NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F019200

Metagenome / Metatranscriptome Family F019200

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F019200
Family Type Metagenome / Metatranscriptome
Number of Sequences 231
Average Sequence Length 45 residues
Representative Sequence MNARTRQATITFVALCAFAMLSWLIFRGYLTPEMMVYFLSFKWCF
Number of Associated Samples 169
Number of Associated Scaffolds 231

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 30.87 %
% of genes near scaffold ends (potentially truncated) 19.48 %
% of genes from short scaffolds (< 2000 bps) 86.15 %
Associated GOLD sequencing projects 148
AlphaFold2 3D model prediction Yes
3D model pTM-score0.50

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (63.203 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(10.822 % of family members)
Environment Ontology (ENVO) Unclassified
(40.693 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(48.918 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 50.68%    β-sheet: 0.00%    Coil/Unstructured: 49.32%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.50
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 231 Family Scaffolds
PF07690MFS_1 38.10
PF13619KTSC 2.60
PF01381HTH_3 2.16
PF01625PMSR 1.73
PF00480ROK 0.87
PF04226Transgly_assoc 0.43
PF01339CheB_methylest 0.43
PF05199GMC_oxred_C 0.43
PF01385OrfB_IS605 0.43
PF00005ABC_tran 0.43
PF00664ABC_membrane 0.43
PF01594AI-2E_transport 0.43
PF13560HTH_31 0.43
PF13502AsmA_2 0.43
PF13098Thioredoxin_2 0.43
PF03928HbpS-like 0.43
PF02576RimP_N 0.43
PF12867DinB_2 0.43
PF09285Elong-fact-P_C 0.43
PF11954DUF3471 0.43

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 231 Family Scaffolds
COG0225Peptide methionine sulfoxide reductase MsrAPosttranslational modification, protein turnover, chaperones [O] 1.73
COG1940Sugar kinase of the NBD/HSP70 family, may contain an N-terminal HTH domainTranscription [K] 1.73
COG2201Chemotaxis response regulator CheB, contains REC and protein-glutamate methylesterase domainsSignal transduction mechanisms [T] 0.87
COG0628Predicted PurR-regulated permease PerMGeneral function prediction only [R] 0.43
COG0675TransposaseMobilome: prophages, transposons [X] 0.43
COG0779Ribosome maturation factor RimPTranslation, ribosomal structure and biogenesis [J] 0.43
COG2261Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein familyGeneral function prediction only [R] 0.43
COG2303Choline dehydrogenase or related flavoproteinLipid transport and metabolism [I] 0.43


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms63.20 %
UnclassifiedrootN/A36.80 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2199352024|deeps__Contig_179890Not Available965Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_105800813Not Available1432Open in IMG/M
3300000956|JGI10216J12902_100391234Not Available516Open in IMG/M
3300000956|JGI10216J12902_102431918All Organisms → cellular organisms → Bacteria → Proteobacteria500Open in IMG/M
3300002907|JGI25613J43889_10017320All Organisms → cellular organisms → Bacteria2016Open in IMG/M
3300002917|JGI25616J43925_10168081All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria866Open in IMG/M
3300003315|P22013IDBA_10010180All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales4639Open in IMG/M
3300004114|Ga0062593_100037908All Organisms → cellular organisms → Bacteria → Proteobacteria2848Open in IMG/M
3300004114|Ga0062593_102726579Not Available563Open in IMG/M
3300004156|Ga0062589_102131797All Organisms → cellular organisms → Bacteria → Proteobacteria572Open in IMG/M
3300004157|Ga0062590_101892519Not Available615Open in IMG/M
3300004157|Ga0062590_102301071All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Usitatibacteraceae → Usitatibacter → Usitatibacter palustris566Open in IMG/M
3300004463|Ga0063356_100105647All Organisms → cellular organisms → Bacteria3072Open in IMG/M
3300004463|Ga0063356_101004072All Organisms → cellular organisms → Bacteria1192Open in IMG/M
3300004463|Ga0063356_101857732All Organisms → cellular organisms → Bacteria907Open in IMG/M
3300004463|Ga0063356_104634303Not Available591Open in IMG/M
3300004463|Ga0063356_104734810All Organisms → cellular organisms → Bacteria585Open in IMG/M
3300004463|Ga0063356_104858804Not Available578Open in IMG/M
3300004463|Ga0063356_105749654All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria532Open in IMG/M
3300004643|Ga0062591_100335118All Organisms → cellular organisms → Bacteria1213Open in IMG/M
3300004778|Ga0062383_10473955Not Available624Open in IMG/M
3300005327|Ga0070658_10191984All Organisms → cellular organisms → Bacteria → Proteobacteria1721Open in IMG/M
3300005327|Ga0070658_10267511All Organisms → cellular organisms → Bacteria → Proteobacteria1453Open in IMG/M
3300005330|Ga0070690_100291688All Organisms → cellular organisms → Bacteria → Proteobacteria1167Open in IMG/M
3300005334|Ga0068869_100051489All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria2988Open in IMG/M
3300005340|Ga0070689_100282992Not Available1376Open in IMG/M
3300005340|Ga0070689_101171433All Organisms → cellular organisms → Bacteria → Proteobacteria689Open in IMG/M
3300005343|Ga0070687_100772378Not Available678Open in IMG/M
3300005344|Ga0070661_100445192Not Available1030Open in IMG/M
3300005354|Ga0070675_100076623All Organisms → cellular organisms → Bacteria → Proteobacteria2782Open in IMG/M
3300005356|Ga0070674_100475027All Organisms → cellular organisms → Bacteria1037Open in IMG/M
3300005438|Ga0070701_10016732All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria3415Open in IMG/M
3300005438|Ga0070701_10667776All Organisms → cellular organisms → Bacteria → Proteobacteria695Open in IMG/M
3300005441|Ga0070700_100161098All Organisms → cellular organisms → Bacteria → Proteobacteria1544Open in IMG/M
3300005456|Ga0070678_100546448All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Usitatibacteraceae → Usitatibacter → Usitatibacter palustris1028Open in IMG/M
3300005468|Ga0070707_101766009All Organisms → cellular organisms → Bacteria586Open in IMG/M
3300005471|Ga0070698_101029346Not Available771Open in IMG/M
3300005530|Ga0070679_101095577All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Usitatibacteraceae → Usitatibacter → Usitatibacter palustris741Open in IMG/M
3300005538|Ga0070731_10004167All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria12593Open in IMG/M
3300005539|Ga0068853_101543537Not Available643Open in IMG/M
3300005539|Ga0068853_102326938All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Usitatibacteraceae → Usitatibacter → Usitatibacter palustris519Open in IMG/M
3300005543|Ga0070672_100105632All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria2290Open in IMG/M
3300005543|Ga0070672_100845660All Organisms → cellular organisms → Bacteria806Open in IMG/M
