NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F018559

Metagenome / Metatranscriptome Family F018559

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F018559
Family Type Metagenome / Metatranscriptome
Number of Sequences 234
Average Sequence Length 40 residues
Representative Sequence FYTTGMEHSPTSATGTGWERTPWHATQRAAWEALKKAEPSG
Number of Associated Samples 156
Number of Associated Scaffolds 234

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 12.75 %
% of genes near scaffold ends (potentially truncated) 46.58 %
% of genes from short scaffolds (< 2000 bps) 52.99 %
Associated GOLD sequencing projects 140
AlphaFold2 3D model prediction Yes
3D model pTM-score0.36

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (59.402 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil
(17.094 % of family members)
Environment Ontology (ENVO) Unclassified
(22.222 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(42.308 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 21.74%    β-sheet: 0.00%    Coil/Unstructured: 78.26%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.36
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 234 Family Scaffolds
PF04392ABC_sub_bind 5.56
PF00072Response_reg 2.99
PF07883Cupin_2 1.71
PF13924Lipocalin_5 1.71
PF00583Acetyltransf_1 1.28
PF00005ABC_tran 1.28
PF00106adh_short 0.85
PF00496SBP_bac_5 0.85
PF07681DoxX 0.85
PF03480DctP 0.85
PF03060NMO 0.85
PF00041fn3 0.85
PF00211Guanylate_cyc 0.85
PF00754F5_F8_type_C 0.85
PF04909Amidohydro_2 0.85
PF07589PEP-CTERM 0.85
PF13649Methyltransf_25 0.85
PF01068DNA_ligase_A_M 0.85
PF00561Abhydrolase_1 0.85
PF01925TauE 0.43
PF07603DUF1566 0.43
PF17164DUF5122 0.43
PF11752DUF3309 0.43
PF10415FumaraseC_C 0.43
PF14350Beta_protein 0.43
PF13592HTH_33 0.43
PF00772DnaB 0.43
PF12680SnoaL_2 0.43
PF02374ArsA_ATPase 0.43
PF00903Glyoxalase 0.43
PF10115HlyU 0.43
PF13472Lipase_GDSL_2 0.43
PF13602ADH_zinc_N_2 0.43
PF00892EamA 0.43
PF14659Phage_int_SAM_3 0.43
PF01575MaoC_dehydratas 0.43
PF07992Pyr_redox_2 0.43
PF00486Trans_reg_C 0.43
PF04226Transgly_assoc 0.43
PF13701DDE_Tnp_1_4 0.43
PF01494FAD_binding_3 0.43
PF02698DUF218 0.43
PF03886ABC_trans_aux 0.43
PF00848Ring_hydroxyl_A 0.43
PF13551HTH_29 0.43
PF01695IstB_IS21 0.43
PF01551Peptidase_M23 0.43
PF02824TGS 0.43
PF02417Chromate_transp 0.43
PF13751DDE_Tnp_1_6 0.43
PF00037Fer4 0.43
PF12681Glyoxalase_2 0.43
PF16861Carbam_trans_C 0.43
PF01699Na_Ca_ex 0.43
PF13531SBP_bac_11 0.43
PF07690MFS_1 0.43
PF03400DDE_Tnp_IS1 0.43
PF01244Peptidase_M19 0.43
PF03088Str_synth 0.43
PF03928HbpS-like 0.43
PF00326Peptidase_S9 0.43
PF05494MlaC 0.43
PF13282DUF4070 0.43

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 234 Family Scaffolds
COG2984ABC-type uncharacterized transport system, periplasmic componentGeneral function prediction only [R] 5.56
COG0516IMP dehydrogenase/GMP reductaseNucleotide transport and metabolism [F] 0.85
COG06542-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductasesEnergy production and conversion [C] 0.85
COG1423ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) familyReplication, recombination and repair [L] 0.85
COG1793ATP-dependent DNA ligaseReplication, recombination and repair [L] 0.85
COG2070NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase familyGeneral function prediction only [R] 0.85
COG2114Adenylate cyclase, class 3Signal transduction mechanisms [T] 0.85
COG2259Uncharacterized membrane protein YphA, DoxX/SURF4 familyFunction unknown [S] 0.85
COG4270Uncharacterized membrane proteinFunction unknown [S] 0.85
COG4638Phenylpropionate dioxygenase or related ring-hydroxylating dioxygenase, large terminal subunitInorganic ion transport and metabolism [P] 0.85
COG0305Replicative DNA helicaseReplication, recombination and repair [L] 0.43
COG0387Cation (Ca2+/Na+/K+)/H+ antiporter ChaAInorganic ion transport and metabolism [P] 0.43
COG0530Ca2+/Na+ antiporterInorganic ion transport and metabolism [P] 0.43
COG0578Glycerol-3-phosphate dehydrogenaseEnergy production and conversion [C] 0.43
COG0644Dehydrogenase (flavoprotein)Energy production and conversion [C] 0.43
COG0665Glycine/D-amino acid oxidase (deaminating)Amino acid transport and metabolism [E] 0.43
COG0730Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 familyInorganic ion transport and metabolism [P] 0.43
COG1434Lipid carrier protein ElyC involved in cell wall biogenesis, DUF218 familyCell wall/membrane/envelope biogenesis [M] 0.43
COG1484DNA replication protein DnaCReplication, recombination and repair [L] 0.43
COG1662Transposase and inactivated derivatives, IS1 familyMobilome: prophages, transposons [X] 0.43
COG2059Chromate transport protein ChrAInorganic ion transport and metabolism [P] 0.43
COG2261Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein familyGeneral function prediction only [R] 0.43
COG2355Zn-dependent dipeptidase, microsomal dipeptidase homologPosttranslational modification, protein turnover, chaperones [O] 0.43
COG2854Periplasmic subunit MlaC of the ABC-type intermembrane phospholipid transporter MlaCell wall/membrane/envelope biogenesis [M] 0.43
COG2949Uncharacterized periplasmic protein SanA, affects membrane permeability for vancomycinCell wall/membrane/envelope biogenesis [M] 0.43
COG3386Sugar lactone lactonase YvrECarbohydrate transport and metabolism [G] 0.43


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms59.83 %
UnclassifiedrootN/A40.17 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2228664022|INPgaii200_c0913505All Organisms → cellular organisms → Bacteria688Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_100780334All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1120Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_105731267All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1365Open in IMG/M
3300000443|F12B_11447871All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium846Open in IMG/M
