Basic Information | |
---|---|
Family ID | F018802 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 233 |
Average Sequence Length | 40 residues |
Representative Sequence | MKRKLLIAVPLLALVALAAWFFRPKHESLGEAYVSEKS |
Number of Associated Samples | 186 |
Number of Associated Scaffolds | 233 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 92.24 % |
% of genes near scaffold ends (potentially truncated) | 92.27 % |
% of genes from short scaffolds (< 2000 bps) | 84.12 % |
Associated GOLD sequencing projects | 168 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.42 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (86.266 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (25.322 % of family members) |
Environment Ontology (ENVO) | Unclassified (28.755 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (49.356 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 31.82% β-sheet: 0.00% Coil/Unstructured: 68.18% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 233 Family Scaffolds |
---|---|---|
PF07681 | DoxX | 67.81 |
PF00365 | PFK | 9.01 |
PF04024 | PspC | 6.44 |
PF02780 | Transketolase_C | 4.29 |
PF13240 | zinc_ribbon_2 | 1.72 |
PF08448 | PAS_4 | 0.86 |
PF13620 | CarboxypepD_reg | 0.43 |
PF00171 | Aldedh | 0.43 |
PF01242 | PTPS | 0.43 |
PF08281 | Sigma70_r4_2 | 0.43 |
PF17210 | SdrD_B | 0.43 |
PF04389 | Peptidase_M28 | 0.43 |
PF13358 | DDE_3 | 0.43 |
PF02897 | Peptidase_S9_N | 0.43 |
COG ID | Name | Functional Category | % Frequency in 233 Family Scaffolds |
---|---|---|---|
COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 67.81 |
COG4270 | Uncharacterized membrane protein | Function unknown [S] | 67.81 |
COG0205 | 6-phosphofructokinase | Carbohydrate transport and metabolism [G] | 9.01 |
COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.43 |
COG0720 | 6-pyruvoyl-tetrahydropterin synthase | Coenzyme transport and metabolism [H] | 0.43 |
COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.43 |
COG1505 | Prolyl endopeptidase PreP, S9A serine peptidase family | Amino acid transport and metabolism [E] | 0.43 |
COG1770 | Protease II | Amino acid transport and metabolism [E] | 0.43 |
COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.43 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 86.27 % |
Unclassified | root | N/A | 13.73 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000550|F24TB_11587556 | Not Available | 534 | Open in IMG/M |
3300001545|JGI12630J15595_10116323 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 528 | Open in IMG/M |
3300001686|C688J18823_10146135 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1624 | Open in IMG/M |
3300002245|JGIcombinedJ26739_100847580 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 795 | Open in IMG/M |
3300002560|JGI25383J37093_10211840 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 509 | Open in IMG/M |
3300002914|JGI25617J43924_10267316 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 582 | Open in IMG/M |
3300004091|Ga0062387_100009528 | All Organisms → cellular organisms → Bacteria | 3495 | Open in IMG/M |
3300004114|Ga0062593_102689571 | Not Available | 566 | Open in IMG/M |
3300005439|Ga0070711_100743749 | All Organisms → cellular organisms → Bacteria | 828 | Open in IMG/M |
3300005446|Ga0066686_10795430 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 630 | Open in IMG/M |
3300005459|Ga0068867_101072133 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
3300005468|Ga0070707_101639936 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
3300005518|Ga0070699_100016102 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 6419 | Open in IMG/M |
3300005537|Ga0070730_10348649 | All Organisms → cellular organisms → Bacteria | 964 | Open in IMG/M |
3300005542|Ga0070732_10018737 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3882 | Open in IMG/M |
3300005552|Ga0066701_10219163 | All Organisms → cellular organisms → Bacteria | 1171 | Open in IMG/M |
3300005556|Ga0066707_10667485 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 655 | Open in IMG/M |
3300005557|Ga0066704_10136392 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1638 | Open in IMG/M |
3300005560|Ga0066670_10837807 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 558 | Open in IMG/M |
3300005569|Ga0066705_10282756 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1052 | Open in IMG/M |
3300005569|Ga0066705_10596001 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 679 | Open in IMG/M |
3300005569|Ga0066705_10600363 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 675 | Open in IMG/M |
3300005586|Ga0066691_10302540 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 943 | Open in IMG/M |
3300005610|Ga0070763_10428001 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
3300005712|Ga0070764_10564324 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 691 | Open in IMG/M |
3300005764|Ga0066903_106325403 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 618 | Open in IMG/M |
3300005843|Ga0068860_100292320 | All Organisms → cellular organisms → Bacteria | 1595 | Open in IMG/M |
3300006052|Ga0075029_101176219 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
3300006086|Ga0075019_10286140 | All Organisms → cellular organisms → Bacteria | 990 | Open in IMG/M |
3300006102|Ga0075015_100295265 | All Organisms → cellular organisms → Bacteria | 890 | Open in IMG/M |
3300006172|Ga0075018_10225399 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 898 | Open in IMG/M |
3300006794|Ga0066658_10163028 | All Organisms → cellular organisms → Bacteria | 1144 | Open in IMG/M |
3300006796|Ga0066665_10055872 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 2742 | Open in IMG/M |
3300006796|Ga0066665_11534788 | Not Available | 521 | Open in IMG/M |
3300006797|Ga0066659_10943921 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 721 | Open in IMG/M |
3300006800|Ga0066660_11347305 | Not Available | 559 | Open in IMG/M |
3300006800|Ga0066660_11438086 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 541 | Open in IMG/M |
3300006806|Ga0079220_10612383 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 777 | Open in IMG/M |
3300006893|Ga0073928_10496843 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 876 | Open in IMG/M |
3300006914|Ga0075436_100675378 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 764 | Open in IMG/M |