3300005547|Ga0070693_100447076All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Usitatibacteraceae → Usitatibacter → Usitatibacter palustris906Open in IMG/M
3300005575|Ga0066702_10440390Not Available798Open in IMG/M
3300005578|Ga0068854_101184509Not Available684Open in IMG/M
3300005615|Ga0070702_100416454Not Available965Open in IMG/M
3300005617|Ga0068859_102179657All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Usitatibacteraceae → Usitatibacter → Usitatibacter palustris611Open in IMG/M
3300005719|Ga0068861_100602085All Organisms → cellular organisms → Bacteria → Proteobacteria1009Open in IMG/M
3300005836|Ga0074470_10526495Not Available506Open in IMG/M
3300005840|Ga0068870_11126585All Organisms → cellular organisms → Bacteria565Open in IMG/M
3300005841|Ga0068863_100614080All Organisms → cellular organisms → Bacteria1077Open in IMG/M
3300006102|Ga0075015_100194306All Organisms → cellular organisms → Bacteria → Proteobacteria1077Open in IMG/M
3300006173|Ga0070716_100760517Not Available746Open in IMG/M
3300006237|Ga0097621_100319808Not Available1374Open in IMG/M
3300006358|Ga0068871_100827818Not Available855Open in IMG/M
3300006755|Ga0079222_10706054All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae799Open in IMG/M
3300006797|Ga0066659_11696048All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria533Open in IMG/M
3300006844|Ga0075428_102341195All Organisms → cellular organisms → Bacteria549Open in IMG/M
3300006854|Ga0075425_103025957All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300006876|Ga0079217_10002870All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria4884Open in IMG/M
3300006894|Ga0079215_11014552Not Available612Open in IMG/M
3300006918|Ga0079216_10142002All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Usitatibacteraceae → Usitatibacter → Usitatibacter palustris1237Open in IMG/M
3300006918|Ga0079216_10543747Not Available781Open in IMG/M
3300006918|Ga0079216_10566642All Organisms → cellular organisms → Bacteria771Open in IMG/M
3300006931|Ga0097620_101078585All Organisms → cellular organisms → Bacteria883Open in IMG/M
3300007004|Ga0079218_10069172All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria2288Open in IMG/M
3300007004|Ga0079218_10468778All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1101Open in IMG/M
3300007004|Ga0079218_11054698All Organisms → cellular organisms → Bacteria822Open in IMG/M
3300007004|Ga0079218_11662447All Organisms → cellular organisms → Bacteria705Open in IMG/M
3300007004|Ga0079218_13741801Not Available517Open in IMG/M
3300007076|Ga0075435_101786208All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Usitatibacteraceae → Usitatibacter → Usitatibacter palustris540Open in IMG/M
3300009012|Ga0066710_104376207All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Usitatibacteraceae → Usitatibacter → Usitatibacter palustris528Open in IMG/M
3300009078|Ga0105106_10165510Not Available1622Open in IMG/M
3300009087|Ga0105107_10848291All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria636Open in IMG/M
3300009094|Ga0111539_12335732All Organisms → cellular organisms → Bacteria620Open in IMG/M
3300009148|Ga0105243_10265674Not Available1538Open in IMG/M
3300009148|Ga0105243_11668868Not Available665Open in IMG/M
3300009553|Ga0105249_11231018Not Available820Open in IMG/M
3300009609|Ga0105347_1038538All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1689Open in IMG/M
3300009609|Ga0105347_1498614All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Usitatibacteraceae → Usitatibacter → Usitatibacter palustris529Open in IMG/M
3300009870|Ga0131092_10145559All Organisms → cellular organisms → Bacteria2624Open in IMG/M
3300009873|Ga0131077_10503113All Organisms → cellular organisms → Bacteria1121Open in IMG/M
3300010337|Ga0134062_10578776Not Available575Open in IMG/M
3300010397|Ga0134124_11389610Not Available727Open in IMG/M
3300010397|Ga0134124_12773671All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Usitatibacteraceae → Usitatibacter → Usitatibacter palustris534Open in IMG/M
3300010399|Ga0134127_11900640All Organisms → cellular organisms → Bacteria → Proteobacteria672Open in IMG/M
3300010401|Ga0134121_12519590All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Usitatibacteraceae → Usitatibacter → Usitatibacter palustris557Open in IMG/M
3300010401|Ga0134121_12858482Not Available529Open in IMG/M
3300010403|Ga0134123_10078142All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria2570Open in IMG/M
3300010403|Ga0134123_13358477Not Available517Open in IMG/M
3300010877|Ga0126356_10537197All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Usitatibacteraceae → Usitatibacter → Usitatibacter palustris907Open in IMG/M
3300010880|Ga0126350_12033382All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1443Open in IMG/M
3300011420|Ga0137314_1096904All Organisms → cellular organisms → Bacteria723Open in IMG/M
3300012212|Ga0150985_112526273All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria603Open in IMG/M
3300012353|Ga0137367_11215852All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300012668|Ga0157216_10134325Not Available1197Open in IMG/M
3300012668|Ga0157216_10176678All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Usitatibacteraceae → Usitatibacter → Usitatibacter palustris1020Open in IMG/M
3300012684|Ga0136614_11193567All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria515Open in IMG/M
3300012895|Ga0157309_10355562Not Available511Open in IMG/M
3300012901|Ga0157288_10136374Not Available715Open in IMG/M
3300012905|Ga0157296_10354340Not Available533Open in IMG/M
3300012916|Ga0157310_10294962All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Usitatibacteraceae → Usitatibacter → Usitatibacter palustris633Open in IMG/M
3300012944|Ga0137410_11554938All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Usitatibacteraceae → Usitatibacter → Usitatibacter palustris578Open in IMG/M
3300012961|Ga0164302_11739379All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Usitatibacteraceae → Usitatibacter → Usitatibacter palustris524Open in IMG/M
3300012984|Ga0164309_11277585Not Available620Open in IMG/M
3300013306|Ga0163162_11751819Not Available710Open in IMG/M
3300013306|Ga0163162_12190012All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria635Open in IMG/M
3300014166|Ga0134079_10107495All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1073Open in IMG/M
3300014326|Ga0157380_11503551All Organisms → cellular organisms → Bacteria → Proteobacteria726Open in IMG/M
3300014326|Ga0157380_11747970All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Usitatibacteraceae → Usitatibacter → Usitatibacter palustris680Open in IMG/M
3300014326|Ga0157380_12062565Not Available633Open in IMG/M
3300014866|Ga0180090_1013839All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1198Open in IMG/M
3300015079|Ga0167657_1000874All Organisms → cellular organisms → Bacteria6695Open in IMG/M