3300000559|F14TC_101030464All Organisms → cellular organisms → Bacteria1577Open in IMG/M
3300000955|JGI1027J12803_105432850All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces1148Open in IMG/M
3300000956|JGI10216J12902_112882057All Organisms → cellular organisms → Bacteria668Open in IMG/M
3300001431|F14TB_100585160All Organisms → cellular organisms → Bacteria759Open in IMG/M
3300002912|JGI25386J43895_10045691All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1270Open in IMG/M
3300004281|Ga0066397_10112909All Organisms → cellular organisms → Bacteria584Open in IMG/M
3300004479|Ga0062595_102025770All Organisms → cellular organisms → Bacteria → Proteobacteria557Open in IMG/M
3300004633|Ga0066395_10016602All Organisms → cellular organisms → Bacteria2848Open in IMG/M
3300004633|Ga0066395_10336420All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium835Open in IMG/M
3300005174|Ga0066680_10041258All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium2670Open in IMG/M
3300005174|Ga0066680_10636375All Organisms → cellular organisms → Bacteria663Open in IMG/M
3300005179|Ga0066684_10196782All Organisms → cellular organisms → Bacteria1302Open in IMG/M
3300005180|Ga0066685_11061744All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300005332|Ga0066388_100659961All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1659Open in IMG/M
3300005332|Ga0066388_101008841All Organisms → cellular organisms → Bacteria1395Open in IMG/M
3300005332|Ga0066388_103799837All Organisms → cellular organisms → Bacteria770Open in IMG/M
3300005445|Ga0070708_100172403All Organisms → cellular organisms → Bacteria2020Open in IMG/M
3300005467|Ga0070706_100521446All Organisms → cellular organisms → Bacteria → Terrabacteria group → unclassified Terrabacteria group → Terrabacteria group bacterium ANGP11105Open in IMG/M
3300005467|Ga0070706_101343547Not Available655Open in IMG/M
3300005468|Ga0070707_100346242All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1444Open in IMG/M
3300005471|Ga0070698_100117626All Organisms → cellular organisms → Bacteria → Proteobacteria2620Open in IMG/M
3300005549|Ga0070704_101406449All Organisms → cellular organisms → Bacteria640Open in IMG/M
3300005552|Ga0066701_10041711All Organisms → cellular organisms → Bacteria → Proteobacteria2467Open in IMG/M
3300005552|Ga0066701_10195813All Organisms → cellular organisms → Bacteria1237Open in IMG/M
3300005557|Ga0066704_10198450Not Available1356Open in IMG/M
3300005558|Ga0066698_11110031All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300005598|Ga0066706_11478206Not Available512Open in IMG/M
3300005713|Ga0066905_101043507All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium723Open in IMG/M
3300005713|Ga0066905_102322862All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium502Open in IMG/M
3300005764|Ga0066903_100021424All Organisms → cellular organisms → Bacteria6910Open in IMG/M
3300006034|Ga0066656_10233518All Organisms → cellular organisms → Bacteria1179Open in IMG/M
3300006058|Ga0075432_10224659All Organisms → cellular organisms → Bacteria752Open in IMG/M
3300006196|Ga0075422_10612425All Organisms → cellular organisms → Bacteria505Open in IMG/M
3300006796|Ga0066665_10154917All Organisms → cellular organisms → Bacteria1742Open in IMG/M
3300006844|Ga0075428_100141901All Organisms → cellular organisms → Bacteria2611Open in IMG/M
3300006852|Ga0075433_10022296All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria5315Open in IMG/M
3300006852|Ga0075433_10265499All Organisms → cellular organisms → Bacteria1521Open in IMG/M
3300006852|Ga0075433_10474912Not Available1102Open in IMG/M
3300006852|Ga0075433_10991111All Organisms → cellular organisms → Bacteria732Open in IMG/M
3300006853|Ga0075420_101050265All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium701Open in IMG/M
3300006854|Ga0075425_100004474All Organisms → cellular organisms → Bacteria14429Open in IMG/M
3300006854|Ga0075425_101343584All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium810Open in IMG/M
3300006871|Ga0075434_100723035All Organisms → Viruses → Predicted Viral1013Open in IMG/M
3300006876|Ga0079217_10711253Not Available678Open in IMG/M
3300007076|Ga0075435_100064534All Organisms → cellular organisms → Bacteria → Proteobacteria2976Open in IMG/M
3300007076|Ga0075435_101156640All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium677Open in IMG/M
3300007265|Ga0099794_10423987All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium696Open in IMG/M
3300009012|Ga0066710_100317202All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium2291Open in IMG/M
3300009038|Ga0099829_10117199All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium2092Open in IMG/M
3300009089|Ga0099828_10838923All Organisms → cellular organisms → Bacteria822Open in IMG/M
3300009100|Ga0075418_10160461All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium2393Open in IMG/M
3300009100|Ga0075418_10346275All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1586Open in IMG/M
3300009100|Ga0075418_11223112All Organisms → cellular organisms → Bacteria814Open in IMG/M
3300009147|Ga0114129_10322829All Organisms → cellular organisms → Bacteria2052Open in IMG/M
3300009147|Ga0114129_10371437All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1890Open in IMG/M
3300009147|Ga0114129_10411932Not Available1779Open in IMG/M
3300009147|Ga0114129_13146761All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium538Open in IMG/M
3300009162|Ga0075423_11336675All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium766Open in IMG/M
3300010046|Ga0126384_10139663All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1851Open in IMG/M
3300010046|Ga0126384_12087056All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium544Open in IMG/M
3300010047|Ga0126382_11863989All Organisms → cellular organisms → Bacteria568Open in IMG/M
