NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F018954

Metagenome / Metatranscriptome Family F018954

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F018954
Family Type Metagenome / Metatranscriptome
Number of Sequences 232
Average Sequence Length 50 residues
Representative Sequence YRNGVPVAALEGDMLRTLGEIDPSIAADVAAAAAGRRVPVLSGFVGRLG
Number of Associated Samples 176
Number of Associated Scaffolds 232

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.29 %
% of genes near scaffold ends (potentially truncated) 98.28 %
% of genes from short scaffolds (< 2000 bps) 91.81 %
Associated GOLD sequencing projects 162
AlphaFold2 3D model prediction Yes
3D model pTM-score0.35

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (68.534 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil
(12.931 % of family members)
Environment Ontology (ENVO) Unclassified
(36.207 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(57.759 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Fibrous Signal Peptide: No Secondary Structure distribution: α-helix: 14.29%    β-sheet: 7.79%    Coil/Unstructured: 77.92%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.35
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 232 Family Scaffolds
PF01965DJ-1_PfpI 14.22
PF00076RRM_1 12.50
PF13091PLDc_2 4.31
PF07681DoxX 2.59
PF05726Pirin_C 2.16
PF04679DNA_ligase_A_C 2.16
PF03807F420_oxidored 1.72
PF04389Peptidase_M28 1.29
PF04542Sigma70_r2 0.86
PF00535Glycos_transf_2 0.86
PF04264YceI 0.86
PF00144Beta-lactamase 0.86
PF03358FMN_red 0.86
PF12200DUF3597 0.43
PF0563523S_rRNA_IVP 0.43
PF06736TMEM175 0.43
PF13336AcetylCoA_hyd_C 0.43
PF00383dCMP_cyt_deam_1 0.43
PF00903Glyoxalase 0.43
PF13646HEAT_2 0.43
PF12796Ank_2 0.43
PF13620CarboxypepD_reg 0.43
PF04226Transgly_assoc 0.43
PF07238PilZ 0.43
PF12543DUF3738 0.43
PF06234TmoB 0.43
PF07676PD40 0.43
PF13508Acetyltransf_7 0.43
PF14326DUF4384 0.43
PF07638Sigma70_ECF 0.43
PF00753Lactamase_B 0.43
PF12704MacB_PCD 0.43
PF12867DinB_2 0.43
PF03625DUF302 0.43

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 232 Family Scaffolds
COG2259Uncharacterized membrane protein YphA, DoxX/SURF4 familyFunction unknown [S] 2.59
COG4270Uncharacterized membrane proteinFunction unknown [S] 2.59
COG1741Redox-sensitive bicupin YhaK, pirin superfamilyGeneral function prediction only [R] 2.16
COG1793ATP-dependent DNA ligaseReplication, recombination and repair [L] 2.16
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 1.29
COG0568DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)Transcription [K] 0.86
COG1191DNA-directed RNA polymerase specialized sigma subunitTranscription [K] 0.86
COG1680CubicO group peptidase, beta-lactamase class C familyDefense mechanisms [V] 0.86
COG1686D-alanyl-D-alanine carboxypeptidaseCell wall/membrane/envelope biogenesis [M] 0.86
COG2353Polyisoprenoid-binding periplasmic protein YceIGeneral function prediction only [R] 0.86
COG2367Beta-lactamase class ADefense mechanisms [V] 0.86
COG4941Predicted RNA polymerase sigma factor, contains C-terminal TPR domainTranscription [K] 0.86
COG2261Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein familyGeneral function prediction only [R] 0.43
COG3439Uncharacterized conserved protein, DUF302 familyFunction unknown [S] 0.43
COG3548Uncharacterized membrane proteinFunction unknown [S] 0.43


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms68.53 %
UnclassifiedrootN/A31.47 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2162886012|MBSR1b_contig_14072657Not Available882Open in IMG/M
3300000033|ICChiseqgaiiDRAFT_c0503306All Organisms → cellular organisms → Bacteria → Acidobacteria681Open in IMG/M
3300000178|FW301_c1026999Not Available701Open in IMG/M
3300000443|F12B_11437221All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium811Open in IMG/M
3300000574|JGI1357J11328_10095476Not Available948Open in IMG/M
3300000956|JGI10216J12902_104433833All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300002070|JGI24750J21931_1054009All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium632Open in IMG/M
3300004153|Ga0063455_100799951All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria652Open in IMG/M
3300004156|Ga0062589_100877481All Organisms → cellular organisms → Bacteria823Open in IMG/M
3300004463|Ga0063356_101448813All Organisms → cellular organisms → Bacteria1014Open in IMG/M
3300004480|Ga0062592_101975695All Organisms → cellular organisms → Bacteria575Open in IMG/M
3300004643|Ga0062591_102434926Not Available549Open in IMG/M
3300004801|Ga0058860_11805694All Organisms → cellular organisms → Bacteria899Open in IMG/M
3300005167|Ga0066672_10794482All Organisms → cellular organisms → Bacteria596Open in IMG/M
3300005288|Ga0065714_10369811Not Available617Open in IMG/M
3300005294|Ga0065705_10107059All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria6034Open in IMG/M
3300005328|Ga0070676_10201930All Organisms → cellular organisms → Bacteria1303Open in IMG/M
3300005330|Ga0070690_100913692All Organisms → cellular organisms → Bacteria → Acidobacteria687Open in IMG/M
3300005332|Ga0066388_108567433Not Available509Open in IMG/M
3300005333|Ga0070677_10458565All Organisms → cellular organisms → Bacteria → Proteobacteria683Open in IMG/M
3300005334|Ga0068869_100986900All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jiangellales → Jiangellaceae → Jiangella → unclassified Jiangella → Jiangella sp. DSM 45060733Open in IMG/M
3300005334|Ga0068869_101513056All Organisms → cellular organisms → Bacteria596Open in IMG/M
3300005339|Ga0070660_101346849All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium606Open in IMG/M
3300005347|Ga0070668_101650048All Organisms → cellular organisms → Bacteria588Open in IMG/M
3300005354|Ga0070675_101417259Not Available641Open in IMG/M
3300005354|Ga0070675_101770318All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium570Open in IMG/M
3300005364|Ga0070673_101548554All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria626Open in IMG/M
3300005365|Ga0070688_100145570All Organisms → cellular organisms → Bacteria → Proteobacteria1614Open in IMG/M
3300005440|Ga0070705_100135411All Organisms → cellular organisms → Bacteria → Proteobacteria1613Open in IMG/M
3300005456|Ga0070678_102128691All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300005459|Ga0068867_101475538All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jiangellales → Jiangellaceae → Jiangella → unclassified Jiangella → Jiangella sp. DSM 45060633Open in IMG/M
3300005466|Ga0070685_11542352Not Available513Open in IMG/M
3300005536|Ga0070697_101261796All Organisms → cellular organisms → Bacteria659Open in IMG/M
3300005543|Ga0070672_100742722All Organisms → cellular organisms → Bacteria861Open in IMG/M
3300005543|Ga0070672_101913357All Organisms → cellular organisms → Bacteria534Open in IMG/M
3300005544|Ga0070686_100877647Not Available728Open in IMG/M
3300005544|Ga0070686_101627709All Organisms → cellular organisms → Bacteria547Open in IMG/M
3300005545|Ga0070695_100327504All Organisms → cellular organisms → Bacteria1141Open in IMG/M
3300005545|Ga0070695_100491944All Organisms → cellular organisms → Bacteria947Open in IMG/M