3300007255|Ga0099791_10057759 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1743 | Open in IMG/M |
3300007255|Ga0099791_10145455 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli | 1106 | Open in IMG/M |
3300007255|Ga0099791_10394223 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 666 | Open in IMG/M |
3300007258|Ga0099793_10113856 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli | 1260 | Open in IMG/M |
3300007265|Ga0099794_10060805 | All Organisms → cellular organisms → Bacteria | 1835 | Open in IMG/M |
3300009012|Ga0066710_102823035 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 686 | Open in IMG/M |
3300009038|Ga0099829_10279699 | All Organisms → cellular organisms → Bacteria | 1365 | Open in IMG/M |
3300009088|Ga0099830_10547061 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 947 | Open in IMG/M |
3300009088|Ga0099830_10863452 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 748 | Open in IMG/M |
3300009090|Ga0099827_10821988 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 804 | Open in IMG/M |
3300009090|Ga0099827_11745792 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 542 | Open in IMG/M |
3300009792|Ga0126374_10142807 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1438 | Open in IMG/M |
3300010046|Ga0126384_10728742 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 881 | Open in IMG/M |
3300010048|Ga0126373_12828369 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 542 | Open in IMG/M |
3300010321|Ga0134067_10245919 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 673 | Open in IMG/M |
3300010362|Ga0126377_10452172 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1307 | Open in IMG/M |
3300010362|Ga0126377_11065865 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 876 | Open in IMG/M |
3300010376|Ga0126381_103386799 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 628 | Open in IMG/M |
3300010379|Ga0136449_104659926 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
3300011269|Ga0137392_10300733 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1326 | Open in IMG/M |
3300011269|Ga0137392_10899099 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 729 | Open in IMG/M |
3300011271|Ga0137393_10055543 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3113 | Open in IMG/M |
3300012189|Ga0137388_10786972 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 882 | Open in IMG/M |
3300012189|Ga0137388_11698708 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 565 | Open in IMG/M |
3300012189|Ga0137388_11766299 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 551 | Open in IMG/M |
3300012200|Ga0137382_10289362 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1141 | Open in IMG/M |
3300012202|Ga0137363_10347717 | All Organisms → cellular organisms → Bacteria | 1226 | Open in IMG/M |
3300012202|Ga0137363_10959525 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 726 | Open in IMG/M |
3300012203|Ga0137399_10066103 | All Organisms → cellular organisms → Bacteria | 2694 | Open in IMG/M |
3300012203|Ga0137399_10083470 | All Organisms → cellular organisms → Bacteria | 2431 | Open in IMG/M |
3300012205|Ga0137362_10191483 | All Organisms → cellular organisms → Bacteria | 1759 | Open in IMG/M |
3300012205|Ga0137362_10375231 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1232 | Open in IMG/M |
3300012205|Ga0137362_11053177 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 692 | Open in IMG/M |
3300012206|Ga0137380_11361129 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
3300012207|Ga0137381_10623108 | All Organisms → cellular organisms → Bacteria | 939 | Open in IMG/M |
3300012210|Ga0137378_10801309 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 854 | Open in IMG/M |
3300012211|Ga0137377_11534868 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 591 | Open in IMG/M |
3300012359|Ga0137385_11404524 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 561 | Open in IMG/M |
3300012363|Ga0137390_10902741 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 838 | Open in IMG/M |
3300012363|Ga0137390_11316516 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
3300012917|Ga0137395_10154493 | All Organisms → cellular organisms → Bacteria | 1573 | Open in IMG/M |
3300012925|Ga0137419_10653712 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 849 | Open in IMG/M |
3300012925|Ga0137419_11000156 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 693 | Open in IMG/M |
3300012927|Ga0137416_10545655 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1004 | Open in IMG/M |
3300012927|Ga0137416_12241068 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 502 | Open in IMG/M |
3300012929|Ga0137404_11144351 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 715 | Open in IMG/M |
3300012971|Ga0126369_12107517 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 651 | Open in IMG/M |
3300012977|Ga0134087_10067909 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1440 | Open in IMG/M |
3300014169|Ga0181531_10314774 | Not Available | 958 | Open in IMG/M |
3300014200|Ga0181526_10879052 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 564 | Open in IMG/M |
3300015053|Ga0137405_1190904 | All Organisms → cellular organisms → Bacteria | 2446 | Open in IMG/M |
3300015053|Ga0137405_1423851 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6112 | Open in IMG/M |
3300015241|Ga0137418_10257778 | All Organisms → cellular organisms → Bacteria | 1476 | Open in IMG/M |
3300015242|Ga0137412_10357321 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Lacipirellulaceae | 1137 | Open in IMG/M |
3300015242|Ga0137412_10460500 | All Organisms → cellular organisms → Bacteria | 977 | Open in IMG/M |
3300015242|Ga0137412_11037678 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 584 | Open in IMG/M |
3300015264|Ga0137403_10786229 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 808 | Open in IMG/M |
3300015264|Ga0137403_11000835 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 683 | Open in IMG/M |
3300015356|Ga0134073_10420745 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
3300015374|Ga0132255_101994308 | Not Available | 883 | Open in IMG/M |
3300016357|Ga0182032_10196730 | All Organisms → cellular organisms → Bacteria | 1531 | Open in IMG/M |