3300010320|Ga0134109_10111494All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium960Open in IMG/M
3300010336|Ga0134071_10547939All Organisms → cellular organisms → Bacteria601Open in IMG/M
3300010359|Ga0126376_10019595All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales4402Open in IMG/M
3300010359|Ga0126376_10319308All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1360Open in IMG/M
3300010359|Ga0126376_10352545All Organisms → cellular organisms → Bacteria1305Open in IMG/M
3300010359|Ga0126376_10939339All Organisms → cellular organisms → Bacteria859Open in IMG/M
3300010360|Ga0126372_11569280All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium696Open in IMG/M
3300010362|Ga0126377_10351464All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1471Open in IMG/M
3300010362|Ga0126377_10514343All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1231Open in IMG/M
3300010362|Ga0126377_11970594All Organisms → cellular organisms → Bacteria660Open in IMG/M
3300010362|Ga0126377_13200095All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium529Open in IMG/M
3300010362|Ga0126377_13329678All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium519Open in IMG/M
3300010376|Ga0126381_101062829All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1169Open in IMG/M
3300010398|Ga0126383_11650121All Organisms → cellular organisms → Bacteria730Open in IMG/M
3300012204|Ga0137374_10335674All Organisms → cellular organisms → Bacteria1225Open in IMG/M
3300012204|Ga0137374_11000742All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium604Open in IMG/M
3300012205|Ga0137362_10303257All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1383Open in IMG/M
3300012208|Ga0137376_11664082All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300012211|Ga0137377_11488130All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium603Open in IMG/M
3300012359|Ga0137385_11546417All Organisms → cellular organisms → Bacteria527Open in IMG/M
3300012582|Ga0137358_10670953All Organisms → cellular organisms → Bacteria694Open in IMG/M
3300012685|Ga0137397_11138465All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp.566Open in IMG/M
3300012948|Ga0126375_11690006All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300012972|Ga0134077_10085245All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1207Open in IMG/M
3300012976|Ga0134076_10057265All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1481Open in IMG/M
3300013306|Ga0163162_11618289All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria739Open in IMG/M
3300014326|Ga0157380_12817509All Organisms → cellular organisms → Bacteria553Open in IMG/M
3300015053|Ga0137405_1366488All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1787Open in IMG/M
3300015245|Ga0137409_10207682All Organisms → cellular organisms → Bacteria1760Open in IMG/M
3300015264|Ga0137403_10874608All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium750Open in IMG/M
3300015373|Ga0132257_100432565All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria1604Open in IMG/M
3300015373|Ga0132257_103961187All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300015374|Ga0132255_100125972All Organisms → cellular organisms → Bacteria3531Open in IMG/M
3300017997|Ga0184610_1225859All Organisms → cellular organisms → Bacteria625Open in IMG/M
3300018053|Ga0184626_10024840All Organisms → cellular organisms → Bacteria2451Open in IMG/M
3300018063|Ga0184637_10195171All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1242Open in IMG/M
3300018431|Ga0066655_10995718All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_40CM_4_65_12579Open in IMG/M
3300021560|Ga0126371_12215264All Organisms → cellular organisms → Bacteria663Open in IMG/M
3300025910|Ga0207684_10044358All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium3770Open in IMG/M
3300025910|Ga0207684_11008712All Organisms → cellular organisms → Bacteria696Open in IMG/M
3300025923|Ga0207681_11459780All Organisms → cellular organisms → Bacteria574Open in IMG/M
3300025938|Ga0207704_11739921All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300026309|Ga0209055_1145433All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4833Open in IMG/M
3300026313|Ga0209761_1035460All Organisms → cellular organisms → Bacteria → Proteobacteria2942Open in IMG/M
3300026331|Ga0209267_1063691All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1628Open in IMG/M
3300026332|Ga0209803_1014760All Organisms → cellular organisms → Bacteria3998Open in IMG/M
3300026332|Ga0209803_1243221All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium624Open in IMG/M
3300026342|Ga0209057_1224652All Organisms → cellular organisms → Bacteria533Open in IMG/M
3300026529|Ga0209806_1030341All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium2690Open in IMG/M
3300026538|Ga0209056_10390423All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria869Open in IMG/M
3300026552|Ga0209577_10581419All Organisms → cellular organisms → Bacteria688Open in IMG/M
3300027384|Ga0209854_1101826All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300027646|Ga0209466_1022335All Organisms → cellular organisms → Bacteria1313Open in IMG/M
3300027748|Ga0209689_1017119All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria4583Open in IMG/M
3300027874|Ga0209465_10072074All Organisms → cellular organisms → Bacteria1675Open in IMG/M
3300027874|Ga0209465_10384867All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium702Open in IMG/M
3300027907|Ga0207428_10934937All Organisms → cellular organisms → Bacteria611Open in IMG/M
3300027907|Ga0207428_11206886All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium526Open in IMG/M
3300027957|Ga0209857_1059255Not Available665Open in IMG/M
3300028819|Ga0307296_10534913All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium641Open in IMG/M
3300031226|Ga0307497_10329916All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria709Open in IMG/M