3300005546|Ga0070696_101324918All Organisms → cellular organisms → Bacteria → Acidobacteria612Open in IMG/M
3300005549|Ga0070704_100231293Not Available1508Open in IMG/M
3300005549|Ga0070704_100671597All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium916Open in IMG/M
3300005549|Ga0070704_101704568All Organisms → cellular organisms → Bacteria582Open in IMG/M
3300005564|Ga0070664_101301969Not Available686Open in IMG/M
3300005564|Ga0070664_102040901Not Available544Open in IMG/M
3300005577|Ga0068857_101217569Not Available729Open in IMG/M
3300005615|Ga0070702_101509284Not Available553Open in IMG/M
3300005615|Ga0070702_101660439All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300005617|Ga0068859_100378499All Organisms → cellular organisms → Bacteria → Acidobacteria1511Open in IMG/M
3300005618|Ga0068864_102572926All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300005718|Ga0068866_10919215All Organisms → cellular organisms → Bacteria617Open in IMG/M
3300005840|Ga0068870_11008448Not Available594Open in IMG/M
3300005843|Ga0068860_101262657Not Available759Open in IMG/M
3300005844|Ga0068862_101248629All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria743Open in IMG/M
3300005985|Ga0081539_10078185Not Available1747Open in IMG/M
3300006196|Ga0075422_10041952All Organisms → cellular organisms → Bacteria1632Open in IMG/M
3300006755|Ga0079222_10955494All Organisms → cellular organisms → Bacteria → Acidobacteria729Open in IMG/M
3300006844|Ga0075428_100078586All Organisms → cellular organisms → Bacteria → Acidobacteria3601Open in IMG/M
3300006844|Ga0075428_100241149All Organisms → cellular organisms → Bacteria → Acidobacteria1950Open in IMG/M
3300006844|Ga0075428_100252834Not Available1899Open in IMG/M
3300006846|Ga0075430_100040121All Organisms → cellular organisms → Bacteria3963Open in IMG/M
3300006852|Ga0075433_11604230All Organisms → cellular organisms → Bacteria561Open in IMG/M
3300006852|Ga0075433_11656745All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium551Open in IMG/M
3300006853|Ga0075420_100635563All Organisms → cellular organisms → Bacteria → Acidobacteria921Open in IMG/M
3300006854|Ga0075425_102059152All Organisms → cellular organisms → Bacteria638Open in IMG/M
3300006854|Ga0075425_102404468Not Available584Open in IMG/M
3300006871|Ga0075434_100084614All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3170Open in IMG/M
3300006880|Ga0075429_100268928All Organisms → cellular organisms → Bacteria1493Open in IMG/M
3300006880|Ga0075429_101032192All Organisms → cellular organisms → Bacteria719Open in IMG/M
3300006894|Ga0079215_10309341All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp.878Open in IMG/M
3300006904|Ga0075424_101220839All Organisms → cellular organisms → Bacteria → Acidobacteria800Open in IMG/M
3300006969|Ga0075419_10033984All Organisms → cellular organisms → Bacteria → Proteobacteria3171Open in IMG/M
3300006969|Ga0075419_10663013All Organisms → cellular organisms → Bacteria737Open in IMG/M
3300007004|Ga0079218_10809564Not Available902Open in IMG/M
3300007004|Ga0079218_11351057All Organisms → cellular organisms → Bacteria756Open in IMG/M
3300007004|Ga0079218_12887323Not Available577Open in IMG/M
3300007076|Ga0075435_100304326All Organisms → cellular organisms → Bacteria1364Open in IMG/M
3300009094|Ga0111539_12123122All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium652Open in IMG/M
3300009100|Ga0075418_11707598Not Available684Open in IMG/M
3300009100|Ga0075418_12573974Not Available555Open in IMG/M
3300009147|Ga0114129_10284338Not Available2209Open in IMG/M
3300009147|Ga0114129_12545206All Organisms → cellular organisms → Bacteria611Open in IMG/M
3300009162|Ga0075423_10069450All Organisms → cellular organisms → Bacteria3655Open in IMG/M
3300009162|Ga0075423_10963837All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium905Open in IMG/M
3300009177|Ga0105248_12766756Not Available560Open in IMG/M
3300009678|Ga0105252_10426080All Organisms → cellular organisms → Bacteria → Acidobacteria609Open in IMG/M
3300010042|Ga0126314_11236869All Organisms → cellular organisms → Bacteria558Open in IMG/M
3300010043|Ga0126380_10479943All Organisms → cellular organisms → Bacteria948Open in IMG/M
3300010047|Ga0126382_11750633All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium582Open in IMG/M
3300010337|Ga0134062_10358299All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium704Open in IMG/M
3300010366|Ga0126379_12156616All Organisms → cellular organisms → Bacteria659Open in IMG/M
3300010373|Ga0134128_12350635All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium587Open in IMG/M
3300010375|Ga0105239_12021044All Organisms → cellular organisms → Bacteria669Open in IMG/M
3300010397|Ga0134124_13021092Not Available514Open in IMG/M
3300010399|Ga0134127_11704305All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jiangellales → Jiangellaceae → Jiangella → unclassified Jiangella → Jiangella sp. DSM 45060705Open in IMG/M
3300010400|Ga0134122_12254371All Organisms → cellular organisms → Bacteria → Acidobacteria589Open in IMG/M
3300010401|Ga0134121_12344129All Organisms → cellular organisms → Bacteria573Open in IMG/M
3300010403|Ga0134123_13214775All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium526Open in IMG/M
3300011119|Ga0105246_11332644Not Available667Open in IMG/M
3300011415|Ga0137325_1117847Not Available606Open in IMG/M
3300011431|Ga0137438_1066500All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1079Open in IMG/M
3300011443|Ga0137457_1131280Not Available820Open in IMG/M
3300011445|Ga0137427_10229668All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_12_FULL_66_21775Open in IMG/M
3300012469|Ga0150984_109833567Not Available853Open in IMG/M
3300012469|Ga0150984_110238228All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → unclassified Eubacteriales → Clostridiales bacterium2001Open in IMG/M
3300012469|Ga0150984_111041166Not Available998Open in IMG/M
3300012898|Ga0157293_10327234Not Available516Open in IMG/M
3300012899|Ga0157299_10047865All Organisms → cellular organisms → Bacteria → Acidobacteria947Open in IMG/M
3300012914|Ga0157297_10392671Not Available553Open in IMG/M
3300012925|Ga0137419_11902002Not Available511Open in IMG/M
3300012944|Ga0137410_10461787All Organisms → cellular organisms → Bacteria1032Open in IMG/M
3300012948|Ga0126375_11520813Not Available573Open in IMG/M
3300013297|Ga0157378_10707130All Organisms → cellular organisms → Bacteria1027Open in IMG/M
3300013297|Ga0157378_11266149All Organisms → cellular organisms → Bacteria778Open in IMG/M
3300013306|Ga0163162_11967168Not Available670Open in IMG/M
3300013306|Ga0163162_12139501All Organisms → cellular organisms → Bacteria642Open in IMG/M
3300013307|Ga0157372_10983137All Organisms → cellular organisms → Bacteria978Open in IMG/M
3300013308|Ga0157375_10449044All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1455Open in IMG/M
3300013308|Ga0157375_12602650All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium604Open in IMG/M
3300014157|Ga0134078_10550889All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium544Open in IMG/M
3300014325|Ga0163163_12281885All Organisms → cellular organisms → Bacteria600Open in IMG/M