3300016357|Ga0182032_11009559 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 711 | Open in IMG/M |
3300016371|Ga0182034_11660367 | Not Available | 562 | Open in IMG/M |
3300016404|Ga0182037_10669984 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 886 | Open in IMG/M |
3300017822|Ga0187802_10059837 | Not Available | 1402 | Open in IMG/M |
3300017823|Ga0187818_10539114 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
3300017934|Ga0187803_10023981 | All Organisms → cellular organisms → Bacteria | 2431 | Open in IMG/M |
3300017955|Ga0187817_10386873 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 892 | Open in IMG/M |
3300018057|Ga0187858_10381012 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 879 | Open in IMG/M |
3300018090|Ga0187770_10419257 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1053 | Open in IMG/M |
3300018433|Ga0066667_10382548 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1131 | Open in IMG/M |
3300018468|Ga0066662_11779170 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 645 | Open in IMG/M |
3300018482|Ga0066669_11424768 | Not Available | 628 | Open in IMG/M |
3300019789|Ga0137408_1090847 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1543 | Open in IMG/M |
3300020010|Ga0193749_1068685 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 664 | Open in IMG/M |
3300020021|Ga0193726_1199823 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 841 | Open in IMG/M |
3300020579|Ga0210407_10981035 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 645 | Open in IMG/M |
3300020579|Ga0210407_11393094 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 520 | Open in IMG/M |
3300020580|Ga0210403_10747570 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 781 | Open in IMG/M |
3300020581|Ga0210399_10833933 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 751 | Open in IMG/M |
3300020583|Ga0210401_10013291 | All Organisms → cellular organisms → Bacteria | 8000 | Open in IMG/M |
3300021046|Ga0215015_10890723 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 553 | Open in IMG/M |
3300021086|Ga0179596_10412853 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 682 | Open in IMG/M |
3300021086|Ga0179596_10498775 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 617 | Open in IMG/M |
3300021086|Ga0179596_10694575 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
3300021171|Ga0210405_10262680 | All Organisms → cellular organisms → Bacteria | 1365 | Open in IMG/M |
3300021171|Ga0210405_10850284 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 696 | Open in IMG/M |
3300021401|Ga0210393_10481441 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1013 | Open in IMG/M |
3300021401|Ga0210393_10864838 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 734 | Open in IMG/M |
3300021407|Ga0210383_10993274 | Not Available | 712 | Open in IMG/M |
3300021420|Ga0210394_10413119 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1187 | Open in IMG/M |
3300021420|Ga0210394_10477612 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1097 | Open in IMG/M |
3300021474|Ga0210390_10090910 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2541 | Open in IMG/M |
3300021474|Ga0210390_10822054 | Not Available | 768 | Open in IMG/M |
3300021477|Ga0210398_11034394 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 654 | Open in IMG/M |
3300021479|Ga0210410_11049459 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 704 | Open in IMG/M |
3300021559|Ga0210409_10829444 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 798 | Open in IMG/M |
3300021559|Ga0210409_10912004 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 752 | Open in IMG/M |
3300021560|Ga0126371_11169449 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
3300021560|Ga0126371_11808198 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 732 | Open in IMG/M |
3300024181|Ga0247693_1042664 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
3300024288|Ga0179589_10452645 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
3300024290|Ga0247667_1110245 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 507 | Open in IMG/M |
3300025916|Ga0207663_10830904 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 737 | Open in IMG/M |
3300026041|Ga0207639_12156763 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 518 | Open in IMG/M |
3300026089|Ga0207648_10698753 | All Organisms → cellular organisms → Bacteria | 940 | Open in IMG/M |
3300026296|Ga0209235_1196765 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 709 | Open in IMG/M |
3300026297|Ga0209237_1103649 | All Organisms → cellular organisms → Bacteria | 1240 | Open in IMG/M |
3300026309|Ga0209055_1176931 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 664 | Open in IMG/M |
3300026343|Ga0209159_1170001 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 799 | Open in IMG/M |
3300026481|Ga0257155_1078137 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 536 | Open in IMG/M |
3300026515|Ga0257158_1082347 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 623 | Open in IMG/M |
3300026538|Ga0209056_10691721 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
3300026551|Ga0209648_10392247 | Not Available | 919 | Open in IMG/M |
3300026557|Ga0179587_11071802 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 530 | Open in IMG/M |
3300026928|Ga0207779_1012180 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1179 | Open in IMG/M |
3300027064|Ga0208724_1006351 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1095 | Open in IMG/M |
3300027174|Ga0207948_1012622 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 978 | Open in IMG/M |
3300027502|Ga0209622_1074115 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
3300027587|Ga0209220_1017515 | All Organisms → cellular organisms → Bacteria | 1909 | Open in IMG/M |
3300027587|Ga0209220_1032076 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1408 | Open in IMG/M |
3300027629|Ga0209422_1121537 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 597 | Open in IMG/M |
3300027643|Ga0209076_1097410 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 835 | Open in IMG/M |
3300027660|Ga0209736_1084098 | Not Available | 874 | Open in IMG/M |
3300027663|Ga0208990_1028351 | All Organisms → cellular organisms → Bacteria | 1789 | Open in IMG/M |