3300031561|Ga0318528_10202760All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1061Open in IMG/M
3300031713|Ga0318496_10265474All Organisms → cellular organisms → Bacteria947Open in IMG/M
3300031720|Ga0307469_10640444All Organisms → cellular organisms → Bacteria956Open in IMG/M
3300031720|Ga0307469_11387884All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium670Open in IMG/M
3300031723|Ga0318493_10872677All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300031740|Ga0307468_100243923All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1257Open in IMG/M
3300031740|Ga0307468_100288386All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1183Open in IMG/M
3300031770|Ga0318521_10558091All Organisms → cellular organisms → Bacteria691Open in IMG/M
3300031792|Ga0318529_10147037All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1083Open in IMG/M
3300031805|Ga0318497_10503701Not Available678Open in IMG/M
3300031820|Ga0307473_10122562All Organisms → cellular organisms → Bacteria1429Open in IMG/M
3300031820|Ga0307473_10779139All Organisms → cellular organisms → Bacteria680Open in IMG/M
3300031820|Ga0307473_11076124All Organisms → cellular organisms → Bacteria591Open in IMG/M
3300031832|Ga0318499_10023493All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium2169Open in IMG/M
3300031845|Ga0318511_10551127All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium535Open in IMG/M
3300031897|Ga0318520_10022476All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium3033Open in IMG/M
3300031941|Ga0310912_10780939All Organisms → cellular organisms → Bacteria738Open in IMG/M
3300032013|Ga0310906_10008532All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiorhodovibrio → unclassified Thiorhodovibrio → Thiorhodovibrio sp. 9703784Open in IMG/M
3300032052|Ga0318506_10426613All Organisms → cellular organisms → Bacteria588Open in IMG/M
3300032180|Ga0307471_101224596All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium914Open in IMG/M
3300032205|Ga0307472_100167419All Organisms → cellular organisms → Bacteria1629Open in IMG/M
3300033289|Ga0310914_10411059All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1225Open in IMG/M
3300033811|Ga0364924_022762Not Available1246Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil17.09%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil16.24%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere12.82%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil9.40%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil6.84%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil6.41%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil5.98%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.27%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil3.85%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment3.42%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil2.56%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.71%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand1.71%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.71%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.85%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.85%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.43%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.43%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.43%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.43%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.43%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.43%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.43%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.43%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.43%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.43%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2228664022Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000443Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.2B clc assemlyEnvironmentalOpen in IMG/M
3300000559Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemlyEnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001431Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemlyEnvironmentalOpen in IMG/M
3300002912Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cmEnvironmentalOpen in IMG/M
3300004281Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBioEnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004633Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBioEnvironmentalOpen in IMG/M
3300005174Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129EnvironmentalOpen in IMG/M
3300005179Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133EnvironmentalOpen in IMG/M
3300005180Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150EnvironmentalOpen in IMG/M
3300005554Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110EnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005557Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153EnvironmentalOpen in IMG/M
3300005558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147EnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006058Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1Host-AssociatedOpen in IMG/M
3300006196Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1Host-AssociatedOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006876Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200EnvironmentalOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300007265Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009818Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015EnvironmentalOpen in IMG/M