3300014326|Ga0157380_10041606All Organisms → cellular organisms → Bacteria3587Open in IMG/M
3300014326|Ga0157380_10075042All Organisms → cellular organisms → Bacteria2747Open in IMG/M
3300014326|Ga0157380_11621556All Organisms → cellular organisms → Bacteria703Open in IMG/M
3300014326|Ga0157380_12027605Not Available637Open in IMG/M
3300014326|Ga0157380_13372771All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300014745|Ga0157377_10063769All Organisms → cellular organisms → Bacteria2111Open in IMG/M
3300014745|Ga0157377_10659588Not Available754Open in IMG/M
3300014745|Ga0157377_11312257All Organisms → cellular organisms → Bacteria566Open in IMG/M
3300015077|Ga0173483_10561488Not Available620Open in IMG/M
3300015200|Ga0173480_10948320Not Available562Open in IMG/M
3300015201|Ga0173478_10065971All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1236Open in IMG/M
3300015245|Ga0137409_10346402All Organisms → cellular organisms → Bacteria1296Open in IMG/M
3300015371|Ga0132258_12977330All Organisms → cellular organisms → Bacteria → Acidobacteria1175Open in IMG/M
3300015371|Ga0132258_13428115All Organisms → cellular organisms → Bacteria → Proteobacteria1088Open in IMG/M
3300015372|Ga0132256_100329059All Organisms → cellular organisms → Bacteria1618Open in IMG/M
3300015372|Ga0132256_101367388All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jiangellales → Jiangellaceae → Jiangella → unclassified Jiangella → Jiangella sp. DSM 45060820Open in IMG/M
3300015373|Ga0132257_100762147All Organisms → cellular organisms → Bacteria1206Open in IMG/M
3300015373|Ga0132257_103317148All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium586Open in IMG/M
3300015374|Ga0132255_100310283All Organisms → cellular organisms → Bacteria2273Open in IMG/M
3300015374|Ga0132255_100964394All Organisms → cellular organisms → Bacteria1278Open in IMG/M
3300015374|Ga0132255_102770236Not Available750Open in IMG/M
3300018067|Ga0184611_1102312Not Available996Open in IMG/M
3300018083|Ga0184628_10155571All Organisms → cellular organisms → Bacteria1190Open in IMG/M
3300018083|Ga0184628_10501900All Organisms → cellular organisms → Bacteria627Open in IMG/M
3300018089|Ga0187774_11179474Not Available547Open in IMG/M
3300018422|Ga0190265_11522257All Organisms → cellular organisms → Bacteria → Acidobacteria782Open in IMG/M
3300018429|Ga0190272_11952306Not Available619Open in IMG/M
3300018476|Ga0190274_10763441All Organisms → cellular organisms → Bacteria1020Open in IMG/M
3300018476|Ga0190274_13405693Not Available536Open in IMG/M
3300019356|Ga0173481_10122164All Organisms → cellular organisms → Bacteria1035Open in IMG/M
3300019362|Ga0173479_10338831Not Available701Open in IMG/M
3300020084|Ga0194110_10434785All Organisms → cellular organisms → Bacteria876Open in IMG/M
3300020221|Ga0194127_10845430All Organisms → cellular organisms → Bacteria561Open in IMG/M
3300021082|Ga0210380_10388546Not Available638Open in IMG/M
3300022880|Ga0247792_1144524Not Available512Open in IMG/M
3300022910|Ga0247768_1231401Not Available557Open in IMG/M
3300023071|Ga0247752_1039874All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium716Open in IMG/M
3300023102|Ga0247754_1069311All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jiangellales → Jiangellaceae → Jiangella → unclassified Jiangella → Jiangella sp. DSM 45060832Open in IMG/M
3300025310|Ga0209172_10125499All Organisms → cellular organisms → Bacteria1436Open in IMG/M
3300025315|Ga0207697_10457302Not Available566Open in IMG/M
3300025903|Ga0207680_10011316All Organisms → cellular organisms → Bacteria4504Open in IMG/M
3300025903|Ga0207680_11156204All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium552Open in IMG/M
3300025907|Ga0207645_11084919All Organisms → cellular organisms → Bacteria540Open in IMG/M
3300025920|Ga0207649_11484593Not Available537Open in IMG/M
3300025923|Ga0207681_10436226All Organisms → cellular organisms → Bacteria → Proteobacteria1063Open in IMG/M
3300025923|Ga0207681_10625006All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia892Open in IMG/M
3300025926|Ga0207659_10228776All Organisms → cellular organisms → Bacteria1499Open in IMG/M
3300025926|Ga0207659_11556591All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium565Open in IMG/M
3300025930|Ga0207701_10606894Not Available931Open in IMG/M
3300025932|Ga0207690_11716065All Organisms → cellular organisms → Bacteria524Open in IMG/M
3300025934|Ga0207686_11660979All Organisms → cellular organisms → Bacteria528Open in IMG/M
3300025940|Ga0207691_11144707All Organisms → cellular organisms → Bacteria → Proteobacteria646Open in IMG/M
3300025942|Ga0207689_11119494All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jiangellales → Jiangellaceae → Jiangella → unclassified Jiangella → Jiangella sp. DSM 45060663Open in IMG/M
3300025945|Ga0207679_10160416Not Available1841Open in IMG/M
3300025945|Ga0207679_11158449Not Available709Open in IMG/M
3300025960|Ga0207651_11963655Not Available526Open in IMG/M
3300025961|Ga0207712_11147963Not Available692Open in IMG/M
3300025972|Ga0207668_11330282All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jiangellales → Jiangellaceae → Jiangella → unclassified Jiangella → Jiangella sp. DSM 45060647Open in IMG/M
3300025981|Ga0207640_10819987All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium807Open in IMG/M
3300026089|Ga0207648_11570969Not Available618Open in IMG/M
3300026116|Ga0207674_10224821Not Available1825Open in IMG/M
3300026118|Ga0207675_102582527Not Available518Open in IMG/M
3300026121|Ga0207683_10552936All Organisms → cellular organisms → Bacteria1064Open in IMG/M
3300026121|Ga0207683_11390951All Organisms → cellular organisms → Bacteria → Acidobacteria649Open in IMG/M
3300026285|Ga0209438_1151058All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium611Open in IMG/M
3300027876|Ga0209974_10074778All Organisms → cellular organisms → Bacteria → Acidobacteria1159Open in IMG/M
3300027882|Ga0209590_10715011All Organisms → cellular organisms → Bacteria640Open in IMG/M
3300027886|Ga0209486_10594794All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_12_FULL_66_21701Open in IMG/M
3300028381|Ga0268264_10006355All Organisms → cellular organisms → Bacteria9958Open in IMG/M
3300028608|Ga0247819_10613565All Organisms → cellular organisms → Bacteria → Acidobacteria656Open in IMG/M
3300028812|Ga0247825_10656769Not Available753Open in IMG/M
3300028812|Ga0247825_10782982Not Available688Open in IMG/M
3300028812|Ga0247825_11045284Not Available594Open in IMG/M
3300028889|Ga0247827_10692593All Organisms → cellular organisms → Bacteria → Acidobacteria663Open in IMG/M
3300031538|Ga0310888_10164225All Organisms → cellular organisms → Bacteria → Acidobacteria1195Open in IMG/M
3300031538|Ga0310888_10645825All Organisms → cellular organisms → Bacteria → Acidobacteria645Open in IMG/M
3300031547|Ga0310887_10500859All Organisms → cellular organisms → Bacteria → Acidobacteria731Open in IMG/M
3300031562|Ga0310886_10072282All Organisms → cellular organisms → Bacteria1638Open in IMG/M
3300031562|Ga0310886_11004281All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium535Open in IMG/M
3300031716|Ga0310813_10885167Not Available808Open in IMG/M
