDTAPYTEWLALVGSIVVAVLVCAVLFSN
Ga0306920_10030176613300032261SoilGNDIPDTAPYTEWLALVGSIVVAVLVCAVLFSNGILT
Ga0306920_10134127313300032261SoilDLRSKGGAMRESLGNEIPDTAPYTEWLAIVGSIVVAVLVCAVLFSNGILT
Ga0306920_10135046133300032261SoilARRGGAMRESLGNEIPDTAPYTEWLAIVGSIVVAVVVCAVLFSNGILT
Ga0306920_10369733113300032261SoilGNEIPDTAPYTEWLAIVGSIAVAVLVCAVLFSNGILT
Ga0318519_1094968623300033290SoilGNEIPDTAPYTEWLALVGSIVVAVLVCAALFSNGILT


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.