3300010336Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012355Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012972Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300012976Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300015053Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015054Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015245Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017659Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300017997Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coexEnvironmentalOpen in IMG/M
3300018052Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2EnvironmentalOpen in IMG/M
3300018053Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1EnvironmentalOpen in IMG/M
3300018063Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2EnvironmentalOpen in IMG/M
3300018076Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coexEnvironmentalOpen in IMG/M
3300018078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coexEnvironmentalOpen in IMG/M
3300018084Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1EnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300019259Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026296Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026297Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026309Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes)EnvironmentalOpen in IMG/M
3300026313Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026324Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes)EnvironmentalOpen in IMG/M
3300026331Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes)EnvironmentalOpen in IMG/M
3300026332Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes)EnvironmentalOpen in IMG/M
3300026342Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes)EnvironmentalOpen in IMG/M
3300026524Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes)EnvironmentalOpen in IMG/M
3300026529Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes)EnvironmentalOpen in IMG/M
3300026538Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)EnvironmentalOpen in IMG/M
3300026547Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes)EnvironmentalOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300027384Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_30_40 (SPAdes)EnvironmentalOpen in IMG/M
3300027646Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027671Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes)EnvironmentalOpen in IMG/M
3300027748Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes)EnvironmentalOpen in IMG/M
3300027862Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027874Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027957Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_10_20 (SPAdes)EnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300031226Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_SEnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031792Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031832Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25EnvironmentalOpen in IMG/M
3300031835Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21EnvironmentalOpen in IMG/M
3300031845Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300032042Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26EnvironmentalOpen in IMG/M
3300032052Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033811Sediment microbial communities from East River floodplain, Colorado, United States - 28_j17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
INPgaii200_091350532228664022SoilYTSGMEHSPTSATGTAWERTPWHAVRNAAWDALKRD
INPhiseqgaiiFebDRAFT_10078033413300000364SoilYTTGMEHSPTSAMGTGWERTPWRAVQGAARDALKAG*
INPhiseqgaiiFebDRAFT_10573126733300000364SoilFYTTGMEHSPTSATGTAWERTPWHATQKAAWDALKRAHTS*
F12B_1144787113300000443SoilFYTTGMEHSPTSATGSAWERTPWHAVQGAAREALNNDKTTA*
F14TC_10041937123300000559SoilTSGMEHSPTSATGTAWERTPWLATQRAAWEVLRK*
F14TC_10103046413300000559SoilTGMEHSPTSATGTGWQRTPWHATQRAAWETLRHADVSD*
JGI1027J12803_10543285033300000955SoilTFYTTGMEHSPTSATGTGWERTPRHATQRAAWESLRQQLFGA*
JGI10216J12902_11288205713300000956SoilTFYTTGMEHSPTSATGTGWEPTPWHATQRAAWEVLKKGSTA*
F14TB_10058516013300001431SoilTTGMEHSPTSATGTAWEPTPWQAVQGAARDALKRALIGPL*
JGI25386J43895_1004569113300002912Grasslands SoilYTSGMEHSPTSAMGTAWELTPXHAVQRAACEALKRSXIGG*
Ga0066397_1011290913300004281Tropical Forest SoilTFYTTGMEHSPTSATGTAWEPTPWRATQRAAWEALSRKKS*
Ga0062595_10202577013300004479SoilATFYTTGMEHSPTSVTGTGWEPTPWHATQQAAWEALRKSKED*
Ga0066395_1001660233300004633Tropical Forest SoilMFYTTGMEHSPMSATGTEWERTSWRATQRAAWEALKRMLEKC*
Ga0066395_1033642023300004633Tropical Forest SoilMFYTTGMEHSRTSATGTARERTPWDATQRAAWEALERADRQ*
Ga0066680_1004125813300005174SoilLARDFYTTGMEHSPTSATGTGWERSAWHATQRAAWEALKKASG*
Ga0066680_1063637523300005174SoilRATFYTTGMEHSPTSATGTGWERTPWHATQRAAWEALRKVKAAR*
Ga0066684_1019678223300005179SoilMSGMEHSLTRATGTAWERTPWRAVQGAAREALKQAGRDG*
Ga0066685_1106174423300005180SoilTFYTTGMEHSPTSATGTAWERTPWHATQRAAWEALRNAEATR*
Ga0066388_10065996133300005332Tropical Forest SoilTFYTTGMEHSPTSATGIAWEPTAWHATQRAAWGALNKPNDDHK*
Ga0066388_10100884113300005332Tropical Forest SoilASRATFYTTGMEHSPTSTTGTAWERTPWHAVQRAAWGVLEKADGGS*
Ga0066388_10379983733300005332Tropical Forest SoilATFYTTGMEHSPTSATGTGWEPTPWHTTQRAAWEALKRTECRDL*
Ga0070708_10017240323300005445Corn, Switchgrass And Miscanthus RhizosphereMEHLPTSATGTGWERTPWHAAQSAPARLARSHGGGRNVELADAV
Ga0070706_10052144633300005467Corn, Switchgrass And Miscanthus RhizosphereMFYTTAIEHSPTSATGTGWERTPWHATQRAAWEALKKADTSG*
Ga0070706_10134354713300005467Corn, Switchgrass And Miscanthus RhizosphereATFYATGMEHSPTSATGSAWERTSWHATQRAAWEARKRMETV*
Ga0070707_10034624213300005468Corn, Switchgrass And Miscanthus RhizosphereMFYTTGVEHSPTSATGTGWERAPWHATQRAAWEALRQVSAVGQG
Ga0070698_10011762623300005471Corn, Switchgrass And Miscanthus RhizosphereMTGMEHSPTSATGTGWERTPWHAVQRAAWEALRKHLDETV*
Ga0070704_10140644913300005549Corn, Switchgrass And Miscanthus RhizosphereRCHRAGTEMEHSPTSATGTAWERTPWHSTQRAAWAVLKKADT*
Ga0066701_1003243813300005552SoilMEHSPTSATGTGWERTPWHATQRAAWEALRQANRDG*