3300031731|Ga0307405_11511497All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium590Open in IMG/M
3300031731|Ga0307405_12119506Not Available505Open in IMG/M
3300031854|Ga0310904_11031882All Organisms → cellular organisms → Bacteria → Acidobacteria587Open in IMG/M
3300031854|Ga0310904_11185735Not Available550Open in IMG/M
3300031858|Ga0310892_10150815All Organisms → cellular organisms → Bacteria → Acidobacteria1348Open in IMG/M
3300031858|Ga0310892_10319091All Organisms → cellular organisms → Bacteria → Acidobacteria986Open in IMG/M
3300031901|Ga0307406_10838684Not Available778Open in IMG/M
3300031901|Ga0307406_11348417Not Available624Open in IMG/M
3300031908|Ga0310900_11236074Not Available622Open in IMG/M
3300031938|Ga0308175_101571799All Organisms → cellular organisms → Bacteria → Acidobacteria735Open in IMG/M
3300031939|Ga0308174_10826700Not Available779Open in IMG/M
3300031940|Ga0310901_10023982All Organisms → cellular organisms → Bacteria1801Open in IMG/M
3300031940|Ga0310901_10515441Not Available538Open in IMG/M
3300031943|Ga0310885_10201452All Organisms → cellular organisms → Bacteria984Open in IMG/M
3300031943|Ga0310885_10710443Not Available565Open in IMG/M
3300031944|Ga0310884_10156101All Organisms → cellular organisms → Bacteria → Acidobacteria1182Open in IMG/M
3300032002|Ga0307416_100448406Not Available1342Open in IMG/M
3300032012|Ga0310902_10581042All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jiangellales → Jiangellaceae → Jiangella → unclassified Jiangella → Jiangella sp. DSM 45060741Open in IMG/M
3300032013|Ga0310906_10016977All Organisms → cellular organisms → Bacteria2996Open in IMG/M
3300032017|Ga0310899_10550097All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium572Open in IMG/M
3300032075|Ga0310890_10036375All Organisms → cellular organisms → Bacteria2705Open in IMG/M
3300032126|Ga0307415_100024227All Organisms → cellular organisms → Bacteria3785Open in IMG/M
3300032157|Ga0315912_11672584All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jiangellales → Jiangellaceae → Jiangella → unclassified Jiangella → Jiangella sp. DSM 45060500Open in IMG/M
3300032179|Ga0310889_10679342Not Available536Open in IMG/M
3300032180|Ga0307471_100025970All Organisms → cellular organisms → Bacteria → Proteobacteria4411Open in IMG/M
3300032180|Ga0307471_100125748All Organisms → cellular organisms → Bacteria2402Open in IMG/M
3300032180|Ga0307471_104007388All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium520Open in IMG/M
3300032211|Ga0310896_10037638All Organisms → cellular organisms → Bacteria1869Open in IMG/M
3300033551|Ga0247830_10304600All Organisms → cellular organisms → Bacteria1222Open in IMG/M
3300033551|Ga0247830_10527663All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jiangellales → Jiangellaceae → Jiangella → unclassified Jiangella → Jiangella sp. DSM 45060930Open in IMG/M
3300034150|Ga0364933_020532All Organisms → cellular organisms → Bacteria1581Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil12.93%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere10.34%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil6.03%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.31%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere4.31%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere3.45%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere3.02%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere3.02%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere3.02%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere3.02%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.59%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.59%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.59%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere2.59%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil2.16%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere2.16%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere2.16%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.72%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.72%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.29%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.29%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.29%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.29%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.29%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.29%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere1.29%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere1.29%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.86%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.86%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.86%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere0.86%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.86%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.86%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.86%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.86%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.86%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.86%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.43%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater0.43%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater0.43%
Hot Spring SedimentEnvironmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment0.43%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.43%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.43%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.43%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.43%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.43%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.43%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.43%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.43%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated0.43%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.43%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.43%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.43%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.43%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2162886012Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1Host-AssociatedOpen in IMG/M
3300000033Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000178Pristine groundwater from Oak Ridge Integrated Field Research Center, Tennessee (resequenced)EnvironmentalOpen in IMG/M
3300000443Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.2B clc assemlyEnvironmentalOpen in IMG/M
3300000574Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 mEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300002070Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4Host-AssociatedOpen in IMG/M
3300004153Grasslands soil microbial communities from Hopland, California, USA (version 2)EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300004801Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300005167Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121EnvironmentalOpen in IMG/M