3300027667|Ga0209009_1179507 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 537 | Open in IMG/M |
3300027684|Ga0209626_1103117 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 740 | Open in IMG/M |
3300027725|Ga0209178_1221398 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 676 | Open in IMG/M |
3300027729|Ga0209248_10047860 | All Organisms → cellular organisms → Bacteria | 1315 | Open in IMG/M |
3300027787|Ga0209074_10425456 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 562 | Open in IMG/M |
3300027824|Ga0209040_10042722 | All Organisms → cellular organisms → Bacteria | 2784 | Open in IMG/M |
3300027829|Ga0209773_10430072 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 546 | Open in IMG/M |
3300027857|Ga0209166_10195305 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1090 | Open in IMG/M |
3300027875|Ga0209283_10085362 | All Organisms → cellular organisms → Bacteria | 2051 | Open in IMG/M |
3300027875|Ga0209283_10575617 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 716 | Open in IMG/M |
3300027879|Ga0209169_10421751 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 702 | Open in IMG/M |
3300027882|Ga0209590_10022310 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3217 | Open in IMG/M |
3300027908|Ga0209006_11109977 | Not Available | 623 | Open in IMG/M |
3300027915|Ga0209069_10776233 | Not Available | 570 | Open in IMG/M |
3300028047|Ga0209526_10027131 | All Organisms → cellular organisms → Bacteria | 4018 | Open in IMG/M |
3300028047|Ga0209526_10708878 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 633 | Open in IMG/M |
3300028673|Ga0257175_1077397 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 635 | Open in IMG/M |
3300028792|Ga0307504_10061440 | All Organisms → cellular organisms → Bacteria | 1103 | Open in IMG/M |
3300028906|Ga0308309_10062682 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2737 | Open in IMG/M |
3300030935|Ga0075401_10914646 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 568 | Open in IMG/M |
3300031057|Ga0170834_106260310 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 713 | Open in IMG/M |
3300031057|Ga0170834_109678883 | All Organisms → cellular organisms → Bacteria | 1204 | Open in IMG/M |
3300031057|Ga0170834_109773128 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 662 | Open in IMG/M |
3300031231|Ga0170824_128199577 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1660 | Open in IMG/M |
3300031446|Ga0170820_11120373 | Not Available | 527 | Open in IMG/M |
3300031446|Ga0170820_16510732 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 708 | Open in IMG/M |
3300031474|Ga0170818_110020259 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 593 | Open in IMG/M |
3300031679|Ga0318561_10683455 | Not Available | 564 | Open in IMG/M |
3300031718|Ga0307474_10106696 | All Organisms → cellular organisms → Bacteria | 2097 | Open in IMG/M |
3300031740|Ga0307468_102233389 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 530 | Open in IMG/M |
3300031744|Ga0306918_11559277 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 504 | Open in IMG/M |
3300031779|Ga0318566_10163651 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1104 | Open in IMG/M |
3300031796|Ga0318576_10020082 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2641 | Open in IMG/M |
3300031823|Ga0307478_10681166 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 861 | Open in IMG/M |
3300031879|Ga0306919_10562886 | All Organisms → cellular organisms → Bacteria | 879 | Open in IMG/M |
3300031954|Ga0306926_10867483 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1083 | Open in IMG/M |
3300031962|Ga0307479_10772251 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 937 | Open in IMG/M |
3300032044|Ga0318558_10483006 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 618 | Open in IMG/M |
3300032055|Ga0318575_10484864 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 628 | Open in IMG/M |
3300032060|Ga0318505_10357425 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 690 | Open in IMG/M |
3300032076|Ga0306924_11699515 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 661 | Open in IMG/M |
3300032091|Ga0318577_10060060 | All Organisms → cellular organisms → Bacteria | 1723 | Open in IMG/M |
3300032174|Ga0307470_10520104 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 872 | Open in IMG/M |
3300032180|Ga0307471_100248294 | All Organisms → cellular organisms → Bacteria | 1829 | Open in IMG/M |
3300032180|Ga0307471_100456246 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1418 | Open in IMG/M |
3300032180|Ga0307471_103546293 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 552 | Open in IMG/M |
3300032180|Ga0307471_103779129 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 535 | Open in IMG/M |
3300032205|Ga0307472_100033630 | All Organisms → cellular organisms → Bacteria | 3008 | Open in IMG/M |
3300032805|Ga0335078_10017185 | All Organisms → cellular organisms → Bacteria | 10748 | Open in IMG/M |
3300032829|Ga0335070_10454337 | Not Available | 1219 | Open in IMG/M |
3300032955|Ga0335076_10057987 | All Organisms → cellular organisms → Bacteria | 3828 | Open in IMG/M |
3300033134|Ga0335073_10072005 | All Organisms → cellular organisms → Bacteria | 4542 | Open in IMG/M |
3300033289|Ga0310914_11137884 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 682 | Open in IMG/M |