Ga0066701_1004171113300005552SoilFYTTGMEHSITSATGTGWERTPWRAVQGAAREALKKQEPTR*
Ga0066701_1007009243300005552SoilMEHSPTSATGTGWERTPWHATQRAAWEALKKGEESKG*
Ga0066701_1019581343300005552SoilATFYTSGMEHSPTSATGSAWERTPWHAVQGAAGDALRRASRDG*
Ga0066661_1000169733300005554SoilMEHSPATGTGWERTPWHATQRAAWEALPKTEEGDR*
Ga0066661_1017703933300005554SoilMEHSPTGATGTGWERTPWHATQRAAWEALKKAESGS*
Ga0066707_1077375423300005556SoilMEHSPMSATGTGWERTPWHATQRAAWEALKKGEESKG*
Ga0066704_1008168323300005557SoilMEHSPTSATGTGWERTPSHATQRAAWEALKQAEMS*
Ga0066704_1019845013300005557SoilFYTTGVEHSPTSATGTAWERTPWHAVRRAAWEALKKVEPSG*
Ga0066698_1111003123300005558SoilATFYTTGMEHSPTSATGAGWERTRWHATQRAAAWEALERAGETD*
Ga0066699_1104522133300005561SoilHSLTSATGTAWERTPWRAVQGAAREAFTHMEATR*
Ga0066706_1147820613300005598SoilYTSGMEHSPTSATGTGWERTPWHATQRAAWEALKKAGAGG*
Ga0066905_10011148823300005713Tropical Forest SoilMEHLPTSATGTAWEQTPWHATQRAAWEALKRTEEIACYHPK*
Ga0066905_10104350723300005713Tropical Forest SoilYTTGMEHSPTRATGSGRDRTPWRATQKAVWEVLRR*
Ga0066905_10232286213300005713Tropical Forest SoilVTRSRKRATFYTTGMEPSAVSATGTAWERTPWHATQRAAWKAL
Ga0066903_10002142453300005764Tropical Forest SoilMFYTSWMEHSPTSATGTAWERTPWRAAQRAAWEASRNHEKVTQ*
Ga0066903_10191311323300005764Tropical Forest SoilMEHSPTSATGTAWEPTPWRATQRAAWEALDRESRS*
Ga0066696_1080411333300006032SoilHSLTSATGTAWEPTPWRAVQGAAREAFTHMEATR*
Ga0066656_1023351853300006034SoilFYTTGMEHSPTSATGTGWERAPWHAVQSAARHALTQGSRDA*
Ga0066656_1034316613300006034SoilMEHSPTSATGTGWERTPWHATQRAAGAALKQAEMS*
Ga0075432_1022465923300006058Populus RhizosphereAYTIGIEHSPTSATGIGWERTPWQATRLAAWEVLIRLEGR*
Ga0075422_1012924813300006196Populus RhizosphereTGMEHSPTSATGTGWVRTPWHATQRAVWEALKKTPESESG*
Ga0075422_1061242513300006196Populus RhizosphereATFYTTGMEHSPTSATGTGWEPTPWHATLRAASEVLKKAEEGER*
Ga0066665_1005871443300006796SoilMNPPTSATGTGWERTPWHATQRAAWGALKQAEMS*
Ga0066665_1015491713300006796SoilYTTGMEHSPTSATGTGWERTPWRATQRAAWDALKKAEPSG*
Ga0066660_1016065813300006800SoilMEHSPTSATGTGWERSAWHATQRAAWEALKKASG*
Ga0075428_10014190153300006844Populus RhizosphereLEATFYTTGMEHSPTRDRDGWERTLWHTTKRAALEVLKKGSTA*
Ga0075433_1002229623300006852Populus RhizosphereMEHAATSATGTGWEPKPWQATQRAAWEALSRVND*
Ga0075433_1002925383300006852Populus RhizosphereMEYSPAGATGTGWERTPWHATQRAAWEAVMKSEEGNR*
Ga0075433_1026549943300006852Populus RhizosphereMSLTTGVEHSPTSATGTSWERTPWHATQRAPWEALSRVND*
Ga0075433_1047491213300006852Populus RhizosphereYVSGMEYSPAGATGTGWERTPWHATQRAARKALRKAG*
Ga0075433_1099111113300006852Populus RhizosphereFYTTGMEHSPTSATGTGWERTPWHAVQVAAWDTLRRRSI*
Ga0075433_1123730133300006852Populus RhizosphereTGMEHSPTSATGTGWERTPWHATQRAVWEALKKTPESESG*
Ga0075420_10105026513300006853Populus RhizosphereRRATFYTTGIGHSATSATGTGWESTPWHATQRAAWEVLKKAEEGER*
Ga0075425_10000447453300006854Populus RhizosphereMRATFYTTGVEHSPTRGTGTGWERTPWHATQRAAWEALKKA*
Ga0075425_10134358433300006854Populus RhizosphereFYTTGMEHSPTSATGTGWERTPWHATQRAAWEALKKAEPSG*
Ga0075434_10072303523300006871Populus RhizosphereMFYTTAIEHSRTGATGTGWEPTPWRATQRAAWGTLKRVDG*
Ga0079217_1071125323300006876Agricultural SoilMEHSATSAIGSAWEKTPWRAVQRAAWAALNTPQPSQPGA*
Ga0075429_10005644933300006880Populus RhizosphereMEHSPTNATGTGWARTPWHATQRAAWEALRRAADG*
Ga0075419_1040353613300006969Populus RhizosphereMEYSPAGATGTGWERTPWHATQQAAWEALDRAHRP*
Ga0075435_10006453443300007076Populus RhizosphereMGVAGMEHSPTSATGTGWERTAWHAVQRAAWDALRKDDG*
Ga0075435_10115664013300007076Populus RhizosphereTTGMEHSPTSATGTGSERTPWHATQRAAWDALTRAE*
Ga0099794_1019075713300007265Vadose Zone SoilTTGMEHSITSATPSVWERTPWHATQRAAWEALRTAK*
Ga0099794_1042398723300007265Vadose Zone SoilMEHSPTGAIGTAWERTPWRVVQSAAWEALKKVSV*
Ga0066710_10018348433300009012Grasslands SoilMEHSPTSATGTGWEGTPWHATPRAAWEALRQISTVE
Ga0066710_10031720213300009012Grasslands SoilATFYTTGMEHSPTSATGTGWERTPWHATQQAAWEAVRKVEREA
Ga0066710_10463360523300009012Grasslands SoilMEHSPTSATGTGWEPTPWHAVQRAAWEALKKAEEGNR
Ga0099829_1011719973300009038Vadose Zone SoilATFYTTGIEHSITSATASAWERTPWHSTQRAAWEALRKAGAGVGEMSE*
Ga0099828_1083892313300009089Vadose Zone SoilMEHSITSATASAWERTPWHAVQGAARDALRQAERSR*
Ga0099828_1116880933300009089Vadose Zone SoilGMEHSPSSATGTGWERTPWHAVQGAARDALRQTKKGD*
Ga0075418_1016046173300009100Populus RhizosphereYTTGMEHLPTSATGTAWERTLWQAVQRSAWQALKKAETG*
Ga0075418_1034627543300009100Populus RhizosphereYVSGMEYSPAGATGTGWERTPWHATQRAAWEAVMKSEEGNR*
Ga0075418_1122311223300009100Populus RhizosphereATVYTTGMEHSPTSATGTGWERTPWRATQRAPWEALNRTNRQ*
Ga0066709_10196085613300009137Grasslands SoilMEHSPTSATGTGWERTPWQTVQKAAREFLKASLDG*
Ga0114129_1032282933300009147Populus RhizosphereRYEERGWRATFYTIGMEHSPWERTPWHATQRAAWEALKKARG*
Ga0114129_1037143723300009147Populus RhizosphereMAATFYTSEMEHSPTSATGTGWKRTPWHVTQRAAWEALKRTDA*
Ga0114129_1041193253300009147Populus RhizosphereMTFSVIDHSPTSATDTRGSARRGTATQRAAWKALKKAEPSG*
Ga0114129_1123889813300009147Populus RhizosphereMEHSPTSATGTGWERTPWHATQRAAWKALMRVENYVR*
Ga0114129_1226408033300009147Populus RhizosphereSPTSATGTGWERTPWQATQRAAWEALRQAEYECHIA*
Ga0114129_1314676113300009147Populus RhizosphereTFYTTGMEHSPTSATGTGWERTPWHATQRAAWEALKKADDTQ*
Ga0075423_1133667533300009162Populus RhizosphereYTTGMEHSPTSATGTAFERTPWQATQRAAWEALKKALKP*
Ga0105249_1055571733300009553Switchgrass RhizosphereMRRDMEHSLTSAIGTGWELTPWHATQRATWEAVKRN*
Ga0105072_113595813300009818Groundwater SandEHSITSATASAWERTPWHATQRAAWEVLKKIWEVQ*
Ga0126384_1013966313300010046Tropical Forest SoilTFYTTGMEHSPVSAIGTGWEPTPWRAVQRAAWEALKSVDSIGG*
Ga0126384_1208705613300010046Tropical Forest SoilTFYTTGMEHSPTSATGTAWERTPWHATQRAAWEAAKKTQDDIR*
Ga0126382_1012037013300010047Tropical Forest SoilEHSPTSATGTAWERTAWRATLRAAWEALKRAEWVG*
Ga0126382_1186398923300010047Tropical Forest SoilYTTGMEHSPTSATGTGWERTPWQATRHAAWEALENADGRS*
Ga0134109_1011149413300010320Grasslands SoilTFHKSEMGHSRTSATGTAWERTPWRAVHRAAWEALKRT*
Ga0134071_1000249213300010336Grasslands SoilMSGMEHSPTSATGTAWEPMPWRAVQGAAWGTLRAEE
Ga0134071_1054793913300010336Grasslands SoilMFYTTAIEHSPTSATGAGWERTPWRATQRAAWEALKKTEDEIR*