3300005288Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1Host-AssociatedOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005333Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaGHost-AssociatedOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005339Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaGHost-AssociatedOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005365Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaGEnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005466Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005840Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300005985Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2Host-AssociatedOpen in IMG/M
3300006196Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1Host-AssociatedOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300006894Agricultural soil microbial communities from Utah to study Nitrogen management - NC ControlEnvironmentalOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009678Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100EnvironmentalOpen in IMG/M
3300010042Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105BEnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010337Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300011415Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT469_2EnvironmentalOpen in IMG/M
3300011431Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT157_2EnvironmentalOpen in IMG/M
3300011443Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT630_2EnvironmentalOpen in IMG/M
3300011445Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT700_2EnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012898Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1EnvironmentalOpen in IMG/M
3300012899Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2EnvironmentalOpen in IMG/M
3300012914Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2EnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014157Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300015077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)EnvironmentalOpen in IMG/M
3300015200Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2)EnvironmentalOpen in IMG/M
3300015201Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2)EnvironmentalOpen in IMG/M
3300015245Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300018067Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coexEnvironmentalOpen in IMG/M
3300018083Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1EnvironmentalOpen in IMG/M
3300018089Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300020084Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015032 Kigoma Deep Cast 1200mEnvironmentalOpen in IMG/M
3300020221Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015036 Kigoma Deep Cast 100mEnvironmentalOpen in IMG/M
3300021082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redoEnvironmentalOpen in IMG/M
3300022880Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S106-311C-6EnvironmentalOpen in IMG/M
3300022910Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L016-104C-6EnvironmentalOpen in IMG/M
3300023071Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S019-104C-5EnvironmentalOpen in IMG/M
3300023102Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S184-509B-5EnvironmentalOpen in IMG/M
3300025310Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025315Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)Host-AssociatedOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025907Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026285Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300027876Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027886Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes)EnvironmentalOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028608Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Xylose_Day6EnvironmentalOpen in IMG/M
3300028812Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48EnvironmentalOpen in IMG/M
3300028889Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2EnvironmentalOpen in IMG/M
3300031538Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1EnvironmentalOpen in IMG/M
3300031547Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4EnvironmentalOpen in IMG/M
3300031562Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031731Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1Host-AssociatedOpen in IMG/M
3300031854Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1EnvironmentalOpen in IMG/M
3300031858Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2EnvironmentalOpen in IMG/M
3300031901Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2Host-AssociatedOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031939Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2EnvironmentalOpen in IMG/M
3300031940Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2EnvironmentalOpen in IMG/M
3300031943Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2EnvironmentalOpen in IMG/M
3300031944Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1EnvironmentalOpen in IMG/M
3300032002Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3Host-AssociatedOpen in IMG/M
3300032012Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3EnvironmentalOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300032017Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4EnvironmentalOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300032126Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2Host-AssociatedOpen in IMG/M
3300032157Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soilEnvironmentalOpen in IMG/M
3300032179Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032211Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1EnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M
3300034150Sediment microbial communities from East River floodplain, Colorado, United States - 25_j17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
MBSR1b_0374.000050202162886012Miscanthus RhizosphereIVYLRGVPVSAMEGDMLRVLAPVDAAMAPLVAAAAAGRRVPVLSGYVGRI
ICChiseqgaiiDRAFT_050330613300000033SoilRIRAAASSRLVYRNGVPVMAMEGDMLRTLADVGPDVLADAAAIAAGRRVPVSHGYVGRLST*
FW301_102699923300000178GroundwaterLRMLDEVDPAIASDVAAAAAGRRVPVLSGYVGRIG*
F12B_1143722123300000443SoilERDMLRTFAEVDPAIAADVAAAAAGRSVPVFSGYVGRTS*
JGI1357J11328_1009547643300000574GroundwaterRVLSQVDPEVAAAAAAAAAGRRVPVVSGYVGRIG*
JGI10216J12902_10443383323300000956SoilIAALEGDMLRTLAVVDAEIAEHAAAAAAGRRVPVVSGWVGRV*
JGI24750J21931_105400913300002070Corn, Switchgrass And Miscanthus RhizosphereNGIPLAALEGDMLRTFAEVDPAIAADVAAAAAGRRVPVFSGYVGRTS*
Ga0063455_10079995123300004153SoilGDRIRSSTGTRIVYRNGVVLAAMEGDMLRMLAPLAPDDATRVAAAAAGRRVPVISGYVGRVGR*
Ga0062589_10087748113300004156SoilAMEGDMLRTFGDLEPELAADAAAAAAGRRVPVISGFVGRL*
Ga0063356_10144881313300004463Arabidopsis Thaliana RhizosphereRDGVPLAAMEGDVARELTAIDPAIAGDVARALRRRRVPALLR*
Ga0062592_10197569523300004480SoilGTRIVYRNGVVLAAMEGDMLRMLAPLEGEDAAQVAAVAAGRRVPVISGYVGRFGR*
Ga0062591_10243492613300004643SoilVMAMEGDMLRTLADVDAPILADAAALAAGRRVPVSNGYVGRIWP*
Ga0058860_1180569443300004801Host-AssociatedANRIVYRNGVPVAAMEGDLLRTFGDLEPELAADAAAAAAGRRVPVISGFVGR*
Ga0066672_1079448213300005167SoilRVVYRNGVAVAAMEGDMLRTFGDLDPEIAADAAAAAAGRRVPVVSGYVGRL*