3300015086|Ga0167655_1033387Not Available829Open in IMG/M
3300015200|Ga0173480_10741882Not Available620Open in IMG/M
3300015245|Ga0137409_10514779All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1021Open in IMG/M
3300015371|Ga0132258_10243815All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium GR16-434388Open in IMG/M
3300015371|Ga0132258_10249726All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium GR16-434336Open in IMG/M
3300015371|Ga0132258_10482630Not Available3096Open in IMG/M
3300015373|Ga0132257_101206419All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria958Open in IMG/M
3300015373|Ga0132257_101411038All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Usitatibacteraceae → Usitatibacter → Usitatibacter palustris886Open in IMG/M
3300017792|Ga0163161_11391533Not Available612Open in IMG/M
3300017792|Ga0163161_11445161Not Available602Open in IMG/M
3300017965|Ga0190266_10298400All Organisms → cellular organisms → Bacteria838Open in IMG/M
3300017965|Ga0190266_10917738Not Available577Open in IMG/M
3300018029|Ga0187787_10074073All Organisms → cellular organisms → Bacteria → Proteobacteria1050Open in IMG/M
3300018063|Ga0184637_10598690Not Available624Open in IMG/M
3300018075|Ga0184632_10019781All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium GR16-432849Open in IMG/M
3300018084|Ga0184629_10028964All Organisms → cellular organisms → Bacteria → Proteobacteria2378Open in IMG/M
3300018429|Ga0190272_10368178Not Available1155Open in IMG/M
3300018429|Ga0190272_13293310All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Usitatibacteraceae → Usitatibacter → Usitatibacter palustris504Open in IMG/M
3300018476|Ga0190274_10673629All Organisms → cellular organisms → Bacteria → Proteobacteria1074Open in IMG/M
3300018476|Ga0190274_10687267All Organisms → cellular organisms → Bacteria → Proteobacteria1065Open in IMG/M
3300018476|Ga0190274_11574449All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Usitatibacteraceae → Usitatibacter → Usitatibacter palustris749Open in IMG/M
3300018476|Ga0190274_11604707Not Available743Open in IMG/M
3300018476|Ga0190274_11764027All Organisms → cellular organisms → Bacteria → Proteobacteria713Open in IMG/M
3300018476|Ga0190274_12833393Not Available581Open in IMG/M
3300018476|Ga0190274_12860605All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Usitatibacteraceae → Usitatibacter → Usitatibacter palustris579Open in IMG/M
3300018481|Ga0190271_10985958All Organisms → cellular organisms → Bacteria967Open in IMG/M
3300018481|Ga0190271_11760090All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales732Open in IMG/M
3300018481|Ga0190271_11803467All Organisms → cellular organisms → Bacteria724Open in IMG/M
3300018481|Ga0190271_12913962All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Usitatibacteraceae → Usitatibacter → Usitatibacter palustris574Open in IMG/M
3300018481|Ga0190271_13682707All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Usitatibacteraceae → Usitatibacter → Usitatibacter palustris513Open in IMG/M
3300018482|Ga0066669_11106785All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium715Open in IMG/M
3300020146|Ga0196977_1000046All Organisms → cellular organisms → Bacteria → Proteobacteria87786Open in IMG/M
3300020202|Ga0196964_10220069All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Usitatibacteraceae → Usitatibacter → Usitatibacter palustris883Open in IMG/M
3300020215|Ga0196963_10106610All Organisms → cellular organisms → Bacteria → Proteobacteria1180Open in IMG/M
3300020581|Ga0210399_10697258Not Available835Open in IMG/M
3300021384|Ga0213876_10337521All Organisms → cellular organisms → Bacteria801Open in IMG/M
3300021445|Ga0182009_10739374Not Available535Open in IMG/M
3300024347|Ga0179591_1065879All Organisms → cellular organisms → Bacteria → Proteobacteria2372Open in IMG/M
3300025901|Ga0207688_10017542All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3891Open in IMG/M
3300025903|Ga0207680_10548496Not Available825Open in IMG/M
3300025907|Ga0207645_10700102Not Available689Open in IMG/M
3300025909|Ga0207705_10415486Not Available1041Open in IMG/M
3300025909|Ga0207705_10641170All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Usitatibacteraceae → Usitatibacter → Usitatibacter palustris826Open in IMG/M
3300025918|Ga0207662_10667134Not Available727Open in IMG/M
3300025918|Ga0207662_10779144Not Available673Open in IMG/M
3300025922|Ga0207646_10469132All Organisms → cellular organisms → Bacteria → Proteobacteria1135Open in IMG/M
3300025923|Ga0207681_10467817Not Available1028Open in IMG/M
3300025924|Ga0207694_11479544All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Usitatibacteraceae → Usitatibacter → Usitatibacter palustris573Open in IMG/M
3300025926|Ga0207659_10167385All Organisms → cellular organisms → Bacteria → Proteobacteria1731Open in IMG/M
3300025926|Ga0207659_10248011Not Available1444Open in IMG/M
3300025934|Ga0207686_10061157All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria2387Open in IMG/M
3300025937|Ga0207669_10275216Not Available1267Open in IMG/M
3300025937|Ga0207669_11193707Not Available644Open in IMG/M
3300025944|Ga0207661_12155124All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Usitatibacteraceae → Usitatibacter → Usitatibacter palustris504Open in IMG/M
3300025960|Ga0207651_10336539Not Available1267Open in IMG/M
3300025960|Ga0207651_11854695All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Usitatibacteraceae → Usitatibacter → Usitatibacter palustris542Open in IMG/M
3300025961|Ga0207712_12127492Not Available502Open in IMG/M
3300025981|Ga0207640_11680354Not Available573Open in IMG/M
3300026035|Ga0207703_11125239All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Usitatibacteraceae → Usitatibacter → Usitatibacter palustris754Open in IMG/M
3300026041|Ga0207639_10268332All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1496Open in IMG/M
3300026075|Ga0207708_10560980All Organisms → cellular organisms → Bacteria964Open in IMG/M
3300026088|Ga0207641_10365778All Organisms → cellular organisms → Bacteria1378Open in IMG/M
3300026088|Ga0207641_11344644Not Available715Open in IMG/M
3300026089|Ga0207648_11788688All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria576Open in IMG/M
3300026089|Ga0207648_11792661All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria575Open in IMG/M
3300026121|Ga0207683_10795160Not Available878Open in IMG/M
3300026142|Ga0207698_10556525Not Available1125Open in IMG/M
3300026142|Ga0207698_10815949All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria936Open in IMG/M
3300026320|Ga0209131_1000662All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium GR16-4324408Open in IMG/M
3300027639|Ga0209387_1205295Not Available543Open in IMG/M
3300027645|Ga0209117_1089283All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Usitatibacteraceae → Usitatibacter → Usitatibacter palustris853Open in IMG/M