Ga0126376_1001959523300010359Tropical Forest SoilMTGERATFYTTGMEHSPTSATGTGLRRTPWHAVQRAAWEALDRTGRP*
Ga0126376_1031930813300010359Tropical Forest SoilMFYTTGMEHSRTSATGTARERTPWDATQPAAWEALERADRQ*
Ga0126376_1035254513300010359Tropical Forest SoilTFYTTGMEHSPISATATAWEQTPWHATQRAAWEALDRAHRQ*
Ga0126376_1093933933300010359Tropical Forest SoilMKVGVEHSPTSATGTGWEPTPWHATQRAAWEALKKAEEGDR*
Ga0126372_1156928013300010360Tropical Forest SoilMAGYTTGIEHSPTTVTGTTWEPTPWHATQRATWEVLKRAEYGG*
Ga0126377_1004995853300010362Tropical Forest SoilMEHSPTSATGTAWERPTWHAAQRAAWGALATAEASG*
Ga0126377_1035146443300010362Tropical Forest SoilSDHPATFNVTGRAHSGIGGTAWERTPWRATQRAAWEALD*
Ga0126377_1051434323300010362Tropical Forest SoilMFYTTGMEHSRTSATGTAWERTPWDATQRAAWEALERADRQ*
Ga0126377_1197059413300010362Tropical Forest SoilFYTTGMEHSPTSATGTAWERAPWRATQRAAWEGLKNSETNC*
Ga0126377_1320009513300010362Tropical Forest SoilWRATLYATGMEHSPTSATGTAWERTPWHAVQWAAWGALKKSEA*
Ga0126377_1332967833300010362Tropical Forest SoilYTTGMEPSPSSVTGTGYEPTPWHATSRAAWEVLKKADSIGR*
Ga0126381_10106282933300010376Tropical Forest SoilFYTTGMEHSPTSATGTASERTPWRATQRAAWGALKNADQREG*
Ga0126383_1109620233300010398Tropical Forest SoilMEHSPTSATGTAWERTPWRATQRAAWEALKQTVSET*
Ga0126383_1165012113300010398Tropical Forest SoilFYTTGMEHSPTSVTGTAWERTPWHATQRAAWEALKKGDA*
Ga0134122_1165740213300010400Terrestrial SoilMEHSPTSATGTGWERTPWHATQRAVWEALKKTPESESG*
Ga0137392_1110250023300011269Vadose Zone SoilMEHSITRATASAWERTPWHAVQGAAREALRKAGDD*
Ga0137388_1169340013300012189Vadose Zone SoilMEHSITSATASAWERTPWHAVQGAARDALRQATAGG*
Ga0137382_1134971813300012200Vadose Zone SoilTTGMEHSPTSATGTGGERAPWHATQRAAREALGRGD*
Ga0137363_1047081413300012202Vadose Zone SoilMEHSPTSATGTGWERTPWHATQRAAWAVLKKADT*
Ga0137363_1152229413300012202Vadose Zone SoilGMEHSPTSATGTGWERTPWHPTQRAAWEALKNAEAIYR*
Ga0137374_1033567443300012204Vadose Zone SoilMEHSITSATASAWKRTPWHATQRAAWEALVKAEE*
Ga0137374_1100074213300012204Vadose Zone SoilMEHSITSATASAWEHTPWHAVQGAAWEALKRASERE*
Ga0137362_1001601773300012205Vadose Zone SoilMEHSPMSATGTGWERTPWHAKQRAAWEALKKGEESKG*
Ga0137362_1010514643300012205Vadose Zone SoilMEHSPPGATGTGWERTPWHATQRAAWDALMKKDAR*
Ga0137362_1030325713300012205Vadose Zone SoilTFYTTGMEHSPTSATGTGWERTPWHATQRAAWEALKQAGANNA*
Ga0137380_1035460513300012206Vadose Zone SoilMEHSITSATASAWERTPWHAIQGAARDTLRQVSRDG*
Ga0137376_1166408213300012208Vadose Zone SoilGLARDFYTTGMEHSPTSATGTGWERSAWHATQRAAWEALKKASG*
Ga0137378_1092950023300012210Vadose Zone SoilFYTTGMEHSITSATASAWERTPWHAVQRAAWEALSRVND*
Ga0137377_1148813013300012211Vadose Zone SoilTTGMEHSPMGATGTSWERTPWHATQRAAWDALTKAEIGAEHS*
Ga0137387_1056217223300012349Vadose Zone SoilYTTGMEHSITSATASALERTLWRAVQGAARDALRAAGY*
Ga0137386_1079207113300012351Vadose Zone SoilHSITSATASAWERAPWHAVQGAAREALRLANRDG*
Ga0137369_1010293733300012355Vadose Zone SoilMEHSITSATASAWERTPWHAVQGAARDALRQAEELEH*
Ga0137369_1043370913300012355Vadose Zone SoilTFYTTGMEHSITSATASAWERTPWHAFQGAARDVLRKVEAR*
Ga0137369_1085239333300012355Vadose Zone SoilGMEHSITSATASAWERTPWHAVQGAARDALRQAEAGDR*
Ga0137385_1154641723300012359Vadose Zone SoilEVLYAVRTGMEHSPTRATGTGSERTPWHATQRAAWEALKKNEEDDR*
Ga0137390_1020749513300012363Vadose Zone SoilTGMEHSATSATGTGWERTPWHATQRAAREALKKIDA*
Ga0137358_1067095313300012582Vadose Zone SoilTFYTTGMEHSPTTATGTGWERTPWHAVQRAAWEVLRRSDNYPHLG*
Ga0137358_1085376913300012582Vadose Zone SoilMEHLPTSATGTAWERTPWHATQRAAWEALKKADVA*
Ga0137397_1113846513300012685Vadose Zone SoilTFYTTGMEHSPTSATGTAWERTPWHATQRAALEALTKGTEPEGETR*
Ga0137404_1132427113300012929Vadose Zone SoilTGMEHSPTSATGTGWERTPWHATQRAAGAALKKAESSP*
Ga0137404_1187958523300012929Vadose Zone SoilEHSPTSATGTGWERTPWHATQGAAWEALRRANSDG*
Ga0126375_1123398513300012948Tropical Forest SoilTTGMEHSPTSATGIARHRTPWHATQRAAGEALKHAAEGSRAG*
Ga0126375_1169000613300012948Tropical Forest SoilSGCMAMGIEHSPRSATGTGWEPTPWHATQRAAWEALKRPETS*
Ga0126369_1087785713300012971Tropical Forest SoilKVGVEHSPTSATGTGWEPTRWHATQRAAWEALALK*
Ga0134077_1008524523300012972Grasslands SoilFYTPGMEHSPTSATGTGWERTPWHATQRAAWETLKKAETNYL*
Ga0134076_1005726513300012976Grasslands SoilGMEHSPTSATGTAWKPLPWRAVQRAAWEALRQISTVE*
Ga0163162_1161828933300013306Switchgrass RhizosphereMSLTTGMEYSPTSATGTGWERTPWHATQRAPWEALRKVDVA*
Ga0157380_1281750923300014326Switchgrass RhizosphereVSFYTTGLEHSPTSATGTAWERTPWRATQRAAWEA
Ga0137405_136648813300015053Vadose Zone SoilSLCSSYTTGMEHSPTSATGTGWERTPWHATQRAAWEALKKADAGG*
Ga0137420_150044093300015054Vadose Zone SoilMEHSPTGATGTGWERTPWHGTQRAAWEALKKAETS*
Ga0137409_1020768233300015245Vadose Zone SoilMRATFYTTRMEHSIMSATASAWERTPWHATQRAAWEALKKAEAP*
Ga0137403_1087460833300015264Vadose Zone SoilATFYTTGMEHSPTSATGTGWERTPWHATQRAAWEALKKAEAP*
Ga0132258_1090595813300015371Arabidopsis RhizosphereLSPSSATGTGWERTPWHATQSEAWEALKKAEPSG*
Ga0132257_10043256553300015373Arabidopsis RhizosphereMERSPTSAIGTGRERTPWHATQRAAWEALNKGEP*
Ga0132257_10396118723300015373Arabidopsis RhizosphereYVSGMEYSPAGATGTGWERTPWHATQRAAWGALKKTD*
Ga0132255_10012597213300015374Arabidopsis RhizosphereGMEHSATSATRTAWERTPCHATQRAAWEALRQAG*
Ga0134083_1011009723300017659Grasslands SoilMEHSPTSATGTGWERTPWHATQRAAWEALKKVEESKG
Ga0184610_122585923300017997Groundwater SedimentFYTTGMEHSITSATGTGWERTPWHAVQGAAREALSRSEVGDR
Ga0184638_106797153300018052Groundwater SedimentRATFYTTGMEHSITSATASAWERTPWHAVQGAARDALRRAE
Ga0184626_1002484023300018053Groundwater SedimentMEHSITSATASAWERTPWHATQRAAWEALRKAGEE
Ga0184637_1019517123300018063Groundwater SedimentATFYTTGMEHSITSATASAWERTPWHAVQGAARDALRQAEGGR
Ga0184609_1030837623300018076Groundwater SedimentEHSITSATASAWERTPWHSVQSAAWDALSKAEESR
Ga0184609_1050288213300018076Groundwater SedimentTFYTTGMEHSITSATASAWERTPWHAVQVAAREALRQTEEGSDD
Ga0184612_1038697313300018078Groundwater SedimentTTGMEHSITSATASAWERTSWHAVQGAARDALRQAEELEH
Ga0184629_1044404923300018084Groundwater SedimentYTSGMNHSITSATASAWERTPWHAVQGAARDALNKTAENRG
Ga0066655_1099571813300018431Grasslands SoilRRATFYTMGMEHSPRSATGTAWERMPRQAVQGAARAALRKAAE
Ga0184646_112168213300019259Groundwater SedimentTTGMEHSPTSATGTGWERTPWHATKRAAWEALKGG