Ga0065714_1036981113300005288Miscanthus RhizosphereVPVAALEGDMLRTFGEIDPTIAAEVAAAAAGRRVPVLSGFVGRLG*
Ga0065705_1010705913300005294Switchgrass RhizosphereLGDRIRAAASSRIVYRNGVPIMAMEGDMLRTLADADATVLADAAAIAAGRRVPVSHGYVGRIWP*
Ga0070676_1020193033300005328Miscanthus RhizosphereNRIVYRNGVPVAALEGDMLRTFGEIDPTIAAEVAAAAAGRRVPVLSGFVGRLG*
Ga0070690_10091369223300005330Switchgrass RhizosphereGDMLRTLADADATVLADAAAIAAGRRVPVSHGYVGRIWP*
Ga0066388_10856743323300005332Tropical Forest SoilLEGDMLRTLGEIDPSIAADVAAAAAGRRVPVVNGYVGRLGT*
Ga0070677_1045856513300005333Miscanthus RhizosphereTGIVTLGDRIRAAASSRVVYRNGIPIMAMEGDMLRPLADVDATVLADAAALAAGRRVPVSNGYVGRIWP*
Ga0068869_10098690023300005334Miscanthus RhizosphereALEGDMLRTLGEIDPSIAADVAAAAAGRRVPVLSGFVGRLGSW*
Ga0068869_10151305613300005334Miscanthus RhizosphereERIRASAANRIVYRSGVPVAAMEGDMLRTFGDLEPELAADAAAAAAGRRVPVISGFVGRL
Ga0070660_10134684913300005339Corn RhizosphereYRNGVPLAALEGDMLRTFGEIEPSIAADVAAAAAGRPVPVLSGFVGRLG*
Ga0070668_10165004823300005347Switchgrass RhizosphereVVLAAMEGDMLRMLAPLEGEDAANVGAAAAGRRVPVISGYVGRFGR*
Ga0070675_10141725923300005354Miscanthus RhizosphereVLAAMEGDMLRMLAPLEGEDAAQVAAVAAGRRVPVISGYVGRFGR*
Ga0070675_10177031813300005354Miscanthus RhizosphereYLRGVPVSAMEGDMLRVLADVDPAIAPTVAAAAAGRRVPVLSGYVGRI*
Ga0070673_10154855413300005364Switchgrass RhizosphereGEERIRASAANRIVYRNGVPVAAMEGDLLRTFGDLEPDLAADAAAAAAGRRVPVISGYVGRL*
Ga0070688_10014557053300005365Switchgrass RhizosphereGEERIRASAANRIVYRNGMPVAAMEGDMLRTFGDLEPDLAADAAAAAAGRRVPVISGFVGRL*
Ga0070705_10013541153300005440Corn, Switchgrass And Miscanthus RhizosphereIRASAANRIVYRNGMPVAAMEGDMLRTFGDLEPDLAADAAAAAAGRRVPVISGFVGRL*
Ga0070678_10212869123300005456Miscanthus RhizosphereGILTNGERIRTSVSARVVYRNGTAVAAMEGDMLRMLQPLDPIDAAAAAGAAAGRRVPVVNGYVGRVR*
Ga0068867_10147553813300005459Miscanthus RhizosphereYRNGVPVAALEGDMLRTLGEIDPSIAADVAAAAAGRRVPVLSGFVGRLG*
Ga0070685_1154235213300005466Switchgrass RhizosphereGIPVMAMEGDMLRTLADADATVLADAAAIAAGRRVPVSHGYVGRIWP*
Ga0070697_10126179633300005536Corn, Switchgrass And Miscanthus RhizosphereIRASASTRLVYRNGVPVAAMEGDMLRTFGNLDREIASEAAAAAAGRRVPVISGFVGRI*
Ga0070672_10074272223300005543Miscanthus RhizosphereSAGNRIRASVGTRLVYRNGVVLAAMEGDMLRMLAPLEGEDAASVAAAAAGRRVPVIRGYVGRFGR*
Ga0070672_10191335713300005543Miscanthus RhizosphereSATNRVVYRNGLPVAAMEGDLLRTFAELDPDLAADAAAAAAGRRVPVIRGFVGRM*
Ga0070686_10087764713300005544Switchgrass RhizosphereVVLAAMEGDMLRMLAPLEGEDAAQVAAVAAGRRVPVISGYVGRFGR*
Ga0070686_10162770913300005544Switchgrass RhizosphereVAAMEGDMLRTFGDLEPDLAADAAAAAAGRRVPVISGFVGRL*
Ga0070695_10032750453300005545Corn, Switchgrass And Miscanthus RhizosphereTGIITGDERIRASASTRLVYRNGTAVAAMEGDMLRTFGDLAPEIAADAAAAAAGRRVPVIAGYVGRL*
Ga0070695_10049194443300005545Corn, Switchgrass And Miscanthus RhizosphereGEERIRASASTRLVYRNGVPVAAMEGDMLRTFGNLDREIASEAAAAAAGRRVPVISGFVGRI*
Ga0070696_10132491823300005546Corn, Switchgrass And Miscanthus RhizosphereYRDGVPIMAMEGDMLRTLADADATVLADAAAIAAGRRVPVSHGYVGRIWP*
Ga0070704_10023129313300005549Corn, Switchgrass And Miscanthus RhizosphereRLRTVASNRIVYLRGVPVSAMEGDMLRVLAPVDAAMAPLVAAAAAGRRVPVLSGYVGRI*
Ga0070704_10067159723300005549Corn, Switchgrass And Miscanthus RhizosphereAGNRIVYRNGVPLAALEGDMLRTFGEIEPSIAADVAAAAAGRPVPVLSGFVGRLG*
Ga0070704_10170456833300005549Corn, Switchgrass And Miscanthus RhizosphereAAMEGDMLRTFCDLDAETAADAAAAAAGRRVPVISGFVGRL*
Ga0070664_10130196913300005564Corn RhizosphereTLGEIDPSIAADVAAAAAGRRVPVLSGFVGRLGSW*
Ga0070664_10204090123300005564Corn RhizosphereEGDMLRCLSPVDGAIAERAAAAAAGRRVPVLSGYVGRR*
Ga0068857_10121756923300005577Corn RhizosphereVSAMEGDMLRVLAPVDAAMAPLIAAAAAGRRVPVLSGYVGRI*
Ga0070702_10150928423300005615Corn, Switchgrass And Miscanthus RhizosphereGIPVMAMEGDMLRTLADVDAPILADAAALAAGRRVPVSNGYVGRIWP*
Ga0070702_10166043913300005615Corn, Switchgrass And Miscanthus RhizosphereNGIPVAAMEGDMLRTFCDLDAETAADAAAAAAGRRVPVISGFVGRL*
Ga0068859_10037849923300005617Switchgrass RhizosphereSRIVYRNGVPIMAMEGDMLRTLADADATVLADAAAIAAGRRVPVSHGYVGRIWP*
Ga0068864_10257292623300005618Switchgrass RhizosphereSSGDRIRVATATRIVYKNGVPVAAMEGDMLRMFAAFDGVTAAAVAAAAAGRRVPVTSGYVGRVSR*
Ga0068866_1091921513300005718Miscanthus RhizosphereAAGNRIVYRNGVPVAALEGDMLRTFGEIDPTIAAEVAAAAAGRRVPVLSGFVGRLG*
Ga0068870_1100844823300005840Miscanthus RhizosphereIVFHRGVAVCALEGDMLRTLSPVDDSIAADVAAAAAGRRVPVLSGWVGRI*
Ga0068860_10126265723300005843Switchgrass RhizosphereGDMLRTFGEIDPTIAAEVAAAAAGRRVPVLSGFVGRLG*
Ga0068862_10124862923300005844Switchgrass RhizosphereGDRIRAAASSRVVYRNGIPVMAMEGDMLRTLADVDAPILADAAALAAGRRVPVSNGYVGRIWP*
Ga0081539_1007818513300005985Tabebuia Heterophylla RhizosphereVYRNGVPLAAMEGDMLRTLGEIDPAIALDVAAAAAGRRVPVVSGYVGRLG*
Ga0075422_1004195243300006196Populus RhizosphereGIPLAALEGDMLRTFAEVDPAIAADVAAAAAGRRVPVFSGYVGRTS*
Ga0079222_1095549423300006755Agricultural SoilRIVYRNGIPLMAMEGDMLRTLADADASVLADAATLAARRRVPVVHGYVGRIWP*
Ga0075428_10007858653300006844Populus RhizosphereMEGDMLRTINAVDRGIAADVAALAAGRRVPVLSGYVGRLL*
Ga0075428_10024114943300006844Populus RhizosphereTRIVYRNGVPVAAMEGDLLRTFGTLDAETAADAAAAAAGRRVPVVSGFVGRV*
Ga0075428_10025283413300006844Populus RhizosphereIITPGDRIRTAAASRVVYLRGVPVSAMEGDMLRILAPVDPELAPVVAAAAAGRRVPVLSGYVGRKG*
Ga0075430_10004012113300006846Populus RhizosphereRNGVPLAALEGDMLRTLGDIDPSIAADVAAAAAGRRVPVVNGYVGRLAT*
Ga0075433_1160423013300006852Populus RhizosphereIVYRNGIPVAAMEGDMLRTFCDLDAETAADAAAAAAGRRVPVISGFVGRL*
Ga0075433_1165674513300006852Populus RhizosphereIVYRNGVPLAALEGDMLRTLGDIDPSIAADVAAAAAGRRVPVVSGYVGRLG*
Ga0075420_10063556323300006853Populus RhizosphereRIVYRNGIPIMAMEGDMLRTLADADATVLADAAAIAAGRRVPVSHGYVGRIWP*
Ga0075425_10205915233300006854Populus RhizosphereRASASTRLVYRNGVPVAAMEGDMLRTFGNLDRDVASEAAAAAAGRRVPVISGFVGRI*
Ga0075425_10240446833300006854Populus RhizosphereNRIVYLRGVPVSAMEGDMLRVLAPVDAAMAPLVAAAAAGRRVPVLSGYVGRI*
Ga0075434_10008461473300006871Populus RhizosphereERIRASASTRLVYRNGVPVAAMEGDMLRTFGNLDRDIASEAAAAAAGRRVPVISGFVGRI
Ga0075429_10026892843300006880Populus RhizosphereAAMEGDLLRTFGDLEPELAAEAAAAAAGRRVPVISGFVGRL*
Ga0075429_10103219223300006880Populus RhizosphereASGNRVVYRNGVPVAAMEGDMLRTLAELEPAIAVEAAAAAAGRRVPVLSGYVGRLG*
Ga0079215_1030934123300006894Agricultural SoilYLHGVPVSAMEGDMLRVLAPVEAARAAAVAEAAAGRRVPVVSGYVGRK*
Ga0075424_10122083913300006904Populus RhizosphereMEGDLLRTFGNLDADAAAAAAGRRVPVISGFVGRLY*
Ga0075419_1003398413300006969Populus RhizosphereAMEGDVLRRLAEVDPAVAAEAAAAAAGRRVPAFSGYVGRLG*
Ga0075419_1066301313300006969Populus RhizosphereRASAANRIVYRNGVPVAAMEGDLLRTFGDLEPELAAEAAAAAAGRRVPVISGFVGRL*
Ga0079218_1080956423300007004Agricultural SoilYRNGIPIAAMEGDMLRTLSDMAPSVAAEAAAAAAGRRVPVVTGYVGRVSS*
Ga0079218_1135105723300007004Agricultural SoilDRIRTATSNRIVYLRGVPVSAMEGDMLRVLAPVDASVAAAVAEAAAGRRVPVMSGYVGRLSG*
Ga0079218_1288732323300007004Agricultural SoilYLRGVPVSAMEGDMLRVLAPVDASVATAVAEAAAGRRVPVLSGYVGRLSG*
Ga0075435_10030432643300007076Populus RhizosphereRIVYRNGIPVATMEGDMLRTFGDLDAETAADAAAAAAGRRVPVISGFVGRL*
Ga0111539_1212312213300009094Populus RhizosphereDMLRLLAAVDAGLAPDVAAAAAGRRVPVVTGFVGRLRN*
Ga0075418_1170759823300009100Populus RhizosphereVVYRNGVPVAAMEGDMLRTLAELEPEVAAEAAAAAAGRRVPVLSGYVGRLG*
Ga0075418_1257397423300009100Populus RhizosphereAMEGDMLRTINAVDRGIAADVAALAAGRRVPVVSGYVGRIR*
Ga0114129_1028433813300009147Populus RhizosphereDLLRTFGDLEPELAADAAAAAAGRRVPVISGFVGRL*