3300033290|Ga0318519_10819084 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 573 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 25.32% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 15.02% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.73% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 6.44% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.29% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.72% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.86% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.43% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 3.00% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.58% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.15% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.15% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.72% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.72% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.72% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.72% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.72% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.29% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.29% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.29% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.86% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.86% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.86% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.86% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.43% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.43% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.43% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.43% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.43% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.43% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.43% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.43% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
3300001545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 | Environmental | Open in IMG/M |
3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300002560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm | Environmental | Open in IMG/M |
3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300020010 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1s2 | Environmental | Open in IMG/M |
3300020021 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1 | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300024181 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK34 | Environmental | Open in IMG/M |
3300024249 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK17 | Environmental | Open in IMG/M |
3300024251 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK20 | Environmental | Open in IMG/M |
3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
3300024290 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK08 | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
3300026481 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-A | Environmental | Open in IMG/M |
3300026515 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-A | Environmental | Open in IMG/M |
3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
3300026869 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 53 (SPAdes) | Environmental | Open in IMG/M |
3300026928 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 44 (SPAdes) | Environmental | Open in IMG/M |
3300027064 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF003 (SPAdes) | Environmental | Open in IMG/M |
3300027174 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF040 (SPAdes) | Environmental | Open in IMG/M |
3300027502 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027587 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027629 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
3300027660 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027663 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027684 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300028673 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-B | Environmental | Open in IMG/M |
3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300030935 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA7 SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
F24TB_115875561 | 3300000550 | Soil | MKKKLLIAVPLLALVALTPWFFRPRHESLGEAYVSEKSVT |
JGI12630J15595_101163232 | 3300001545 | Forest Soil | MKRKLLVAVPLLILVGLLAWGLRPKRESLGEGYVSERS |
C688J18823_101461352 | 3300001686 | Soil | MKRKLLVAVPLLCVVGLLAWVLRPKHESLGAEYVSERSVTLW |
JGIcombinedJ26739_1008475801 | 3300002245 | Forest Soil | MKRKLLVAVPLLCLVAVLAWFFRPKHEYLGEAYVSERSSTLWSSV |
JGI25383J37093_102118402 | 3300002560 | Grasslands Soil | MKRKLLIAVPLLSLVALAAWMLRPRHETLGEAFVSEKVAP |
JGI25617J43924_102673161 | 3300002914 | Grasslands Soil | MKRKILIAVPLLFLVALVAWMLRPKHETLAEAFVSEKAAPLLSGIA |
Ga0062387_1000095281 | 3300004091 | Bog Forest Soil | MKRKLLIAVPLLLVVAVVAWFFRPKHETLGEAYVGERTATLWSSVAQ |
Ga0062593_1026895711 | 3300004114 | Soil | MKRKLLIAVPLLSVVVILAWIFRPKREFLGEAYVGERTATL |
Ga0070711_1007437491 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MKRKLLIAVPLLALVALTAWFFRPKHESLGEAYVSEKSVTLW |
Ga0066686_107954302 | 3300005446 | Soil | MKRKLLIAVPLLSLVALAAWMLRPRHETAGEAFVSEKVAPL |
Ga0068867_1010721332 | 3300005459 | Miscanthus Rhizosphere | MKRKLLIAVPLLALVALTAWFFRPKHESLGEAFVSEKSVT |
Ga0070707_1016399361 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MKRKLLIAVPLLCLVTLAAWMVRPRRESQGEAYISEKVAPILSSIA |
Ga0070699_1000161027 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MKRKLLIAVPLLSVVVILAWIFRPKREFLGEAYVGERTATLWSSV |
Ga0070730_103486493 | 3300005537 | Surface Soil | MKRKLLIAVPLLALVAIAAWFFRPKHESLEEAYISEKSV |
Ga0070732_100187371 | 3300005542 | Surface Soil | MKRKLLIAVPLLCLVAFAAWMVRPKRETQGEAFVS |
Ga0066701_102191631 | 3300005552 | Soil | MKRKLLIAVPLLCLVGFFAWWFRPKHETLGEAFVSERSVTL |
Ga0066707_106674852 | 3300005556 | Soil | MKRKLLIAVPLLALVVLVAWMLRPKRENQGEAFVSEKV |
Ga0066704_101363924 | 3300005557 | Soil | MKRKLLIAVPLLSLVALVAWMLRPKHETLGQAFVSEKVAPLLTGI |
Ga0066670_108378071 | 3300005560 | Soil | MKRKLLIAVPLLALVTLVAWMLRPKHETLGEAFVSEKVA |
Ga0066705_102827561 | 3300005569 | Soil | MKRKLVIAVPLLALVALVAWVLRPKREAQGEAFVSEKVAP |
Ga0066705_105960012 | 3300005569 | Soil | MKRKLLIAVPLLALVALAAWMLRPKRENQGEAFVSE |
Ga0066705_106003631 | 3300005569 | Soil | MKRRLLIAVPLLCLVAVAAWMFRPKRETQSEAFVSEKVAPVLSGI |
Ga0066691_103025402 | 3300005586 | Soil | MKRRLLIAVPLLALVALSAWMLRPKRENQGEAFVSEKV |
Ga0070763_104280011 | 3300005610 | Soil | MKRKLLVAVPLLCLVALLAWYFRPKHETFDEMFVSERS |
Ga0070764_105643241 | 3300005712 | Soil | MKRKLLIAVPLLLLVAVTAWFFRPKHETLGEAYVG |
Ga0066903_1063254032 | 3300005764 | Tropical Forest Soil | MKRKLLIAVPLLALVTLTAWFFRPKHESLGEAYVSEKSVTLW |
Ga0068860_1002923201 | 3300005843 | Switchgrass Rhizosphere | MKKKLLIAVPLLALVAVTAWFFRPKHESLGEAYVSEKSVTLWSS |
Ga0075029_1011762192 | 3300006052 | Watersheds | MKRKLLVAVPLLCVVALLAWYFRPKHESLGEAYVSERSVTLWS |
Ga0075019_102861402 | 3300006086 | Watersheds | MKRKLLVAVPLLCVVALLAWYFRPKHESLGEAYVSERSVTLWSSIA |
Ga0075015_1002952652 | 3300006102 | Watersheds | MRRKLVIAVPLLGLVVLVAWWFRPRHETLGEAFISEKAAPLLSS |
Ga0075018_102253991 | 3300006172 | Watersheds | MKRKLLVAVPLLCMVALLAWLFRPKHESIGQAYISERSVTLWS |