3300027691|Ga0209485_1075790All Organisms → cellular organisms → Bacteria → Proteobacteria909Open in IMG/M
3300027695|Ga0209966_1049011Not Available895Open in IMG/M
3300027818|Ga0209706_10570262All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria511Open in IMG/M
3300027869|Ga0209579_10031916All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria2871Open in IMG/M
3300027886|Ga0209486_10082949All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1670Open in IMG/M
3300027886|Ga0209486_10706869All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria650Open in IMG/M
3300027979|Ga0209705_10555546Not Available554Open in IMG/M
3300028380|Ga0268265_10645442All Organisms → cellular organisms → Bacteria1017Open in IMG/M
3300030997|Ga0073997_11812162Not Available549Open in IMG/M
3300031231|Ga0170824_110519498All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria2273Open in IMG/M
(restricted) 3300031248|Ga0255312_1139576Not Available601Open in IMG/M
3300031548|Ga0307408_100283825All Organisms → cellular organisms → Bacteria1380Open in IMG/M
3300031548|Ga0307408_100319164All Organisms → cellular organisms → Bacteria1308Open in IMG/M
3300031548|Ga0307408_100962241All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Usitatibacteraceae → Usitatibacter → Usitatibacter palustris785Open in IMG/M
3300031548|Ga0307408_102274149All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Usitatibacteraceae → Usitatibacter → Usitatibacter palustris525Open in IMG/M
3300031562|Ga0310886_11084066Not Available516Open in IMG/M
3300031731|Ga0307405_10502485Not Available972Open in IMG/M
3300031740|Ga0307468_101651104Not Available601Open in IMG/M
3300031824|Ga0307413_10812015Not Available787Open in IMG/M
3300031824|Ga0307413_11094016All Organisms → cellular organisms → Bacteria → Proteobacteria688Open in IMG/M
3300031854|Ga0310904_10362412All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria938Open in IMG/M
3300031901|Ga0307406_10638024Not Available883Open in IMG/M
3300031911|Ga0307412_10750982All Organisms → cellular organisms → Bacteria842Open in IMG/M
3300031938|Ga0308175_100096782All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria2707Open in IMG/M
3300031939|Ga0308174_11132327All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae666Open in IMG/M
3300031940|Ga0310901_10517097Not Available537Open in IMG/M
3300032002|Ga0307416_103356519All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Usitatibacteraceae → Usitatibacter → Usitatibacter palustris536Open in IMG/M
3300032005|Ga0307411_10801474Not Available829Open in IMG/M
3300032075|Ga0310890_11655714All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Usitatibacteraceae → Usitatibacter → Usitatibacter palustris530Open in IMG/M
3300032144|Ga0315910_11599870Not Available508Open in IMG/M
3300032421|Ga0310812_10275967Not Available744Open in IMG/M
3300032770|Ga0335085_10394011Not Available1609Open in IMG/M
3300032782|Ga0335082_10114086All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium GR16-432660Open in IMG/M
3300032782|Ga0335082_10158977All Organisms → cellular organisms → Bacteria2180Open in IMG/M
3300032783|Ga0335079_10043100All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium GR16-435179Open in IMG/M
3300032829|Ga0335070_10014275All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium GR16-439242Open in IMG/M
3300032829|Ga0335070_10279716All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1625Open in IMG/M
3300032954|Ga0335083_10262025All Organisms → cellular organisms → Bacteria1539Open in IMG/M
3300033004|Ga0335084_10233074Not Available1910Open in IMG/M
3300033004|Ga0335084_11330349Not Available714Open in IMG/M
3300033407|Ga0214472_10269910Not Available1626Open in IMG/M
3300033550|Ga0247829_11759075All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria511Open in IMG/M
3300033551|Ga0247830_10782460All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Usitatibacteraceae → Usitatibacter → Usitatibacter palustris759Open in IMG/M
3300033805|Ga0314864_0049112Not Available959Open in IMG/M
3300034384|Ga0372946_0075433All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Usitatibacteraceae → Usitatibacter → Usitatibacter palustris1556Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil10.82%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil6.49%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere4.76%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.33%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.90%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere3.90%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil3.46%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere3.46%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere3.46%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil3.03%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere3.03%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.60%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere2.60%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.16%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.16%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere2.16%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere2.16%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment1.73%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil1.73%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.73%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil1.73%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.73%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.73%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.73%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.73%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.30%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.30%
SoilEnvironmental → Terrestrial → Soil → Sand → Desert → Soil1.30%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere1.30%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.30%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.30%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.87%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.87%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.87%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.87%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.87%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.87%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.87%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment0.43%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand0.43%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)0.43%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.43%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.43%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.43%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil0.43%