Ga0114129_1254520633300009147Populus RhizosphereAMEGDMLRTFGDLEPDLAADAAAAAAGRRVPVISGFVGRL*
Ga0075423_1006945013300009162Populus RhizosphereDMLRTFGDLNPALAADAAAAAAGRRVPVISGFVGRV*
Ga0075423_1096383713300009162Populus RhizosphereMECDMLRQLRDLDAETAAEAAAAAAGRRVPVVSGYVGRLAT*
Ga0105248_1276675623300009177Switchgrass RhizosphereYRNGVPVAALEGDMLRTFGEIDPTIAAEVAAAAAGRRVPVLSGFVGRLG*
Ga0105252_1042608013300009678SoilTLADIDPDVAGDAAALAAGRRVPVSSGYVGRLHT*
Ga0126314_1123686913300010042Serpentine SoilNLTGIITDGDRIRTSTSSRIVYRNGVALAAMEGDMLRMLAAALEPGDAANVAAAAAGRRVPVVSGYVGRVR*
Ga0126380_1047994313300010043Tropical Forest SoilIRASAANRIVYRNGVPVAAMEGDLLRTFGDLEPELAADAAAAAAGRRVPVISGFVGRL*
Ga0126382_1175063323300010047Tropical Forest SoilPLAALEGDMLRTLGDIDPAIAADVAAAAAGRRVPVLSGYVGRLG*
Ga0134062_1035829913300010337Grasslands SoilVMVAAMEGDMLRTFGDLDAEAAADAAASAAGCRVPVISGFVGRL*
Ga0126379_1215661613300010366Tropical Forest SoilRNGVPVAAMEGDLLRTFAELEPELAADAAAAAAGRRVPVISGFVGRLQPS*
Ga0134128_1235063523300010373Terrestrial SoilGVPLAALEGDMLRTLGEIEPSIAADVAAAAAGRRVPVLSGYVGRSG*
Ga0105239_1202104413300010375Corn RhizosphereSAANRIVYRNGMPVAAMEGDMLRTFGDLEPDLAADAAAAAAGRRVPVISGFVGRL*
Ga0134124_1302109223300010397Terrestrial SoilVPLAAMEGDMLRMLTTVDPAIAADVAAAAAGRRVPVLSGYVGRIQ*
Ga0134127_1170430513300010399Terrestrial SoilNRIVYRNGVPVAALEGDMLRTLGEIDPSIAADVAAAAAGRRVPVLSGFVGRLGSW*
Ga0134122_1225437113300010400Terrestrial SoilTGDARVRASAANRVVYRNGLPVAAMEGDLLRTFAELDPDLAADAAAAAAGRRVPVLSGFVGRL*
Ga0134121_1234412913300010401Terrestrial SoilMEGDMLRMLGELDPATAADAAAAAAGRRVPVVSGYVGRV*
Ga0134123_1321477513300010403Terrestrial SoilRVASGNRVVYRNGVPVAAMEGDMLRTLAELEPAIAVEAAAAAAGRRVPVLSGYVGRLG*
Ga0105246_1133264413300011119Miscanthus RhizosphereIVDRNGVPLAAMEGDMLRMLTTVDPAIASDVAAAAAGRRVPVLSGYVGRLS*
Ga0137325_111784713300011415SoilAAGNRIVYRNGVPLAALEGDMLRTLGDIDPTIAADVAAAAAGRRVPVLSGFVGRLG*
Ga0137438_106650053300011431SoilEGDILRTFGDLDPEVAADAAAAAAGRRVPVVTGYVGRL*
Ga0137457_113128013300011443SoilISAADPLNLTGVLSDERVRVSTASRIVYRNGVALAAMEGDMLRTMGVVDPAIASEVAAAAAGRRVPVVRGYVGRIG*
Ga0137427_1022966823300011445SoilGNRIVYRNGVPLAAMEGDMLRTLSELEPAVAAEAAAAAAGRRVPVLSGYVGRLG*
Ga0150984_10983356723300012469Avena Fatua RhizosphereAAMEGDNLRMLGALDAETAADAAAVAAGRRVPVVSGYVGRR*
Ga0150984_11023822813300012469Avena Fatua RhizosphereHLIFTGVATTGDRIRTSSGTRIVYRNGVAVTAMEGDMLRMLAPLQGDEAARAAAAATGRRVPVVSGYVGRFGR*
Ga0150984_11104116623300012469Avena Fatua RhizosphereRSSAATRIVYRNGIVLAAMEGDMLRMLVPLESADAARVATAVAGRRVPVVSGYVGRVNR*
Ga0157293_1032723423300012898SoilIVTVGVRLRTVASNRIVYLRGVPVSAMEGDMLRVLAPVDAAMAPLIAAAAAGRRVPVLSGYVGRI*
Ga0157299_1004786523300012899SoilMEGDMLRTLADVDAPILADAAALAAGRRVPVSNGYVGSIWP*
Ga0157297_1039267123300012914SoilGDRLRTVASNRIVYLRGVPVSAMEGDMLRVLAPVDAAMGPLIAAAAAGRRVPVLSGYVGRI*
Ga0137419_1190200223300012925Vadose Zone SoilSASARIVYRNGVPVAAMEGDMLRAFGDLDAHAAADAAAAAAGRRVPVVSGFVGRL*
Ga0137410_1046178743300012944Vadose Zone SoilVPVAAMEGDMLRRFGNLDAESAAEAAAAAAGRRVPVVSGFVGRL*
Ga0126375_1152081313300012948Tropical Forest SoilLRTLAAIDPALAADAAAAAAGRRVPVVSGFVGRI*
Ga0157378_1070713043300013297Miscanthus RhizosphereAANRIVYRNGVPVAAMEGDLLRTFGDLEPELAADAAAAAAGRRVPVISGFVGRL*
Ga0157378_1126614923300013297Miscanthus RhizosphereLEGETLRMLAEVDPAIAPDVAAAAAGRRVPVLSGFVGRVS*
Ga0163162_1196716813300013306Switchgrass RhizosphereRIRTSSGTRLVYRNGVVLAAMEGDMLRMLAPLEGEDAASVAAAAAGRRVPVIRGYVGRFGR*
Ga0163162_1213950123300013306Switchgrass RhizosphereSDRIRSAASTRIVYRNGVVVAAMEGDMLRMLAPLEGEDAAHVAAAAAGRRVPVVSGYVGRSAR*
Ga0157372_1098313713300013307Corn RhizosphereTSTGTRIVYRNGVVLAAMVGDMLRMLAPLEGEDAAQVAAVAAGRRVPVISGYVGRFGR*
Ga0157375_1044904433300013308Miscanthus RhizosphereAALEGDMLRTFAEVDPAIAADVAAAAAGRRVPVFSGYVGRTS*
Ga0157375_1260265013300013308Miscanthus RhizosphereGDMLRMLTDIDPAIAADVAAAAAGRRVPVLKGFVGRMR*
Ga0134078_1055088933300014157Grasslands SoilRNGVAVAAMEGDMLRTFGNLDPGVAADAAAAAAGRRVPVVAGYVGRL*
Ga0163163_1228188513300014325Switchgrass RhizosphereGVVLAAMEGDMLRMLAPLEGEDAAQVAAVAAGRRVPVISGYVGRFGR*
Ga0157380_1004160613300014326Switchgrass RhizosphereNGIPLAALEGDMLRTFAEVDPAIAADVAAAAAGRRVPVFSVYVGRTS*
Ga0157380_1007504253300014326Switchgrass RhizosphereATGNRVVYRNGVPVAAMEGDMLRTLAELEPATALEAAAAAAGRRVPVLSGYVGRLG*
Ga0157380_1162155613300014326Switchgrass RhizosphereAANRIVYRNGVPVAAMEGDLLRTFGNLEPELAADAAAAAAGRRVPVISGFVGR*
Ga0157380_1202760513300014326Switchgrass RhizosphereDMLRVLADVDPAIAPTVAAAAAGRRVPVLSGYVGRI*
Ga0157380_1337277133300014326Switchgrass RhizosphereVAAMEGDMLRTFGDHEPELAADAAAAAAGRRVPVISGFVGRL*
Ga0157377_1006376913300014745Miscanthus RhizospherePLAALEGDMLRTFAEVDPAIAADVAAAAAGRRVPVFSGYVGRTS*
Ga0157377_1065958823300014745Miscanthus RhizosphereVGTRLVYRNGVVLAAMEGDMLRMLAPLEGEDAASVAAAAAGRRVPVIRGYVGRFGR*
Ga0157377_1131225733300014745Miscanthus RhizosphereRVRASGANRVVYRNGVPVAAMEGDLLRTFAELEPELAADAAAAAAGRRVPVISGFVGRL*
Ga0173483_1056148823300015077SoilILSTGERIRTSTGTRIVYRNGVVLAAMEGDMLRMLAPLEGEDAAQVAAVAAGRRVPVISGYVGRFGR*
Ga0173480_1094832013300015200SoilSTGERIRTSTGTRIVYRNGVVLAAMEGDMLRMLAPLEGEDAAQVAAVAAGRRVPVISGYVGRFGR*
Ga0173478_1006597133300015201SoilDLLRSFGDLEPELAADAAAAAAGRRVPVISGFVGRL*
Ga0137409_1034640213300015245Vadose Zone SoilASTRVVYRNGVPVAAMEGDMLRRFGNLDAESAAEAAAAAAGRRVPVVSGFVGRL*
Ga0132258_1297733013300015371Arabidopsis RhizosphereGDMLRTLADVDAAVLADAAAIAAGRRVPVSQGYVGRIWP*
Ga0132258_1342811513300015371Arabidopsis RhizosphereALEGDMLQTFGEIDPSIAADVAAAAAGRRVPVLSGFVGRLG*
Ga0132256_10032905933300015372Arabidopsis RhizospherePLAALEGDMLRTLGEIDPAIAADVAAAAAGRRVPVLSGYVGRLGT*
Ga0132256_10136738813300015372Arabidopsis RhizospherePVAALEGDMLRTFGEIDPSIAADVAAAAAGRRVPVLSGFVGRLG*
Ga0132257_10076214733300015373Arabidopsis RhizosphereVYRNGVVLAAMEGDMLRMLAPLEGEDAASVAAAAAGRRVPVIRGYVGRFGR*
Ga0132257_10331714813300015373Arabidopsis RhizosphereMLRTLGEIDPAIAADVAAAAAGRRVPVLSGYVGRLGT*
Ga0132255_10031028313300015374Arabidopsis RhizosphereSSSSRLVYRNGVPVAVMEGDMLRTLVELEPSIASDVAAAAAGRRVPVINGYVGRVS*
Ga0132255_10096439433300015374Arabidopsis RhizosphereAALEGDMLRTFGEIDPSIAADVAAAAAGRRVPVLSGFVGRLG*
Ga0132255_10277023623300015374Arabidopsis RhizosphereVYLRGVPVSAMEGDMLRVLAPVDPSIAPIVAAAAAGRRVPVFSGYVGRI*
Ga0184611_110231233300018067Groundwater SedimentVAALEGDMLRTFGEIDPTIAAEVAATAAGRRVPVLSGFVGRLG
Ga0184628_1015557133300018083Groundwater SedimentMNHHLTGIKVAALEGDMLRTFGEIDPSIAADVAAAAAGRRVPVLSGFVGRLG
Ga0184628_1050190023300018083Groundwater SedimentYRNGVALAAMEGDMLRVLAPLEPGDAANVAAAAAGRRVPVVSGYVGRVR
Ga0187774_1117947413300018089Tropical PeatlandRNGAPVAAMEGDMLRLLGEVDPAVASDAAAAAAGRRVPVVSGYVGRL
Ga0190265_1152225713300018422SoilANRVVYRNGVPVAAMEGDMLKMLNPVAPEQAADVAAAAAGRRVPVLSGYVGQVRS
Ga0190272_1195230613300018429SoilTPCAAMEGDMLRMLATVDASIAADVAAAAAGRRVPVLSGYVGRL
Ga0190274_1076344123300018476SoilGIAVAALEGDMLRTLAPVDGEIAEAAAAAAAGRRVPVISGWVGRA
Ga0190274_1340569313300018476SoilAMEGDLLRTIGDVDPAIAADVAAAAAGRRVKVLSGFVGAIR
Ga0173481_1012216433300019356SoilAALEGDMLRTLTPVDGEIAEAAAAAAAGRRVPVLSGWVGRA
Ga0173479_1033883113300019362SoilMEGDMLRVLAPVDAAMAPLIAAAAAGRRVPVLSGYVGRI
Ga0194110_1043478513300020084Freshwater LakeEGDMLETLAAVEPEVAIEAAAAAAGRKVPVISGYVGRVN
Ga0194127_1084543023300020221Freshwater LakeIPIAAMEGDMLETLAAVEPEVAIEAAAAAAGRKVPVISGYVGRVN
Ga0210380_1038854613300021082Groundwater SedimentAAMEGDMLRMLAPLEPGDAAHVAAAAAGRRVPVVNGYVGRVR
Ga0247792_114452423300022880SoilGERIRTSTGARIVYRNGVVLAAMEGDMLRMLAPLEGEDAAQVAAVAAGRRVPVISGYVGRFGR