Ga0070716_1002709491 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MKRKLLVAIPLLVIVVIAAWIVRPKHEYIGEAYVST |
Ga0066658_101630283 | 3300006794 | Soil | MKRKLLIAVPLLCVVGVTAWMFRPKRESQGEAFVSERAAPVLSGIAQV |
Ga0066665_100558722 | 3300006796 | Soil | MKRKLLIAVPLLCLVMLVAWLLRPKHELLGEASIS* |
Ga0066665_115347881 | 3300006796 | Soil | MKRKLLIAVPLLCLVIFFAWMFRPKRETQGEAFVNEKVAPVLS |
Ga0066659_109439211 | 3300006797 | Soil | MKRRLLIAVPLLALVALAAWMLRPKRENQGEAFVSEKV |
Ga0066660_113473051 | 3300006800 | Soil | MKRKLLIAVPLLCLVIFFAWMFRPKRETQGEAFVNENVAPVLSGIA |
Ga0066660_114380861 | 3300006800 | Soil | MKRRLLIAVPLLALVALSAWMLRPKRENQGEAFVSEK |
Ga0079220_106123832 | 3300006806 | Agricultural Soil | MKRKLLIAVPLLCLVAFAAWMFRPRRESQGEAFISE |
Ga0073928_104968432 | 3300006893 | Iron-Sulfur Acid Spring | MKRKLLVAVPLLCLVAVLAWFFRPKHEYLGEAYVSERSTTLWSSV |
Ga0075436_1006753781 | 3300006914 | Populus Rhizosphere | MKRKLLIAVPLLALVTLTAWFFRPKHESLGEAYVSEKSVTLWSSMAQV |
Ga0099791_100577594 | 3300007255 | Vadose Zone Soil | MKRKLLIAVPLLALVTLVAWMLRPKHETLSEAVVSEKT |
Ga0099791_101454553 | 3300007255 | Vadose Zone Soil | MKRKLLIAVPLLCLVGFFAWWFRPKHETLGEAFVSERS |
Ga0099791_103942232 | 3300007255 | Vadose Zone Soil | MKRKLLVAVPLLCVVVVLAWFFRPKHEYLGEAYVSERSTTLWS |
Ga0099793_101138563 | 3300007258 | Vadose Zone Soil | MKRKLLIAVPLLCLVGLLAWSFRPKHETLGEAFVSERSVTLWGRVA |
Ga0099794_100608054 | 3300007265 | Vadose Zone Soil | MKRKLLVAVPLLCLVAVTAWFFRPKHEYLGEAYVSERST |
Ga0066710_1028230351 | 3300009012 | Grasslands Soil | MKRKLLIAVPLLCLVGFFAWWFRPKHETLGEAFVSE |
Ga0099829_102796992 | 3300009038 | Vadose Zone Soil | MKRKLLIAVPLLALVTLVAWMLRPKHETLVEAFVSEKVAPLLSGIA |
Ga0099830_105470612 | 3300009088 | Vadose Zone Soil | MKRKLLIAVPLLVLVALVAWMLRPKHETLVEAFVSEKVAP |
Ga0099830_108634521 | 3300009088 | Vadose Zone Soil | MKRKLLIAVPLLCLVAFAAWMVRPKHETQGEAFISEKVAPL |
Ga0099827_108219882 | 3300009090 | Vadose Zone Soil | MKRKLLIAVPLLALVAFAAWMLRPKHETLGEAFVSEKI |
Ga0099827_117457922 | 3300009090 | Vadose Zone Soil | MKRRLLVAIPLLSLVALLAWIFRPRHESLGEAYVSDQSVMLWSSVAQ |
Ga0126374_101428071 | 3300009792 | Tropical Forest Soil | MKKKLLIAVPLLALVALTAWFFRPKHESLGEAYVSEKSVTLWSSM |
Ga0126380_109476972 | 3300010043 | Tropical Forest Soil | MKRKLLVAIPLLILVVIAAWIVRPKHEYIGEAYVSTKSTAIL |
Ga0126384_107287422 | 3300010046 | Tropical Forest Soil | MKRKLLIAVPLLALVALTAWFFRPKHESLGEAYVSEKSVTLWSS |
Ga0126373_128283692 | 3300010048 | Tropical Forest Soil | MKRKLLIAVPLLCLVGVTAWMFRPKHESQEEAFVSEKAAPVLS |
Ga0134067_102459192 | 3300010321 | Grasslands Soil | MKRKLVIAVPLLALVALVAWVLRPKREAQGEAFVSEKVAPLL |
Ga0126376_116797392 | 3300010359 | Tropical Forest Soil | MKRKLLVAIPLLILVVIAAWIVRPKHEYIGEAYVS |
Ga0126377_104521721 | 3300010362 | Tropical Forest Soil | MKRKLLVAVPLLCVVGLVAWVLRPKHESLGAEYVSERSVTLWSS |
Ga0126377_110658651 | 3300010362 | Tropical Forest Soil | MKKKLLIAVPLLALVALTAWFFRPKHESLGEAYVSEKSV |
Ga0126381_1033867991 | 3300010376 | Tropical Forest Soil | MKRKLLIAIPLLALVALTAWFFRPRRESLVEEYVSEKSVT |
Ga0136449_1046599261 | 3300010379 | Peatlands Soil | MKRKLLVVVPLLCLVVLLAWLFRPKHESLGSAYVSE |
Ga0137392_103007331 | 3300011269 | Vadose Zone Soil | MKRKLLVAVPLLCVVALLAWILRPKHESLSDAYISERSVTLWSS |
Ga0137392_108990993 | 3300011269 | Vadose Zone Soil | MRRKLLIAVPLLALVTLVAWMLRPKHEPLSEAFVSEKV |
Ga0137393_100555435 | 3300011271 | Vadose Zone Soil | MRRKLLIAVPLLALVALLAWMLRPRRETLGEAFVSEKVAPLLSSIAQ |
Ga0137388_107869721 | 3300012189 | Vadose Zone Soil | MKRKLLIAVPLLCLVGLVAWWFRPKHETLGEAFVSERSVTLWG |
Ga0137388_116987081 | 3300012189 | Vadose Zone Soil | MKRKLLVAVPLLCVVALTAWFFRPRHEYLGEAYVSERSTTL |
Ga0137388_117662991 | 3300012189 | Vadose Zone Soil | MKRRLLIAVPLLCLVGLVAWWFRPRHETLGEAFVSERSVTLWG |
Ga0137382_102893621 | 3300012200 | Vadose Zone Soil | MKRRLLIAVPLLALVTLVAWMLRPKHETLGEAFVSEKVAPLLSGIA |
Ga0137363_103477171 | 3300012202 | Vadose Zone Soil | MKRKLLVAVPLLCLVAVTAWFFRPKHEYLGEAYVSERSTTLWSSV |
Ga0137363_109595252 | 3300012202 | Vadose Zone Soil | MKRKLLVAVPLLCLVAVTAWFFRPKHEYLGEAYVSERSTTLWS |
Ga0137399_100661035 | 3300012203 | Vadose Zone Soil | VKRRLLIAVPLLALVGLAAWMLRPRRETLGEAFISEKAAPL |
Ga0137399_100834705 | 3300012203 | Vadose Zone Soil | MKRKLLIAVPLLSLVTLAAWMLRPKHETLGEAFVSEKVAPLLSGIAQV |
Ga0137362_101914831 | 3300012205 | Vadose Zone Soil | MKRKLLVAVPLLCLVAVTAWFFRPKHEYLGEAYVSERSTTL |
Ga0137362_103752311 | 3300012205 | Vadose Zone Soil | MKRRLLIAVPLLALVTLAAWMLRPKHETLGEAFVSEKV |
Ga0137362_107761942 | 3300012205 | Vadose Zone Soil | MKRKLLVAIPLLCVVVVLAWLFRPKHEYLGEAYVSER |
Ga0137362_110531772 | 3300012205 | Vadose Zone Soil | MKRKLLIAVPLLVLVALVAWMLRPKHETLVEAFVSEKVAPLL |
Ga0137380_113611293 | 3300012206 | Vadose Zone Soil | MKRKLLIAVPLLCLVTLVAWLLRPKHELLGEAFISERDA |
Ga0137381_106231083 | 3300012207 | Vadose Zone Soil | MKKKLLIAVPLLALVTLTAWFFRPKHESLGEAFVSEK |
Ga0137378_108013091 | 3300012210 | Vadose Zone Soil | MKRKLLIAVPLLCLVTLVAWLLRPKHELLGEAFISERD |
Ga0137377_115348681 | 3300012211 | Vadose Zone Soil | MRRKLLIAVPLLALVTLAAWMLRPKHETLGEAFVS |
Ga0137385_114045241 | 3300012359 | Vadose Zone Soil | MKRKLLIAVPLLCLVTLVAWLLRPKHELLGEAFISERDAPLLSGIAE |
Ga0137390_109027411 | 3300012363 | Vadose Zone Soil | MKRKLLIAVPLLALVTLLAWTLRPRHETLGVAFVS |
Ga0137390_113165162 | 3300012363 | Vadose Zone Soil | MKRKLLIAVPLLFLVALAAWMLRPRHETLGEAFVS |
Ga0137395_101544934 | 3300012917 | Vadose Zone Soil | MKKKLLIAVPLLALVGLTAWFFRPKHELLGEAYVSEKSATLWSSVA |
Ga0137419_106537122 | 3300012925 | Vadose Zone Soil | MKRKLLIAVPLLSLVTLAAWMLRPKHETLGEAFISEKVAP |
Ga0137419_109568372 | 3300012925 | Vadose Zone Soil | MKRKLLVAIPLLVIVVIAAWIMRPKHEYIGEAYVSTKST |
Ga0137419_110001562 | 3300012925 | Vadose Zone Soil | MKRKLLVAVPLLCVVALTAWFFRPRHEYLGEAYVSERSTTLWSSV |
Ga0137416_105456553 | 3300012927 | Vadose Zone Soil | MKRKLLIAVPLLSLVTLAAWMLRPKHETLGEAFVSE |
Ga0137416_122410681 | 3300012927 | Vadose Zone Soil | MKRRLLIAVPLLALVTLAAWMLRPKHETLGEAFVSEKVAPL |
Ga0137404_101390284 | 3300012929 | Vadose Zone Soil | MKRKLLVAIPLLVIVVIAAWIMRPKHEYIGEAYVSTKSTALLS |
Ga0137404_111443512 | 3300012929 | Vadose Zone Soil | MKRKLLIAVPLLCLVGLVAWWFRPKHETLGEAFVSER |
Ga0126369_121075171 | 3300012971 | Tropical Forest Soil | MKRKLLVAVPLLCLVALVAWFFRPKHELLGEAYVSERSVTVWSS |
Ga0134087_100679091 | 3300012977 | Grasslands Soil | MKRKLLIAVPLLALVTLAAWMLRPKHETLGEAFVSDK |
Ga0181531_103147742 | 3300014169 | Bog | MRRKLLIAIPLLVIVGIVAWLLRPKHESLGDGYISERSVTLWSS |
Ga0181526_108790521 | 3300014200 | Bog | MKRKLLVAVPLLCLVVVLAWLFRPKHETLGDAYISERSVTLF |