Ore Pile And Mine Drainage Contaminated SoilEnvironmental → Terrestrial → Soil → Unclassified → Mine Drainage → Ore Pile And Mine Drainage Contaminated Soil0.43%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.43%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.43%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.43%
Sandy SoilEnvironmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil0.43%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.43%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.43%
Plant RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots0.43%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.43%
WastewaterEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater0.43%
Activated SludgeEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge0.43%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2199352024Bare-fallow DEEP SOILEnvironmentalOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300002907Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cmEnvironmentalOpen in IMG/M
3300002917Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cmEnvironmentalOpen in IMG/M
3300003315Ore pile and mine drainage contaminated soil microbial communities from Mina do Sossego, Brazil - P2 sampleEnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300004778Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3FreshEnvironmentalOpen in IMG/M
3300005327Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaGHost-AssociatedOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005344Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaGHost-AssociatedOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005438Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaGEnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300005538Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1EnvironmentalOpen in IMG/M
3300005539Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2Host-AssociatedOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005575Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151EnvironmentalOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005836Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBBEnvironmentalOpen in IMG/M
3300005840Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300006102Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006876Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200EnvironmentalOpen in IMG/M
3300006894Agricultural soil microbial communities from Utah to study Nitrogen management - NC ControlEnvironmentalOpen in IMG/M
3300006918Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100EnvironmentalOpen in IMG/M
3300006931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2)Host-AssociatedOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009078Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015EnvironmentalOpen in IMG/M
3300009087Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015EnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009609Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890EnvironmentalOpen in IMG/M
3300009870Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Linkou plantEngineeredOpen in IMG/M
3300009873Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Wenshan plantEngineeredOpen in IMG/M
3300010337Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300010877Boreal forest soil eukaryotic communities from Alaska, USA - W3-2 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010880Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011420Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT199_2EnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012353Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012668Arctic soils microbial communities. Combined Assembly of 23 SPsEnvironmentalOpen in IMG/M
3300012684Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ279 (21.06)EnvironmentalOpen in IMG/M
3300012895Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S208-509C-2EnvironmentalOpen in IMG/M
3300012901Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1EnvironmentalOpen in IMG/M
3300012905Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2EnvironmentalOpen in IMG/M
3300012916Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S213-509R-2EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015EnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014866Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT890_16_10DEnvironmentalOpen in IMG/M
3300015079Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-6b, vegetation/snow interface)EnvironmentalOpen in IMG/M
3300015086Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-5c, rocky medial moraine)EnvironmentalOpen in IMG/M
3300015200Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2)EnvironmentalOpen in IMG/M
3300015245Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300017965Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 TEnvironmentalOpen in IMG/M
3300018029Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MGEnvironmentalOpen in IMG/M
3300018063Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2EnvironmentalOpen in IMG/M
3300018075Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1EnvironmentalOpen in IMG/M
3300018084Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1EnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300020146Soil microbial communities from Anza Borrego desert, Southern California, United States - S3+v_10-13CEnvironmentalOpen in IMG/M
3300020202Soil microbial communities from Anza Borrego desert, Southern California, United States - S1_10EnvironmentalOpen in IMG/M
3300020215Soil microbial communities from Anza Borrego desert, Southern California, United States - S1_5EnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300021384Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9Host-AssociatedOpen in IMG/M
3300021445Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaGEnvironmentalOpen in IMG/M
3300024347Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300025901Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)Host-AssociatedOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025907Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025909Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025918Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300027639Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control (SPAdes)EnvironmentalOpen in IMG/M
3300027645Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027691Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300027695Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027818Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027869Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027886Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes)EnvironmentalOpen in IMG/M