Ga0126371_1221526423300021560Tropical Forest SoilAGLEHSPTSATGTAWCRTPWRETQRAAWGALKKAEA
Ga0207684_1004435863300025910Corn, Switchgrass And Miscanthus RhizosphereMEHSPTSATGTGWERTPWHATQRAAWEALKKGEESKG
Ga0207684_1100871223300025910Corn, Switchgrass And Miscanthus RhizosphereGMEHSPTSATGAGWERTRWHATQRAAAWEALERAGETD
Ga0207646_1005248963300025922Corn, Switchgrass And Miscanthus RhizosphereMEHSPTSATGTGWERTPWHATQRAAWEALKKGEES
Ga0207646_1147697613300025922Corn, Switchgrass And Miscanthus RhizosphereMEHSPTSATGTGWERTPWHATQRAAWEALKKMEDA
Ga0207681_1145978013300025923Switchgrass RhizosphereATFYTTGMEHSPTSATGTAWEPTPWQAVQGAARDALKRALIGPL
Ga0207704_1173992123300025938Miscanthus RhizosphereMGYSPTSATGTAWERTPWHATQRAAWEALRQAERIESLRALRRP
Ga0207648_1088197323300026089Miscanthus RhizosphereMEHSPTSATGTGWERTPWQATQRAAWEALKTAEESEPTG
Ga0209235_108881823300026296Grasslands SoilMEHSPMSATGTGWERTPWHATQRAAWEALKKGEESKG
Ga0209237_100546813300026297Grasslands SoilIEHSITSATALVWERTPWRAIQVAARDAQRKAEESNR
Ga0209055_1003606123300026309SoilMEHSPTGATGTGWERTPWHATQRAAWEALKKAESGS
Ga0209055_114543313300026309SoilRTFYTTGMEHSATSAIGTGWERTPWHATQRAAWEALGRVND
Ga0209761_103546013300026313Grasslands SoilGRRATFYTTGMEHSPTSATGTGWERTPWHATQRAAWEALRKVKAAR
Ga0209470_121707213300026324SoilTGMEHSITSATASAWERTPWHAVQGAARDALKRAE
Ga0209267_106369143300026331SoilRATFYTTGMEHSPTSATGTGWERTPWHATQRAAWEALKKAATSG
Ga0209803_101476013300026332SoilTTGMEHSPTGATGTGWERTPWHATQRAAWEALKKAESGS
Ga0209803_124322123300026332SoilTFYTTGMEHSPTSATGTGWERTPWHATQRAAWAVLKKADT
Ga0209057_122465213300026342SoilATFYTTGMEHSPTSATGAGWERTRWHATQRAAAWEALERAGETD
Ga0209690_109845633300026524SoilMEHSPTSTTGTAWECTPWHATQRAAREALKKAETS
Ga0209806_103034163300026529SoilVRAIFYTTWMEHSPTSATGTGWERTPWHATQRAAWEALKKGEESKG
Ga0209056_1039042313300026538SoilATFYTTGMEHSLTSATGTGWERTPWHATQRAAWEALKRSDRSG
Ga0209156_1009587433300026547SoilEHSLTRATGTAWERTPWHAVQGAAREALKQAGRDG
Ga0209577_1058141913300026552SoilGTEHSPTSATGSAWEPTPWRAVQGAARDALKRANVDG
Ga0209854_101410133300027384Groundwater SandGMEHSPAGATGSAWERTPWHATQRAAWEALRKVSAT
Ga0209854_110182623300027384Groundwater SandVRATFYVTGMEHSPTSATGTGWERTAWHATQRAAWTAL
Ga0209466_102233533300027646Tropical Forest SoilMEHSPTSATGTAWERTAWRATLRAAWEALKRAEWVG
Ga0209588_112694313300027671Vadose Zone SoilTGMEHSITSATASAWERTPWHAVQGAARDALRQATAGG
Ga0209689_101711983300027748SoilTFYTTGMEHSPTSATGTGWERTPWHATQRAAWEALKKAEPSG
Ga0209701_1019395523300027862Vadose Zone SoilGMEHSITSATGTGWERTPWHAVQGAARDALRQAAGRDR
Ga0209465_1007207413300027874Tropical Forest SoilMFYTTGMEHSPMSATGTEWERTSWRATQRAAWEALKRMLEKC
Ga0209465_1038486723300027874Tropical Forest SoilMFYTTGMEHSRTSATGTARERTPWDATQRAAWEALERADRQ
Ga0209488_1017817423300027903Vadose Zone SoilMEHSPTGATGTGWERTPWHATQRAAWEALRKAEKDSR
Ga0207428_1093493723300027907Populus RhizosphereAYTIGIEHSPTSATGIGWERTPWQATRLAAWEVLIRLEGR
Ga0207428_1120688623300027907Populus RhizosphereFYTTAMEHSATSAIGTGWEPTPWHATQRAAWEALKKLQP
Ga0209857_105925533300027957Groundwater SandMTQMEHAPTRATGFAWERTLWHATQRAAWEALKKAEPSG
Ga0307296_1053491333300028819SoilTFYTTGMEHSITSATASAWERTPSHAVPGAARDALRQRQ
Ga0307497_1032991623300031226SoilMTFYATDMEHSPTSATGTGWARTPWHATQRAAWEALKKIES
Ga0318528_1020276033300031561SoilYTTGMEHSLTSATGTAWERTPWHATQRAAREALKRADASG
Ga0318496_1026547413300031713SoilYTTGMEHSPASATGTGWELTPWHATQRAAWAILGAR
Ga0307469_1046229533300031720Hardwood Forest SoilMEHSPTSATGTGWERTPWHATQRAAWETLKKMSATNY
Ga0307469_1064044423300031720Hardwood Forest SoilMTGKEHSHTSATGTPWERTPWHAVQQAAWEALDRASPPIV
Ga0307469_1138788423300031720Hardwood Forest SoilFFANTTGMEHSPTSATGTGWERTPWHATQRVAWGALKKAEEGS
Ga0318493_1087267733300031723SoilMFAFRNPGRATLYTMGMEHSPTSATGTAWERTPWRAAQRAALEALKRADA
Ga0307468_10024392333300031740Hardwood Forest SoilVSFSTTGLEHSLTSATGTVWERTLWRAMQRGVWEALKKASTSA
Ga0307468_10028838633300031740Hardwood Forest SoilMAATFYTSEMEHSPTSATGTGWKRTPWHVTQRAAWEALKRTDA
Ga0307468_10096436223300031740Hardwood Forest SoilTGMEHSPTSATGTGWERTPWRATQRAAWEVLKKGSTA
Ga0307468_10170826813300031740Hardwood Forest SoilIEHSPTRAAGTAWECTPWHMTQRAAWEAVKKNEEDDR
Ga0307468_10196862423300031740Hardwood Forest SoilGMEHSPTSATGTAWERTPWHATQRAVGEALKKASG
Ga0318521_1055809113300031770SoilMSPTLVREPFHTTGMEHSPTSATGTAWKRTPWRATQRAAWKVLEKTE
Ga0318529_1014703733300031792SoilFYTTGMEHSPTSATSTAWERTPWHATQRAAWEAMTKDNDRISWAG
Ga0318497_1050370133300031805SoilTFYTTGMEHSPSPTGATGTGWERTPWRATQRVAWEVLTKGNQDG
Ga0318497_1088660413300031805SoilTTGMEDSPTSATGTAWERMPWHATQRAAWEALRGGKLTTGYDL
Ga0307473_1012256213300031820Hardwood Forest SoilTFYTTGMEHSPTSATGTGWERTPWHATQRAAWEALDRAHRP
Ga0307473_1077913913300031820Hardwood Forest SoilLDATFYTMGIRTLPPSVTGTGWEPTPWHATQRAVWEASRKSI
Ga0307473_1094275513300031820Hardwood Forest SoilVTFYTTGMEHSITSATRTGRERTPWHATQRAACEALKKAV
Ga0307473_1107612413300031820Hardwood Forest SoilFYTTGMEHSPTSATGTAWERTPWHATQRGAWEALEIG
Ga0318499_1002349313300031832SoilYTTGMEHSPTSATGTAWEGTRWRATQRAAWEALSKGEDR
Ga0318517_1012444413300031835SoilEHSPVSATGTAWEATPWRATQRAAWEALKRVLEKC
Ga0318511_1055112723300031845SoilFYTTGMEHSPASATGTGWELTPWHATQRAAWAILGAR
Ga0318520_1002247663300031897SoilTFYTTGMEHSPTSATGTAWEGTRWRATQRAAWEALSKGEDR
Ga0310912_1078093923300031941SoilATFYTTGMEHSPASATGTGWELTPWHATQRAAWAILGAR
Ga0310906_1000853263300032013SoilYTTGMEHSPTSATGTAWERMPWQATQRAGWEALRNAEGIE
Ga0318545_1038868423300032042SoilTGMEHSPTSATGTAWEGTRWRATQRAAWEALSKGEDR
Ga0318506_1042661323300032052SoilMFYTTGMEHSPTSATGTAWDRTPWRATQRAAWGALTAMAQMEQ
Ga0307471_10122459613300032180Hardwood Forest SoilGWRATFHTTGMEHSQTSATGTGWEGTPWHATQRAAWEALRKAK
Ga0307471_10158436723300032180Hardwood Forest SoilTGMEHSPTSATGIGWERTPWHATQRAAWDALKKAETS
Ga0307472_10016741933300032205Hardwood Forest SoilYTTGIEHSPTSATGTAWERTPWGATQRAAWEVLRRMEKDIQ
Ga0307472_10253873113300032205Hardwood Forest SoilTEHSPTSATGTGWERTPWRATQRAAWEALRRAEAPLQ
Ga0310914_1041105913300033289SoilYTMGMEHSPTSATGTAWERTPWRAAQRAALEALKRADA
Ga0364924_022762_1118_12463300033811SedimentATFYPTGMEHSITSATASAWERTPWHAVQGAARDALRQEARQ


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.