Ga0137405_11909044 | 3300015053 | Vadose Zone Soil | MKKKLLIAVPLLVLVAVTAWFFRPKREVLGEAYVSEKSVTLW |
Ga0137405_14238515 | 3300015053 | Vadose Zone Soil | MRRKLLIAVPLLALVALLAWMLRPRHETLGEAFVSEKAARF* |
Ga0137418_102577783 | 3300015241 | Vadose Zone Soil | MKRKLLIAVPLLILVAAVAWALRPKHESVGEAYISER |
Ga0137412_103573211 | 3300015242 | Vadose Zone Soil | MRRKLLIAVPLLLLVALAAWMLRPRRETLGEAFVREKVT |
Ga0137412_104605001 | 3300015242 | Vadose Zone Soil | MKKKLLIAVPLLALVALTAWFFRPKHELLGEAYVSE |
Ga0137412_110376782 | 3300015242 | Vadose Zone Soil | VKRKLLIAVPLLVLVVVAAWALRPKHESVGEAYISERSITLWS |
Ga0137403_107862293 | 3300015264 | Vadose Zone Soil | MKRKLLIAVPLLALVALTAWFFRPKHESLGEEYVSEKSV |
Ga0137403_110008351 | 3300015264 | Vadose Zone Soil | MKRKLLFAIPLLCLVGLLAWYVRPKHETIGEGYISERSVTLWS |
Ga0134073_104207452 | 3300015356 | Grasslands Soil | MKRKLLIAVPLLCVVGVTAWMFRPKRESQGEAFVSERAA |
Ga0132255_1019943081 | 3300015374 | Arabidopsis Rhizosphere | MKRKLLVAVPLLAVVGIMAWILRPRRESLGEQYISERSVT |
Ga0182032_101967304 | 3300016357 | Soil | MKRKLLVAVPLLCVVGLLAWYFRPKHESLGEAYVSER |
Ga0182032_110095592 | 3300016357 | Soil | MKKKLLIAVPLLALVALAAWFFRPKHELLGEAYVSEKTVT |
Ga0182034_116603672 | 3300016371 | Soil | MKRKLLVAVPLLCVVVLLAWLFRPKHESVGSGYVSERSVTLFSSMAQ |
Ga0182037_106699842 | 3300016404 | Soil | MKRKLLVAVPLLCVVGLLAWYFRPKHESLGEAYVSERTLT |
Ga0187802_100598371 | 3300017822 | Freshwater Sediment | MKKRLLVAVPLLCVVVVLAWFFRPKHESLGVAYISERSVT |
Ga0187818_105391142 | 3300017823 | Freshwater Sediment | MKRKLLVAVPILCLVTLLAWYARPKHESLGAAYVSERS |
Ga0187803_100239811 | 3300017934 | Freshwater Sediment | MKRKLLVAVPLLILVALLAWMFRPKHESLGEAFVSERNVMLWNSVAQ |
Ga0187817_103868732 | 3300017955 | Freshwater Sediment | MKRKLLIAVPLLGLVTLLAWTFRPRHETLGEAFVSERSVTL |
Ga0187776_115642692 | 3300017966 | Tropical Peatland | MKRKLLVAIPLLCMVVVLAWIFRPKHEVVGEAYVSERTVTLWS |
Ga0187858_103810122 | 3300018057 | Peatland | MKRKLLIAVPLLILVAVVAWLLRPKHELVGEGYIS |
Ga0187770_104192573 | 3300018090 | Tropical Peatland | MKRKLLVAVPLLCLVELLAWIFRPRHESLGEAYVSERTVTLW |
Ga0066667_103825484 | 3300018433 | Grasslands Soil | MKRKLLIAVPLLALVTLAAWMLRPKHETLGEAFVSEKVAP |
Ga0066662_117791701 | 3300018468 | Grasslands Soil | MKRKLLIAVPLLCLVAFAAWMVRPRHESQGEAFVSEK |
Ga0066669_114247682 | 3300018482 | Grasslands Soil | MKKKLLIAVPLLVLVTVTAWFFRPKRELLGEAYVSEKSVTLW |
Ga0137408_10908474 | 3300019789 | Vadose Zone Soil | VKRRLLIAVPLLALVGLAAWMLRPRRETLGEAFVSEKAAPLLSSIA |
Ga0193749_10686851 | 3300020010 | Soil | MKKKLLIAVPLLALVALTAWFFRPKHELLGEAYVS |
Ga0193726_11998232 | 3300020021 | Soil | MKRKLLFAIPLLCLVAILAWFFRPKHETIGEAYISERS |
Ga0210407_109810353 | 3300020579 | Soil | MKRRLLIAVPLLALVALAAWMLRPKHETLGEAFVSE |
Ga0210407_113930942 | 3300020579 | Soil | MKRKLLVAVPLLCLVALLAWIFRPKHESISDAYVS |
Ga0210403_107475702 | 3300020580 | Soil | MKRRIMIAVPLLCIVVAVAWLLRPKHEKLGEAFISERSVTLWSS |
Ga0210399_108339332 | 3300020581 | Soil | MKRKLLIAVPLLLIVAVAAWFFRPKHETLGEAYVG |
Ga0210401_1001329110 | 3300020583 | Soil | MKRKLLVAVPLLCLVGVAAWFFRPKHEYLGDAYIS |
Ga0215015_108907231 | 3300021046 | Soil | MKRRLLIAVPLLALVTLVAWMLRPKHETLGEAFVGEKAAPL |
Ga0179596_101386592 | 3300021086 | Vadose Zone Soil | MKRKLLVAIPLLCVVVVLAWLFRPKHEYLGEGYVSERSTTLW |
Ga0179596_104128532 | 3300021086 | Vadose Zone Soil | MKRKLLVAVPLLCLVAVAAWFFRPKHEYLGEAYVSERSTTLWSSV |
Ga0179596_104987752 | 3300021086 | Vadose Zone Soil | MKRKLLVAVPLLCVVVVLAWFFRPKHEYLGEAYVSER |
Ga0179596_106945751 | 3300021086 | Vadose Zone Soil | MKRKLLIAVPLLALVTLVAWMLRPKHETFDEAFVSEK |
Ga0210405_102626801 | 3300021171 | Soil | MKRKLLVAVPLLCVVVVLAWFFRPKHEYLGEAYVSERNTTLWS |
Ga0210405_108502841 | 3300021171 | Soil | MKRKLLIAVPLLLLVAVTAWFFRPKHETLGEAYVGERTATLWSSVAQV |
Ga0210393_104814413 | 3300021401 | Soil | MKRKLLIAVPLLLIVAVAAWFFRPKHETLGEAYVGERT |
Ga0210393_108648382 | 3300021401 | Soil | MKRKLLIAVPLLLIVAVVAWFFRPKHETLGEAYVGERTATLWSSVAQV |
Ga0210383_109932741 | 3300021407 | Soil | MKRKLLVAVPLLCLVVLLAWLFRPKHESLGEAYVGER |
Ga0210394_104131191 | 3300021420 | Soil | MKRKLLIAVPLLLIVAVVAWLFRPKHETLGEAYVGERTATLW |
Ga0210394_104776121 | 3300021420 | Soil | MKRKLLVAVPLLCMVALLAWLFRPKHESIGQAYISERSVT |
Ga0210390_100909105 | 3300021474 | Soil | MKKKLLVAVPLLCLVALLAWIFRPKHETVGSGYVSERSVTLFSSI |
Ga0210390_108220543 | 3300021474 | Soil | MKRKLLVAVPLLCLVALLAWFFRPKHESLGAGYVSERS |
Ga0210398_110343942 | 3300021477 | Soil | MKRKLLIAVPLLLIVAVVAWFFRPKHETLGEAYVGERTATLWSS |
Ga0210410_110494591 | 3300021479 | Soil | MKRKLLIAVPLLLIVVVAAWFFRPKHETLGEAYVGERTATLWSSVA |
Ga0210409_108294441 | 3300021559 | Soil | MKRKLLIAVPLLSLVTLAAWMLRPKHETLGEAFVSEK |
Ga0210409_109120043 | 3300021559 | Soil | MRRKLLIAVPLLALVTLLAWMLRPKHETLGVAFVS |
Ga0126371_111694493 | 3300021560 | Tropical Forest Soil | MKRRLLIAVPLLALVAITAWFFRPKHESLGEAFVSEKSVTLW |
Ga0126371_118081981 | 3300021560 | Tropical Forest Soil | MKRKLLVAVPLLCVVALLAWYFRPKHESLGAAYVSERTLTL |
Ga0247693_10426641 | 3300024181 | Soil | MKRKLLVAVPLLCIVALLAWILRPKHESISDAYISERS |
Ga0247676_10578802 | 3300024249 | Soil | MKRKLLVAIPLLVIVVIAAWIVRPKHEYIGEAYVSTKSTAL |
Ga0247679_10770702 | 3300024251 | Soil | MKRKLLVAIPLLLLVVIAAWIVRPKHEYIGEAYVSTKSTALLSSV |
Ga0179589_104526451 | 3300024288 | Vadose Zone Soil | MKRKLLVAVPLLCLVALLAWIFRPKHESLSEAYISERSVTLWSSVAQ |
Ga0247667_11102451 | 3300024290 | Soil | MKRKLLIAVPLLSIVVLFAWIFRPKRESLGEAYVGERTATLWS |
Ga0207663_108309041 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MKRKLLIAVPLLALVALTAWFFRPKHESLGEAYVSEKSVTL |
Ga0207665_109398642 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MKRKLLVAIPLLVIVVIAAWIVRPKHEYIGEAYVSTKSTALL |
Ga0207639_121567631 | 3300026041 | Corn Rhizosphere | MKRKLLIAVPLLALVALAAWFFRPKHESLGEAYVSEKS |
Ga0207648_106987531 | 3300026089 | Miscanthus Rhizosphere | MKRKLLIAVPLLALVALTAWFFRPKHESLGEAYVSEKSVTLWSSM |
Ga0209235_11967652 | 3300026296 | Grasslands Soil | MKRKLLIAVPLLSLVALAAWMLRPRHETLGEAFVS |
Ga0209237_11036494 | 3300026297 | Grasslands Soil | MKRKLLIAVPLLCLVTLVAWLLRPKHELLGEAFISE |
Ga0209055_11769311 | 3300026309 | Soil | MKRRLLIAVPLLALVTLVAWMLRPKHETLGEAFVSEKVAP |
Ga0209159_11700011 | 3300026343 | Soil | MSRRLIVAIPLLSLVALLAWIFRPRHESLGEAFVSDQSVMLW |
Ga0257155_10781371 | 3300026481 | Soil | MKRRLLIAVPLLALVGLAAWMLRPRRETLGEAFVSEKAAPL |
Ga0257158_10823471 | 3300026515 | Soil | MKRKLLIAVPLLSLVTLAAWMLRPKHETLGEAFVSEKVAPLL |
Ga0209056_106917211 | 3300026538 | Soil | MKRKLLIAVPLLALVVLVAWMLRPKRENQGEAFVSEK |
Ga0209648_103922472 | 3300026551 | Grasslands Soil | MKRKLLVAVPLLCVVALLAWLFRPKHESLGEAYVGERTI |