3300027979Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300030997Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-3B (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031248 (restricted)Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH5_T0_E5EnvironmentalOpen in IMG/M
3300031548Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3Host-AssociatedOpen in IMG/M
3300031562Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3EnvironmentalOpen in IMG/M
3300031731Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1Host-AssociatedOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031824Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2Host-AssociatedOpen in IMG/M
3300031854Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1EnvironmentalOpen in IMG/M
3300031901Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2Host-AssociatedOpen in IMG/M
3300031911Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1Host-AssociatedOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031939Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2EnvironmentalOpen in IMG/M
3300031940Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2EnvironmentalOpen in IMG/M
3300032002Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3Host-AssociatedOpen in IMG/M
3300032005Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1Host-AssociatedOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300032144Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soilEnvironmentalOpen in IMG/M
3300032421Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033407Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175EnvironmentalOpen in IMG/M
3300033550Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4EnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M
3300033805Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_10EnvironmentalOpen in IMG/M
3300034384Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_KNG_2.2EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
deeps_033616502199352024SoilMNARTRNASLAFVFLCAFALLSWAIFRGYMTPEMMIYFLSFKWCFG
INPhiseqgaiiFebDRAFT_10580081323300000364SoilMNAQTRKSLWIFLGLCAFAMLSWLIFVGYLTPEMMVYFLSFRWCF*
JGI10216J12902_10039123413300000956SoilMNARTRRSLFVFLALCAFASLSWLIFVGYLTPEMMVYFLSFRWCF*
JGI10216J12902_10243191823300000956SoilMMNARTRNATLAFVGLLVFALASWAIFRGYLTPEMMVYYLTFQWCL*
JGI25613J43889_1001732033300002907Grasslands SoilMSVRTRQSLWVVLAVCAFAALSWVIFRGYLTPEMMVYFLSFRWCF*
JGI25616J43925_1016808123300002917Grasslands SoilMGEAPRRTRRAAVALLALCAFAALSWVIFRGYLTPEMMVYFLSFKWCL*
P22013IDBA_1001018023300003315Ore Pile And Mine Drainage Contaminated SoilMNARTRQAAVVFALMLAFAMLSWMIFRGYLTPEMMVYFLTFQWCF*
Ga0062593_10003790833300004114SoilVKARARQGLIVFAAALAFAAASWVIFRGYLTPEMMVYFISFKWCF*
Ga0062593_10272657923300004114SoilMNARTRQSFLVCLGLCAFALLSWIIFRGYLTPEMMVYFLSFRWCL*
Ga0062589_10213179723300004156SoilMNARTRNATVAFVGLLAFALASWAIFRGYLTPEMMVYYLTFQWCL*
Ga0062590_10189251923300004157SoilVKARARQGLIVFAAALAFAAASWVIFRGYLTPEMMVYFLSFKWCF*
Ga0062590_10230107113300004157SoilRQSLWVVIALCAFAALSWVIFRGYLTPEMMVYFLSFRWCF*
Ga0063356_10010564713300004463Arabidopsis Thaliana RhizosphereMSRTANPRVRRATVTFVLLCGFAVLSWMIFRGYLTPEMMVYFLSFKWCF
Ga0063356_10100407223300004463Arabidopsis Thaliana RhizosphereMNTRARNASLAFVGLLVFVLASWAIFRGYLTPEMMVYFLTFQWCL*
Ga0063356_10185773223300004463Arabidopsis Thaliana RhizosphereMNARIRNASLAFVGLLGFALASWAIFRGYLTPEMMVYFLTFQWCL*
Ga0063356_10463430313300004463Arabidopsis Thaliana RhizosphereVTPRTRQSIIVAAAALAFIAASWVIFRGYLTPEMMVYFLTFKWCL*
Ga0063356_10473481023300004463Arabidopsis Thaliana RhizosphereMNARTRQSFVVFLMLCAFAALSWVVFRGYLTPEMMVYFLSFRWCF*
Ga0063356_10485880423300004463Arabidopsis Thaliana RhizosphereMNARTRQATVVFVLMLGFAMLSWLIFRGYLTPEMMVYFLTFQWCF*
Ga0063356_10574965423300004463Arabidopsis Thaliana RhizosphereVNARTRQSLFVFLGLCVFALVSWAVFIGYLTPEMMVYFLTFRWCF*
Ga0062591_10033511813300004643SoilVKARARQGLIVFAAALAFAAASWVIFRGYLTPEMMVYFLS
Ga0062383_1047395523300004778Wetland SedimentMSREIRRAAVVFVAMLGFAMLSWLIFRGYLTPEMMVYFLTFQWCL
Ga0070658_1019198413300005327Corn RhizosphereVNARTRNASLAFIFLCAFALLSWAIFRGYMTPDMMIYFLSFKWCFG*
Ga0070658_1026751123300005327Corn RhizosphereMTRETRRAAWTFAALAAFAMASWAAFRGYLTPEMLVYFISFRWCL*
Ga0070690_10029168823300005330Switchgrass RhizosphereMNAQTRRSLWIFLALCAFAMLSWLIFVGYLTPEMMVYFLSFRWCL*
Ga0068869_10005148923300005334Miscanthus RhizosphereVNSRTRQGLIVFAAALAFAAASWVIFRGYLTPEMMVYFLSFKWCF*
Ga0070689_10028299223300005340Switchgrass RhizosphereMNRPVRQALVAFLAMCAFATVSWMIFRGYLTPEMMVYFLSFKWCL*
Ga0070689_10117143323300005340Switchgrass RhizosphereMNARTRRASVVFVALCAFATISWLVFRGYLTPEMMVYFLSFRWCF*
Ga0070687_10077237813300005343Switchgrass RhizosphereVNSRTRQRLIVFAAALAFAAASWVIFRGYLTPEMMVYFLSFKWCF*
Ga0070661_10044519213300005344Corn RhizosphereMTRGARRAAVGFVAMLAFAVVSWMAFVGYLTPDMLVYFLSFKWCL*
Ga0070675_10007662313300005354Miscanthus RhizosphereQGLIVFAAALAFAAASWVIFRGYLTPEMMVYFLSFKWCF*
Ga0070674_10047502723300005356Miscanthus RhizosphereMTNARTRRAALAFVALCAFALVSWAVFRGYLTPEMMVYYLTFQWCL*
Ga0070701_1001673233300005438Corn, Switchgrass And Miscanthus RhizosphereMNARTRRASVVFVALCAFATVSWLVFRGYLTPEMMVYFLSFRWCF*
Ga0070701_1066777623300005438Corn, Switchgrass And Miscanthus RhizosphereMNARTRQSFLVCLGLCAFALLSWIIFRGYLTPEMMVYFLTFRWCF*
Ga0070700_10016109823300005441Corn, Switchgrass And Miscanthus RhizosphereVNPRTRQGLIFFAATLAFAAASWVIFRGYLTPEMMVYFLSFKWCF*
Ga0070678_10054644823300005456Miscanthus RhizosphereMNPRALRAAAISAAVLGFAALSWLIFLGYLTPEMLVYFLSFRWCF*
Ga0070678_10081397913300005456Miscanthus RhizosphereVTVTPRARQSLIAVAATIAFAGASWLIFRGYLTPEMMVYFLSFKWCF*
Ga0070707_10176600923300005468Corn, Switchgrass And Miscanthus RhizosphereMNPRTRHSLYVFLGLCAFATLSWMIFRGYLTPEMMVYFLSFKWCF*
Ga0070698_10102934613300005471Corn, Switchgrass And Miscanthus RhizosphereMQARTRQSLYAFLALCAFAALTWLIFLGYLTPEMMVYFLSFKWCF*
Ga0070679_10109557713300005530Corn RhizosphereMTRQARRAALTFAALAAFAVASWAAFRGYLTPEMLVYFISFRWCL*
Ga0070731_10004167143300005538Surface SoilMNPRTRQATWVFVGLCAFAAASWAIFRGYLTPDMMVYFLSFKWCF*
Ga0068853_10154353723300005539Corn RhizosphereMTRGARRAAVGFVAMLAFAVVSWMAFVGYLTPGMLVYFLSFKWCL*
Ga0068853_10232693823300005539Corn RhizosphereMNARTRNASLAFIFLCAFALLSWAIFRGYMTPEMMIYFLSFKWCFG*
Ga0070672_10010563253300005543Miscanthus RhizosphereVKARARQGLIVFAAALAFAAASWVIFRGYLTPEMMVYFIS
Ga0070672_10084566013300005543Miscanthus RhizosphereRQGLIVFAAALAFAAASWVIFRGYLTPEMMVYFLSFKWCF*
Ga0070693_10044707623300005547Corn, Switchgrass And Miscanthus RhizosphereAGARGAGAGAMNARTRRASVVFVALCAFATVSWLVFRGYLTPEMMVYFLSFRWCF*
Ga0066702_1044039013300005575SoilMTPETRRATFGFAALLAFALASWAAFRGYLTPDMLVYFLSFKWCL*
Ga0068854_10118450923300005578Corn RhizosphereMNAQTRRSLWIFLALCAFAMLSLLIFVGYLTPEMMVYFLSFRWCL*
Ga0070702_10041645413300005615Corn, Switchgrass And Miscanthus RhizosphereVNSRTRQGLIVFAAALAFAAASWVIFRGYLTPEMMVYFLSF
Ga0068859_10217965723300005617Switchgrass RhizosphereGARGAGAGAMNARTRRASVVFVALCAFATVSWLVFRGYLTPEMMVYFLSFRWCF*