Ga0247768_123140113300022910Plant LitterGILSTGERIRTSTGTRIVYRNGVVLAAMEGDMLRMLAPLEGEDAAQVAAVAAGRRVPVISGYVGRFGR
Ga0247752_103987423300023071SoilATGNRIVYRNGIPVAALEGDMLRTFAEVDPAIAADVAAAAAGRRVPVFSGYVGRTS
Ga0247754_106931113300023102SoilNGVPVAALEGDMLRTFGEIDPTIAAEVAAAAAGRRVPVLSGFVGRLG
Ga0209172_1012549913300025310Hot Spring SedimentNGVPLAALEGDMLRTLGDVDPAIAADVAAAAAGRRVPVLTGYVGRLG
Ga0207697_1045730213300025315Corn, Switchgrass And Miscanthus RhizosphereVYRNGTAVAAMEGDMLRMLQPLDPIDAAAAAGAAAGRRVPVVNGYVGRVR
Ga0207680_1001131613300025903Switchgrass RhizosphereRPLGEIDPSIAADVAAAAAGRRVPVLSGFVGRLGSW
Ga0207680_1115620413300025903Switchgrass RhizosphereHLRASASTRIIYRNGIPVAAMEGDMLRTFGDLDAETAADAAAAAAGRRVPVVRGFVGRL
Ga0207645_1108491933300025907Miscanthus RhizosphereEGDLLRTFGNLEPELAADAAAAAAGRRVPVISGFVGR
Ga0207649_1148459313300025920Corn RhizosphereEGDMLRVLAPVDAAMAPLVAAAAAGRRVPVLSGYVGRI
Ga0207681_1043622613300025923Switchgrass RhizosphereGNRIVYRNGVPVAALEGDMLRTLGEIDPSIAADVAAAAAGRRVPVLSGFVGRLGSW
Ga0207681_1062500613300025923Switchgrass RhizosphereTGIVTLGDRIRAAASSRIVYRNGMAIMAMEGDMLRTLADADAIVLADAAAIAAGRRVPVSHGYVGRIWP
Ga0207659_1022877653300025926Miscanthus RhizosphereYRSGVPVAAMEGDMLRTFGDLEPELAADAAAAAAGRRVPVISGFVGRL
Ga0207659_1155659113300025926Miscanthus RhizosphereVYRNGIPVAAMEGDMLRLLAAVDAGLAPDVAAAAAGRRVPVVTGFVGRLRN
Ga0207701_1060689413300025930Corn, Switchgrass And Miscanthus RhizosphereGDRIRTSVSARVVYRNGTAVAAMEGDMLRMLQPLDPIDAAAAAGAAAGRRVPVVNGYVGRVR
Ga0207690_1171606513300025932Corn RhizosphereEGDLLRTFGDLEPDLAADAAAAAAGRRVPVISGYVGRLE
Ga0207686_1166097913300025934Miscanthus RhizosphereRASAANRIVYRNGVPVAAMEGDLLRTFGDLEPELAADAAAAAAGRRVPVVSGFVGRM
Ga0207691_1114470723300025940Miscanthus RhizosphereMAFMEGDMLRMPAALEPEDAARVAAAAAGRRVPVVSGYVGRISR
Ga0207689_1111949423300025942Miscanthus RhizosphereIVYRNGVPVAALEGDMLRTLGEIDPSIAADVAAAAAGRRVPVLSGFVGRLGSW
Ga0207679_1016041613300025945Corn RhizosphereRIRASAANRIVYRSGVPVAAMEGDMLRTFGDLEPELAADAAAAAAGRRVPVIRGFVGRL
Ga0207679_1115844923300025945Corn RhizosphereVPVAALEGDMLRTFGEIDPTIAAEVAATAAGRRVPVLSGFVGRLGSW
Ga0207651_1196365513300025960Switchgrass RhizosphereVPVSAMEGDMLRVLAPVDAAMAPVVAAAAAGRRVPVLSGYVGRI
Ga0207712_1114796313300025961Switchgrass RhizosphereGDMLRMLTTVDPAIAADVAAAAAGRRVPVLSGYVGRIQ
Ga0207668_1133028213300025972Switchgrass RhizosphereTAAGNRIVYRNGVPVAALEGDMLRTFGEIDPTIAAEVAAAAAGRRVPVLSGFVGRLG
Ga0207640_1081998713300025981Corn RhizosphereIVYRNGIPLAALEGDMLRTFAEVDPAIAADVAAAAAGRRVPVFSGYVGRTS
Ga0207648_1157096913300026089Miscanthus RhizosphereVLSAGNRIRASVGTRLVYRNGVVLAAMEGDMLRMLAPLEGEDAASVAAAAAGRRVPVIRGYVGRFGR
Ga0207674_1022482133300026116Corn RhizosphereASNRIVYLRGVPVSAMEGDMLRVLAPVDAAMAPLIAAAAAGRRVPVLSGYVGRI
Ga0207675_10258252723300026118Switchgrass RhizosphereAAMEGDMLRTLNEVDPSTALEVAAAAAGRRVPVVSGYVGRVRT
Ga0207683_1055293633300026121Miscanthus RhizosphereIPLAALEGDMLRTFGEIDPSIAADVAAAAAGRRVPVLSGFVGRLG
Ga0207683_1139095123300026121Miscanthus RhizosphereTAASSRIVYRKGIAIMAMEGDMLRTLADADATVLADAAAIAAGRRVPVSHGYVGRIWP
Ga0209438_115105833300026285Grasslands SoilIVYRNGVPVAAMEGDMLRTFGVQDRELAAEAAAAAAGRRVPVIAGYVGRL
Ga0209974_1007477823300027876Arabidopsis Thaliana RhizosphereIRAAASSRIVYRNGVPIMAMEGDMLRTLADADATVLADAAAIAAGRRVPVSHGYVGRIWP
Ga0209590_1071501113300027882Vadose Zone SoilPVAAMEGDMLRTYGTLDRETAADAAAAAAGRRVPVISGFVGRI
Ga0209486_1059479413300027886Agricultural SoilTANRVVYRNGVPVAAMEGDMLRTLADLEPSVASEAAAAAAGRRVPVLSGYVGRIG
Ga0268264_10006355143300028381Switchgrass RhizosphereVAAMEGDLLRTFGNLEPELAADAAAAAAGRRVPVISGFVGRL
Ga0247819_1061356523300028608SoilTGIVTLGDRIRAAASSRIVYRNGIPVMAMEGDMLRTLADADATVLADAAAIAAGRRVPVSHGYVGRIWP
Ga0247825_1065676913300028812SoilRNGVPVAAKEGDMLRSLSEVDPDVAADAAAAAAGRRVPVVRGFVGRLG
Ga0247825_1078298233300028812SoilEGDMLRTLAPVDGEVAEAAASAAAGRRVPVLSGWVGRA
Ga0247825_1104528413300028812SoilRNGVPIAAMEGDMLRSLSEVDAGTAADAAAAAAGRRVPVVRGFVGRRG
Ga0247827_1069259323300028889SoilVMAMEGDMLRTLADADATVLADAAAIAAGRRVPVSHGYVGRIWP
Ga0310888_1016422523300031538SoilAAASSRLVYRNGVPVMAMEGDMLRTLADVGPDVLADAAAIAAGRRVPVSHGYVGRLST
Ga0310888_1064582513300031538SoilNGVPIMAMEGDMLRTLADADVTVLADAAAIAAGRRVPVSHGYVGRIWP
Ga0310887_1050085913300031547SoilRTLADVGPDVLADAAAIAAGRRVPVSHGYVGRLST
Ga0310886_1007228213300031562SoilLRGVPVSAMEGDMLRVLANVDPAIAPAVAAAAAGRRVPVLSGYVGRL
Ga0310886_1100428113300031562SoilAALEGDMLRTFGEIEPSIAADVAAAAAGRPVPVLSGFVGRLG
Ga0310813_1088516733300031716SoilGTRIVYRNGVVLAAMEGDMLRMLAPLEGEDAAQVAAVAAGRRVPVISGYVGRFGR
Ga0307405_1151149713300031731RhizosphereLAAMEGDMLKMLGDVDASIAQQVASAAAGRHAPALSGYIGRLR
Ga0307405_1211950613300031731RhizosphereIVYRNGIPVMAMEGDMLRTLADADATVLADAAAIAAGRRVPVSHGYVGRIWP
Ga0310904_1103188213300031854SoilRVVYRNGIPIMAMEGDMLRPLADVDATVLADAAALAAGRRVPVSNGYVGRIWP
Ga0310904_1118573513300031854SoilDVLKRLAEVDPAVAAEAAAAAAGRRVPVFSGYVGRLG
Ga0310892_1015081513300031858SoilGIVTLGDRIRAAASSRIVYRNGVPIMAMEGDMLRTLADADATVLADAAAIAAGRRVPVSHGYVGRIWP
Ga0310892_1031909123300031858SoilRAAASSRIVYRNGIPVMAMEGDMLRTLADADATVLADAAAIAAGRRVPVSHGYVGRIWP
Ga0307406_1083868423300031901RhizosphereIRVATGNRIVYRNGVPVAAMEGDMLRTLADLEPSVAAEAAAAAAGRRVPVLSGYVGRMSS
Ga0307406_1134841713300031901RhizosphereVAGNRIVYRNGIPIAAMEGDMLRTLSDMAPSVAAEAAAAAAGRRVPVVTGYVGRVSS
Ga0310900_1123607413300031908SoilANRVVYLRGVPVSAMEGDMLRILVPVDPELAPVVAAAAAGRRVPVLSGYVGRKG
Ga0308175_10157179923300031938SoilEGDIIRVLAPVAPALAADVAAAAAGRRVPVLSGYVGRA
Ga0308174_1082670023300031939SoilRIRSSAATRIVYRNGVALAAMEGDMLRMMATLDPIDAAEVAAAAAGRRVPVVSGYVGRIS
Ga0310901_1002398213300031940SoilYRNGIPLAALEGDMLRTFAEVDPAIAADVAAAAAGRRVPVFSGYVGRTS
Ga0310901_1051544123300031940SoilVPVAALEGDMLRTFGEIDPTIAAEVAATAAGRRVPVLSGFVGRLG
Ga0310885_1020145213300031943SoilDMLRVLANVDPAIAPAVAAAAAGRRVPVLSGYVGRL
Ga0310885_1071044313300031943SoilYRNGIPIMAMEGDMLRPLADVDVTVLADAAALAAGRRVPVSNGYVGRIWP
Ga0310884_1015610123300031944SoilTGIVTLGDRIRAAASSRIVYRNGVPIMAMEGDMLRTLADADATVLADAAAIAAGRRVPVSHGYVGRIWP
Ga0307416_10044840623300032002RhizosphereMEGDFLRTLGHVEPDIAADVAAAAAGRRVPVVSGYVGRLKA
Ga0310902_1058104213300032012SoilAAGNRIVYRNGIPVAALEGDMLRTLGEIDPSIAADVAAAAAGRRVPVLSGFVGRLG
Ga0310906_1001697743300032013SoilLGDRIRAAASSRIVYRNGIPIMAMEGDMLRTLADADAAVLADAAAIAAGRRVPVSHGYVGRIWP
Ga0310899_1055009723300032017SoilLAALEGDMLRTFGEIEPSIAADVAAAAAGRPVPVLSGFVGRLG
Ga0310890_1003637513300032075SoilIVYRNGVPVAALEGDMLRTFGEIDSSIAADVAAAAAGRRVPVLSGFVGRLG
Ga0307415_10002422753300032126RhizosphereDRLRTVAANRIVYLRGVPVSAMEGDMLRVLAPVDAALAAQVAEAAAGRRVPVVSGYVGRM
Ga0315912_1167258413300032157SoilPLAALEGDMLRTFGEIDPSIAADVAAAAAGRRVPVLSGFVGRLG
Ga0310889_1067934223300032179SoilGIPVMAMEGDMLRTLADVDAPILADAAALAAGRRVPVSNGYVGRIWP
Ga0307471_10002597013300032180Hardwood Forest SoilAAMEGDMLRAFGPLDRQVAAEAAAAAAGRRVPVISGFVGRI
Ga0307471_10012574813300032180Hardwood Forest SoilDMLRTFGTLDREVASEAAAAAAGRRVPVISGVVGRI
Ga0307471_10400738813300032180Hardwood Forest SoilITGDERIRAAASTRIVYRNGVPVAAMEGDMLRTFGTLDREVASEAAAAAAGRRVPVISGFVGRI
Ga0310896_1003763843300032211SoilAALEGDMLRTFAEVDPAIAADVAAAAAGRRVPVFSGYVGRTS
Ga0247830_1030460023300033551SoilPVSAMEGDMLRVLANVDPAIAPAVAAAAAGRRVPVLSGYVGRL
Ga0247830_1052766323300033551SoilAGNRIVYRNGVPVAALEGDMLRTFGEIDPTIAAEVAAAAAGRRVPVLSGFVGRLG
Ga0364933_020532_1_2103300034150SedimentTGIITPGDRLRSVAANRIVYLRGVPVSAMEGDMLRVLAPVDPALGPAVAAAAAGRRVPVVSGYVGRLSR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.