Ga0179587_110718021 | 3300026557 | Vadose Zone Soil | MKRKLLVAVPLLCLVAVAAWFFRPKHEYLGEAYVSE |
Ga0207821_10200492 | 3300026869 | Tropical Forest Soil | MKRKLLVAIPLLCMVVLLAWIFRPKHEVVGEAYVSERTVT |
Ga0207779_10121803 | 3300026928 | Tropical Forest Soil | MKRKLLVAIPLLCMVVLLAWIFRPKHEVVGEAYVSERTVTLWSSIA |
Ga0208724_10063513 | 3300027064 | Forest Soil | MKRKLLIAVPLLLIVAVAAWLFRPKHETLGEAYVGER |
Ga0207948_10126221 | 3300027174 | Forest Soil | MKRKLLIAVPLLLIVAVVAWFFRPKHETLGEAYVGERTATL |
Ga0209622_10741152 | 3300027502 | Forest Soil | MKRKLVVAVPLLCVVALLAWLLRPKHESLGAAYVSERSLTLLSSI |
Ga0209220_10175151 | 3300027587 | Forest Soil | MKRKLLVAVPLLCVVAVTAWLFRPKHEYLGEAYVSERSTTLWSSVA |
Ga0209220_10320764 | 3300027587 | Forest Soil | MKRKLLIAVPLLSLVTLAAWMLRPKRETLGEAFVSEK |
Ga0209422_11215372 | 3300027629 | Forest Soil | MKRKLLVAVPLLCLVALLAWILRPKHESISDAYVSERSVTLWSS |
Ga0209076_10974101 | 3300027643 | Vadose Zone Soil | MKRKLLVAVPLLCLVALLAWIFRPKHESLSDAYISERSVTLWSSV |
Ga0209736_10840982 | 3300027660 | Forest Soil | MKRKLLVAIPILCLVVLLAWLLRPKHESIGIAYVNERSVTVLVACS |
Ga0208990_10283514 | 3300027663 | Forest Soil | MKRKLLVAVPLLCLVALLAWIFRPKHESLSDAYISERSVTL |
Ga0209009_11795071 | 3300027667 | Forest Soil | MKRKLLIAVPLLCLVGLVAWWFRPKHETLGEAFVSERSVTLW |
Ga0209626_11031171 | 3300027684 | Forest Soil | MKRKLLVAVPLLCLVAVLAWLFRPKHEYLGEAYVS |
Ga0209178_10264714 | 3300027725 | Agricultural Soil | MKRKLLVAVPLLCAVALLAWYFRPKHEAIGEAYVSG |
Ga0209178_12213981 | 3300027725 | Agricultural Soil | MKRKLLIAVPLLLLVAVTAWFFRPKKESLGEAYVGERTAVLWSS |
Ga0209248_100478603 | 3300027729 | Bog Forest Soil | MKRRLLIAVPLLLLVVVIAWLLRPKREVLGEAYISERSVT |
Ga0209074_104254561 | 3300027787 | Agricultural Soil | MKRKLLIAVPLLCLVAVTAWMFRPRHESLGEAFVSEKV |
Ga0209040_100427225 | 3300027824 | Bog Forest Soil | MKRKLLVAVPLLCLVALLAWYFRPKHEVLDSAYVS |
Ga0209773_104300721 | 3300027829 | Bog Forest Soil | MKRKLLIAVPLLLIVGVVAWFFRPKHETLGEAYVGERTATLWSSVA |
Ga0209166_101953054 | 3300027857 | Surface Soil | MKRKLLVAVPLLCLVAVTAWFFRPKHEYLGEAYIS |
Ga0209283_100853621 | 3300027875 | Vadose Zone Soil | MKRRLLVAVPLLSLVAFLAWMFRPKHESLGEAYVSERSV |
Ga0209283_105756172 | 3300027875 | Vadose Zone Soil | MKRKLLVAVPLLCLVAVTAWFFRPKHEYLGEAYVSERNTTLW |
Ga0209169_104217511 | 3300027879 | Soil | MKRKLLIAVPLLLLVAVTAWFFRPKHETLGEAYVGERTA |
Ga0209590_100223106 | 3300027882 | Vadose Zone Soil | MKRRLLIAVPLLALVTLVAWMLRPKHETLGEAFVSEKVAPL |
Ga0209006_111099771 | 3300027908 | Forest Soil | MKRKLLIAVPLLLLVVVAAWLLRPKHESLGDAYISERSI |
Ga0209069_107762332 | 3300027915 | Watersheds | MKRKLLVAVPLLIVVAILAWIFRPKHESSGEAYVSER |
Ga0209526_100271311 | 3300028047 | Forest Soil | MKRKLLVAVPLLCVVALLDWILRPKHESLSDAYISERSVTLWS |
Ga0209526_107088782 | 3300028047 | Forest Soil | MKRKLLVAVPLLIVVAVVAWVLRPKHESLGEAFVSERSTILW |
Ga0257175_10773971 | 3300028673 | Soil | MKRKLLIAVPLLSLVTLAAWMLRPKHETLGEAFVSEKAAPILS |
Ga0307504_100614401 | 3300028792 | Soil | MKRKLLVAVPLLCVVALTAWFFRPRHEYLGEAYVSE |
Ga0308309_100626821 | 3300028906 | Soil | MKRKLLIAVPLLLIVAVVAWFFRPKHETLGEAYVGERT |
Ga0075401_109146461 | 3300030935 | Soil | MKKKLLIAVPLLALVALTAWFFRPKHELLGEAYVSDKSVTLWSSV |
Ga0170834_1062603101 | 3300031057 | Forest Soil | MKRKLLVAVPLLCVVALLAWILRPKHESLSDAYIS |
Ga0170834_1096788833 | 3300031057 | Forest Soil | MKRKLLVAVPLLCLVALLAWILRPKHESLSEAYISERAQ |
Ga0170834_1097731282 | 3300031057 | Forest Soil | MKKKLLIAVPLLALVALTAWFFRPKRELRGEAYVSEKSVTLWSS |
Ga0170824_1281995772 | 3300031231 | Forest Soil | MKRKLLVAVPLLCLVALLAWIFRPKHESLSEAYIS |
Ga0170820_111203732 | 3300031446 | Forest Soil | MKRKLLIAVPLLALVALTAWFFRPKRESLGEEYVSEKSVTLWS |
Ga0170820_165107321 | 3300031446 | Forest Soil | MKKKLLIAVPLLALVALTAWLFRPKHELLGEGYVSDKSVTLWSSV |
Ga0170818_1100202592 | 3300031474 | Forest Soil | MKKKLLIAVPLLALVALAAWFFRPRHELLGEAYVSEKTVTLWSSVA |
Ga0318561_106834551 | 3300031679 | Soil | MKRKLLVAVPLLCVVGLLAWYFRPKHESLGEAYVSERTLTLLS |
Ga0307474_101066964 | 3300031718 | Hardwood Forest Soil | MKKKLLIAVPLLALVALTAWIFRPKHELLGEAYVSEKSV |
Ga0307468_1022333891 | 3300031740 | Hardwood Forest Soil | MKRKLLVAVPLLCVVALLAWILRPKHESLSDAYISE |
Ga0306918_115592773 | 3300031744 | Soil | MKRKLLIAVPLLCLVALLAWFFRPKHELIGDAYVSERSVTLWSSV |
Ga0318566_101636513 | 3300031779 | Soil | MKRKLLVAVPLLCVVALLAWYFRPKHESLGAAYVSERT |
Ga0318576_100200821 | 3300031796 | Soil | MKRRLLIAVPLLCLVAVAAWMFRPKRETQSEAFVSEQVAPVL |
Ga0307478_106811661 | 3300031823 | Hardwood Forest Soil | MKRKLLVAVPLLILVAILAWILRPKHESSGEAYVSERTVPLFG |
Ga0306919_105628861 | 3300031879 | Soil | MKRKLLVAVPLLCVVGLLAWYFRPKHESLGEAYVSERTLTLLSSVAQ |
Ga0306926_108674832 | 3300031954 | Soil | MKRKLLVAVPLLCVVALLAWYFRPRHESLGAAYVSERTLTL |
Ga0307479_107722511 | 3300031962 | Hardwood Forest Soil | MKRKLLVAVPLLCLVVVLAWILRPKREYLGEAYVSERS |
Ga0318558_104830062 | 3300032044 | Soil | MKRKLLVAVPLLCVVALLAWYFRPKHESLGAAYVSERTLTLLSSVA |
Ga0318575_104848642 | 3300032055 | Soil | MKRKLLIAVPLLAVVALTAWFFRPRHESLGEAYISEKSV |
Ga0318505_103574252 | 3300032060 | Soil | MKRKLLVAVPLLCVVALLAWYFRPKHESLGAAYVSERTLTLLS |
Ga0306924_116995152 | 3300032076 | Soil | MKRRLLVAIPLLCMVVILAWIFRPKHEVVGEAYVS |
Ga0318577_100600604 | 3300032091 | Soil | MKRKLLVAVPLLCVVALLAWYFRPKHESLGAAYVSERTLTLLSSVAQV |
Ga0307470_105201041 | 3300032174 | Hardwood Forest Soil | MKRKLLVAVPLLCLVGVAAWFFRPKHEYLGDAYISERSVTL |
Ga0307471_1002482941 | 3300032180 | Hardwood Forest Soil | MKRKLLVAVPLLILVAILAWIFRPKHESSGEGYVSERSV |
Ga0307471_1004562464 | 3300032180 | Hardwood Forest Soil | MKRKLLIAVPLLSLVALVAWMLRPKHETLGQAFVSEKVAP |
Ga0307471_1035462931 | 3300032180 | Hardwood Forest Soil | MKRKLLVAVPLLFVVVVLAWLFRPRHEYLGEAYVS |
Ga0307471_1037791291 | 3300032180 | Hardwood Forest Soil | MKRKLLIAVPLLCIVGLVAWWFRPKHEILGEAFVSERSVTL |
Ga0307472_1000336304 | 3300032205 | Hardwood Forest Soil | MKRKLLVAVPLLCLVALLAWIFRPKHESLGAAYVSERS |
Ga0335082_103936571 | 3300032782 | Soil | MKRKLLVAIPLLCMVVVLAWIFRPKHEVVGQAYVSERTVTL |
Ga0335078_1001718511 | 3300032805 | Soil | MKRKLLVAVPLLCLVALAAWVFRPKHEPQGEAYVS |
Ga0335070_104543372 | 3300032829 | Soil | MKRKLLVAVPILCLVALLAWVFRPKHESLGAAFVSERSVTL |
Ga0335076_100579875 | 3300032955 | Soil | MKRKLLIAVPLLFLVGVVAWFFRPKRELLGEAYVGERTATLWS |
Ga0335073_100720051 | 3300033134 | Soil | MKRKLLVAVPLLCAVALLAWFFRPKHESVGSGYVSERSVTMFSS |
Ga0310914_111378841 | 3300033289 | Soil | MKRRLLVAIPLLCMVVILAWIFRPKHEVVGEAYVSERTVTLW |
Ga0318519_108190842 | 3300033290 | Soil | MKRKLLIAVPLLAVVALTAWFFRPRHESLGEAYISEKS |
⦗Top⦘ |