Ga0068861_10060208523300005719Switchgrass RhizosphereVNSRTRQALIVFAAALAFAAASWVIFRGYLTPEMMVYFLSFKWCF*
Ga0074470_1052649523300005836Sediment (Intertidal)MNARTRNASLAFVGLLGFALASWAIFRGYLTPEMMVYFLTFQWCL*
Ga0068870_1112658523300005840Miscanthus RhizosphereMSRTANPRVRRATVTFVLLCGFAVLSWMIFRGYLTPEMMVYFLTFQWCL*
Ga0068863_10061408013300005841Switchgrass RhizosphereMNRPVRQALVAFLAMCAFATVSWMIFRGYLTPEMMVYFLSFKWCL
Ga0075015_10019430623300006102WatershedsVSPRTHQASWIFVGLCAFAAASWAIFRGYLTPEMMVYFLSFKWCF*
Ga0070716_10076051723300006173Corn, Switchgrass And Miscanthus RhizosphereMNPETRRATFGFAALLLFALASWAAFRGYLTPDMLVYFLSFKWCL*
Ga0097621_10031980823300006237Miscanthus RhizosphereMNARTRQSFVVFVAVCAFALVSWVIFRGYLTPEMMVYFLSFRWCF*
Ga0068871_10082781823300006358Miscanthus RhizosphereVNSRTRQGLIVFAAALAFAAGSWVIFRGYLTPEMMVYFLSFKWCF*
Ga0079222_1070605423300006755Agricultural SoilMTPRVRQSLIAFIAMLAFLSASWLIFRGYLTPEMMVYFISFKWCF*
Ga0066659_1169604823300006797SoilVTPRTRQSLYVFVAMAAFAAASWLIFRGYLTPEMMAYFLSFKWCF*
Ga0075428_10234119513300006844Populus RhizosphereMNARTRNATLAFVGMLGFALASWAIFRGYLTPEMMVYFLTFQW
Ga0075425_10302595723300006854Populus RhizosphereMESDPIIRKGNARVRGAALAFVFLCAFAALSWAIFRGYMTPDMMIYFLSFKWCFG*
Ga0079217_1000287033300006876Agricultural SoilMNARTRNATLAFVGLLVFALASWAIFRGYLTPEMMVYYLTFQWCL*
Ga0079215_1101455223300006894Agricultural SoilMNARTRNATLAFVGLLVFALASWAIFRGYLTPEMMVYYLTF
Ga0079216_1014200213300006918Agricultural SoilRRAGARRAMNARTRQSLWGFLALCAFAVMSWLIFRGYLTPEMMVYFLSFRWCF*
Ga0079216_1054374713300006918Agricultural SoilMNAKTRQAAVAFVALLAFAALSWAIFRGYLTPEMLVYFLSFRWCF*
Ga0079216_1056664223300006918Agricultural SoilMNARTRNATLAFVGLLIFALVSWAIFRGYLTPEMMVYFLTFQWCL*
Ga0097620_10107858523300006931Switchgrass RhizosphereMSARARQSLWVVIALCAFAALSWVIFRGYLTPEMMVYFLSFRWCF*
Ga0079218_1006917223300007004Agricultural SoilMNARTRQSFVVFIALCAFALASWAIFVGYLTPEMMVYFLTFRWCF*
Ga0079218_1046877843300007004Agricultural SoilMHESHRPGRARTRNATLAFAGLLAFAVASWAIFRGYLTPEMMVYFLTFQWCL*
Ga0079218_1105469823300007004Agricultural SoilMSAMNARTRNATLAFLGLLAFALGSWAIFRGYLTPEMMVYFLTFQWCL*
Ga0079218_1166244723300007004Agricultural SoilMNARTRNASLAFVGLLLFALASWAIFRGYLTPEMMVYFLTFQWCL*
Ga0079218_1374180123300007004Agricultural SoilMMNPRTRQSLWIFLGLGAFASLSWAIFRGYLTPEMMVYFLSFRWCF*
Ga0075435_10178620813300007076Populus RhizosphereRVRGAALAFVFLCAFAALSWAIFRGYMTPDMMIYFLSFKWCFG*
Ga0066710_10437620723300009012Grasslands SoilMNARTRQSLWVVLGVSAFAAISWLVFLGYLTPEMMVYFLSFRWCF
Ga0105106_1016551023300009078Freshwater SedimentMNARTRQAAVVFVLMLAFAMLSWMIFRGYLTPEMMVYFLTFQWCF*
Ga0105107_1084829113300009087Freshwater SedimentMNARTRQAAVVFVLMLGFAMLSWMIFRGYLTPEMMVYFLTFQWCF*
Ga0111539_1233573213300009094Populus RhizosphereMNARTRNAGLAFVGLLGFALASWAIFRGYLTPEMMVYFLTFQWCL*
Ga0105243_1026567413300009148Miscanthus RhizosphereMNARTRRASVVFVALCAFATVSWLVFRGYLTPEMMVYFL
Ga0105243_1166886823300009148Miscanthus RhizosphereMNARTRQATITFVALCAFAMLSWLIFRGYLTPEMMVYFLSFKWCF*
Ga0105249_1123101823300009553Switchgrass RhizosphereMNARTRKALWIFLALCAFAMLSWLIFVGYLTPEMMVYFLSFRWCL*
Ga0105347_103853823300009609SoilMNARTRNATLAFIGMLLFALASWAIFRGYLTPEMMVYYLTLQWCF*
Ga0105347_149861423300009609SoilMNARTRNATLAFAGLLLFALVSWAIFRGYLTPEMMVYFLTFQWCL*
Ga0131092_1014555933300009870Activated SludgeMSPRTRNALVAAVVLGAFAAVSFLVFRGYLTPEMMAYFLSFKWCF*
Ga0131077_1050311323300009873WastewaterMNARTRNASLAFVGMLVFALASWAIFRGYLTPEMMVYFLTFQWCM*
Ga0134062_1057877613300010337Grasslands SoilMNARTRQSLWVFLGVCAFAAISWLVFLGYLTPEMMVYFLSFKWCF*
Ga0134124_1138961023300010397Terrestrial SoilMNARTRQASVAIAALCAFATVSWLVFRGYLTPEMMVYFLSFRWCF*
Ga0134124_1277367123300010397Terrestrial SoilASAGARGAGAGAMNARTRRASVVFVALCAFATISWLVFRGYLTPEMMVYFLSFRWCF*
Ga0134127_1190064023300010399Terrestrial SoilMSVRARQSLWVVLALCAFAALSWVIFRGYLTPEMMVYFLSFRWCF*
Ga0134121_1251959023300010401Terrestrial SoilLNQRARHSLYAFFAMCAFAALSWTIFRGYLTPEMMVYFLSFKWCF*
Ga0134121_1285848213300010401Terrestrial SoilMNARTRQATITFVALCAFAMVSWLIFRGYLTPEMMVYFLSFKWCF*
Ga0134123_1007814223300010403Terrestrial SoilMNARTRQSLVLFLVLCAFAMLSWVIFRGYLTPEMMVYFLSFRWCF*
Ga0134123_1335847723300010403Terrestrial SoilMNARTRNAILAFAGVLAFAAASWAIFRGYLTPEMMVYFLTF
Ga0126356_1053719723300010877Boreal Forest SoilMNARTRQASWVVVGLCAFAAASWAIFREYLTPDMMVYFLSFKWCF*
Ga0126350_1203338223300010880Boreal Forest SoilMNPRTRRATWVFVGLCAFAAASWAIFRGYLTPDMMVYFLSFKWCF*
Ga0137314_109690423300011420SoilMNARTRNATVAFVGLLAFALASWAIFRGYLTPEMMVYYLTLQWCF*
Ga0150985_11252627323300012212Avena Fatua RhizosphereMNAKTRKASLAFVFLCAFALLSWAIFRGYMTPEMMIYFLSFKWCFG*
Ga0137367_1121585213300012353Vadose Zone SoilMNPQTTRATAIFLALCAFAVVSWVIFRGYLTPEMMVYFLSFRWCI*
Ga0157216_1013432523300012668Glacier Forefield SoilVNARTRNAALAFTALCAFAIVSWMIFLGYLTPEMMVYFLTFQWCF*
Ga0157216_1017667823300012668Glacier Forefield SoilMNARIRNATLAFVGLLVFALASWAIFRGYLTPEMMVYYLTFQWCL*
Ga0136614_1119356713300012684Polar Desert SandMNARTRQAAVAFVAMLAFAMLSWLIFRGYLTPEMMVYFLSFKWCF*
Ga0157309_1035556213300012895SoilRLIVFAAALAFAAASWVIFRGYLTPEMMVYFLSFKWCF*
Ga0157288_1013637413300012901SoilVKARARQGLIVFAAALAFAAASWVIFRGYLTPEMMVY
Ga0157296_1035434023300012905SoilMNARARQSLVVFLALCAFALLSWIIFRGYLTPEMMVYFLSFRWCL*
Ga0157310_1029496213300012916SoilMNARTRNASLAFGGLLIFALASWAIFRGYLTPEMMVYFLTFQWCL*
Ga0137410_1155493813300012944Vadose Zone SoilTRQAAVALLALGAFAALSFVIFRGYLTPEMMVYFLSFKWCF*
Ga0164302_1173937923300012961SoilMNARTRRASLAFIFLCAFALLSWAIFRGYMTPEMMIYFLSFKWCFG*
Ga0164309_1127758513300012984SoilTRGARRAAVGFIAMLAFAVVSGMAFVGYLTPGMLVYFLSFKWCL*
Ga0163162_1175181923300013306Switchgrass RhizosphereMNAQTRRSLWIFLALCAFVMLSWLIFVGYLTPEMMVYFLSFRWC
Ga0163162_1219001223300013306Switchgrass RhizosphereMNARTRRSLWIFLALCAFAMLSWLIFVGYLTPEMMVYFLSFRWCL*
Ga0134079_1010749523300014166Grasslands SoilSTRARARGAMNARTRRSLWIFLALCAFAMLSWVIFVGYLTPEMMVYFLTFRCCL*
Ga0157380_1150355123300014326Switchgrass RhizosphereMNARTRNATLAFIGLLAFAFASLAIFRGYLTPEMMVYFLTFQWCL*
Ga0157380_1174797023300014326Switchgrass RhizosphereMNARTRNATLAFAAVLAFAAASWAIFRGYLTPEMMVYFLTFQWCL*
Ga0157380_1206256523300014326Switchgrass RhizosphereMNARTRQSLVVFVVLCAFALVSWVVFRGYLTPEMMVYFLTFRWCF*
Ga0180090_101383913300014866SoilMNARTRNATLAFAGLLLFALVSWAIFRGYLTPEMMVYYLTLQWCF*
Ga0167657_100087423300015079Glacier Forefield SoilMMTNASPPRRTRQALVALLALSAFAALSWVIFRGYLTPEMMVYFLSFKWCF*
Ga0167655_103338723300015086Glacier Forefield SoilMNPETRRAGYLFIALCAFALLSWVIFRGYLTPEMMVYFLSFKWCF*
Ga0173480_1074188223300015200SoilMNARTRNATLAFAGVLAFAAASWAIFRGYLTPEMMVYFLTFQWCL*
Ga0137409_1051477923300015245Vadose Zone SoilMDEASRPRRTRQAAVALLALCAFAALSWVIFAGYLTPEMMVYFLSFKWCF*
Ga0132258_1024381523300015371Arabidopsis RhizosphereMNPNARRSLWIFLALCAFAMLSWLIFVGYLTPEMMVYFLSFRWCL*
Ga0132258_1024972623300015371Arabidopsis RhizosphereMQAKTRQSLVAFVALCAFALLSWAVFRGYLTPEMMVYFLSFKWCL*
Ga0132258_1048263033300015371Arabidopsis RhizosphereVNPRTRQGLIVFAATLVFAAASWVIFRGYLTPEMMVYFLSFKWCF*
Ga0132257_10120641923300015373Arabidopsis RhizosphereVNPRTRQGLIVFAATLAFAAASWVIFRGYLTPEMMVYFLSFKWCF*
Ga0132257_10141103833300015373Arabidopsis RhizosphereKATLAFAFLCAFALLSWAIFRGYMTPEMMLYFLSFKWCF*
Ga0163161_1139153323300017792Switchgrass RhizosphereMNARTRKSLGIFLALCAFAMLSWLIFVGYLTPEMMVYFLSFRWCL
Ga0163161_1144516123300017792Switchgrass RhizosphereMKLQVRQSLVAFLAMCAFATVSWLVFRGYLTPEMMVYFLSFKWCF
Ga0190266_1029840023300017965SoilMTPRARQAAVTCVAVLGFATLSWLIFRGYLTPEMMVYFLSFRWCF
Ga0190266_1091773823300017965SoilMNARTRQAFGVFFALCAFAMLSWLIFVGYLTPEMMVYFLSFRWCF
Ga0187787_1007407323300018029Tropical PeatlandMPARTRRAAWIVAGAAAFAAASYFAFRGYLTADMMVYFLSFKWCF
Ga0184637_1059869023300018063Groundwater SedimentMNARMRRATLAFVALLGFAMLSWLIFLGYLTPEMMVYFLTFQWCF
Ga0184632_1001978123300018075Groundwater SedimentMTDVSRSRRLRQSTLVFLGLCAFAALSWLIFRGYLTPEMMVYFLSFKWCF
Ga0184629_1002896433300018084Groundwater SedimentVSARLRQQVAIFVGLCAFAVVSWLIFRGYLTPEMMVYFLSFKWCF
Ga0190272_1036817823300018429SoilMNARTRNATLAFVGLLVFALASWAIFRGYLTAEMMVYYLTFQWCL
Ga0190272_1329331023300018429SoilMSARTRQSLWVVLALCAFAALSWVIFRGYLTPEMMVYFLSFRWCF
Ga0190274_1067362923300018476SoilMNARTRRSFAVFLALCAFASLSWLIFVGYLTPEMMVYFLSFRWCF
Ga0190274_1068726723300018476SoilMNARTRQSFVVFLGLCAFALLSWIIFRGYLTPEMMVYFLSFRWCF
Ga0190274_1157444933300018476SoilPPRHEPMNARTRNATMAFVGLLAFALASWAIFRGYLTPEMMVYYLTFQWCL
Ga0190274_1160470713300018476SoilMNPRTRNATLGFMALLAFALASWMIFRGYLTPEMMVYFLTFQWCL
Ga0190274_1176402723300018476SoilMAPHTRQSLYVFLGMCAFAAASWLIFRGYLTPEMMVYFLSFKWCF
Ga0190274_1283339323300018476SoilMNARTRQSFVVFVVLCAFAVVSWIIFRGYLTPEMMVYFLSFRWCL
Ga0190274_1286060523300018476SoilMNARTRNASLAFGGLLIFALASWAIFRGYLTPEMMVYFLTFQWCL
Ga0190271_1098595823300018481SoilMNARTRNATVAFVGLLAFALASWAIFRGYLTPEMMVYYLTFQWCL
Ga0190271_1176009023300018481SoilMNARTRRSLFVFLALCAFASLSWLIFVGYLTPEMMVYFLSFRWCF
Ga0190271_1180346723300018481SoilMNTRTRNATLAFIGMLLFALASWAIFRGYLTPEMMVYFLTFQWCL
Ga0190271_1291396223300018481SoilVNARARQATIAFVALLAFAALSWALFRGYLTPEMMVYFLSFKWCF
Ga0190271_1368270723300018481SoilMNARVRNASLAFVGLLVFALASWAIFRGYLTPDMMVYYLTFQWCL
Ga0066669_1110678523300018482Grasslands SoilVTTRARHALVFLGLGAFAAVSWLVFRGYLTPEMMVYFLSFRWCF
Ga0196977_1000046503300020146SoilMNAKTRQAAIAFAALCGFAALSWAIFRGYLTPEMMVYFLSFRWCF
Ga0196964_1022006913300020202SoilPAGDAGARVMQPRTLKATAGFIALLAFALLSWLIFRGYVTPEMLVYFLSFRWCF
Ga0196963_1010661023300020215SoilVSPHPEVRRAAIGFALLLAMALLSWLIFRGYLTPEMMVYFLTFQWCF
Ga0210399_1069725823300020581SoilMNARTRRATWVFVGLCAFAAASWAIFRGYLTPDMMVYFLSFKWCF
Ga0213876_1033752123300021384Plant RootsMTRDTRRAAWTFAALAAFAVASWAAFRGYLTPEMLVYFISFRWCL
Ga0182009_1073937423300021445SoilMTREMRRAAWTIAALAAFAAASWAAFRGYLTPEMLVYFISFRWCL
Ga0179591_106587933300024347Vadose Zone SoilMQPRVKNSLYVVVGTTAFVVASWAAFAGYLSPEMMVYFLSFKWCF
Ga0207688_1001754243300025901Corn, Switchgrass And Miscanthus RhizosphereVNSRTRQGLIVVAAALAFAAASWVIFRGYLTPEMMVYFLSFKWCF
Ga0207680_1054849623300025903Switchgrass RhizosphereMNAQTRRSLWIFLALCAFAMLSWLIFVGYLTPEMMVYFLSFRWCL
Ga0207645_1070010223300025907Miscanthus RhizosphereVKARARQGLIVFAAALAFAAASWVIFRGYLTPEMMVYFLSFKWCF
Ga0207705_1041548623300025909Corn RhizosphereMTRETRRAAWTFAALAAFAMASWAAFRGYLTPEMLVYFISFRWCL
Ga0207705_1064117013300025909Corn RhizosphereVNARTRNASLAFIFLCAFALLSWAIFRGYMTPDMMIYFLSFKWCFG
Ga0207662_1066713423300025918Switchgrass RhizosphereMNARTRRASVVFVALCAFATISWLVFRGYLTPEMMVYFL
Ga0207662_1077914423300025918Switchgrass RhizosphereMNARTRRSLWIFLALCAFAMLSWLIFVGYLTPEMMVYFLSFRWCL
Ga0207646_1046913223300025922Corn, Switchgrass And Miscanthus RhizosphereMNPRTRHSLYVFLGLCAFATLSWMIFRGYLTPEMMVYFLSFKWCF
Ga0207681_1046781713300025923Switchgrass RhizosphereVKARARQGLIVFAAALAFAAASWVIFRGYLTPEMMVYFISFKWCF
Ga0207694_1147954423300025924Corn RhizosphereMNARTRQSFVVFVAVCAFALVSWVIFRGYLTPEMMVYFLSFRWCF
Ga0207659_1016738543300025926Miscanthus RhizosphereVNSRTRQGLIVFAAALAFAAASWVIFRGYLTPEMMVYFLSFKWCF
Ga0207659_1024801123300025926Miscanthus RhizosphereMNARTRQSLLVFLGLCAFALLSWIIFRGYLTPEMMVYFLSFRWCL
Ga0207686_1006115753300025934Miscanthus RhizosphereMNARTRQSFVVFVAVCAFALVSWVIFRGYLTPEMMVYFLTFRWCF
Ga0207669_1027521623300025937Miscanthus RhizosphereMTNARTRRAALAFVALCAFALVSWAVFRGYLTPEMMVYYLTFQWCL
Ga0207669_1119370713300025937Miscanthus RhizosphereMNARTRNATLAFAGVLAFAAASWAIFRGYLTPEMMVYFLTFQWCL
Ga0207661_1215512413300025944Corn RhizosphereFIFLCAFALLSWAIFRGYMTPEMMIYFLSFKWCFG
Ga0207651_1033653923300025960Switchgrass RhizosphereMNARTRQSFLVCLGLCAFALLSWIIFRGYLTPEMMVYFLSFRWCL
Ga0207651_1185469523300025960Switchgrass RhizosphereAARGPHGAGAGAMSARTRQSLVVFVVVCAFALVSWVVFRGYLTPEMMVYFLTFRWCF
Ga0207712_1212749223300025961Switchgrass RhizosphereMNARTRKALWIFLALCAFAMLSWLIFVGYLTPEMMVYFLSFRWCL
Ga0207640_1168035413300025981Corn RhizosphereRAAAGFVAMLAFAVVSWMAFVGYLTPGMLVYFLSFKWCL
Ga0207703_1112523923300026035Switchgrass RhizosphereMNARTRRASVVFVALCAFATISWLVFRGYLTPEMMVYFLSFRWCF
Ga0207639_1026833223300026041Corn RhizosphereMTRGARRAAVGFVAMLAFAVVSWMAFVGYLTPGMLVYFLSFKWCL
Ga0207708_1056098023300026075Corn, Switchgrass And Miscanthus RhizosphereVNPRTRQGLIFFAATLAFAAASWVIFRGYLTPEMMVYFLSFKWCF
Ga0207641_1036577823300026088Switchgrass RhizosphereMNRPVRQALVAFLAMCAFATVSWMIFRGYLTPEMMVYFLSFKWCLYKQA
Ga0207641_1134464413300026088Switchgrass RhizosphereMNAQTRRSLWIFLALCAFAMLSWVIFVGYLTPDMMVYFLTFKWCL
Ga0207648_1178868823300026089Miscanthus RhizosphereVNSRTRQALIVFAAALAFAAASWVIFRGYLTPEMMVYFLSFKWCF
Ga0207648_1179266123300026089Miscanthus RhizosphereMTNARTRGAALAFVALCAFALVSWAVFRGYLTPEMMVYYLTFQWCL
Ga0207683_1079516023300026121Miscanthus RhizosphereMNPRALRAAAISAAVLGFAALSWLIFLGYLTPEMLVYFLSFRWCF
Ga0207698_1055652523300026142Corn RhizosphereMTRGARRAAVGFVAMLAFAVVSWMAFVGYLTPGMLVYFLS
Ga0207698_1081594923300026142Corn RhizosphereVNARTRNASLAFIFLCAFALLSWAIFRGYMTPEMMIYFLSFKWCFG
Ga0209131_1000662153300026320Grasslands SoilMSVRTRQSLWVVLAVCAFAALSWVIFRGYLTPEMMVYFLSFRWCF
Ga0209387_120529523300027639Agricultural SoilMNARTRNATLAFVGLLVFALASWAIFRGYLTPEMMVYYLTFQWCL
Ga0209117_108928323300027645Forest SoilMNARTRQSLAVFFALCLFAMASWLIFLGYLTPEMMTYFLSFKWCF
Ga0209485_107579023300027691Agricultural SoilMNARTRNATLAFVGLLVFALASWAIFRGYLTPEMMVYY
Ga0209966_104901113300027695Arabidopsis Thaliana RhizosphereMNARTRQSFVVFLMLCAFAALSWVVFRGYLTPEMMVYFLSFRWCF
Ga0209706_1057026213300027818Freshwater SedimentMNARTRQAAVVFVLMLGFAMLSWMIFRGYLTPEMMVYFLTFQWCF
Ga0209579_1003191633300027869Surface SoilMNPRTRQATWVFVGLCAFAAASWAIFRGYLTPDMMVYFLSFKWCF
Ga0209486_1008294933300027886Agricultural SoilMNARTRQSFVVFIALCAFALASWAIFVGYLTPEMMVYFLTFRWCF
Ga0209486_1070686923300027886Agricultural SoilMHESHRPGRARTRNATLAFAGLLAFAVASWAIFRGYLTPEMMVYFLTFQWCL
Ga0209705_1055554623300027979Freshwater SedimentMNARTRQAAVVFVLMLAFAMLSWMIFRGYLTPEMM
Ga0268265_1064544213300028380Switchgrass RhizosphereVRARARQSLIVFAAALAFAAASWVIFRGYLTPEMMVYFLSFKW
Ga0073997_1181216223300030997SoilVNEARRPRRTRRAAVAVLALGAFAALSFVIFRGYLTPEMMVYFLSFKWCF
Ga0170824_11051949823300031231Forest SoilMNPRTRRATWVFVGLCAFAAASWAIFLGYLTPDMMVYFLSFKWCF
(restricted) Ga0255312_113957623300031248Sandy SoilMNARARKATLAFAGALVFALASWAIFRGYLTPEMMVYFLSFQWCL
Ga0307408_10028382523300031548RhizosphereMNARTRNASLAFVGMLLFALASWAIFRGYLTADMMVYFLTFQWCM
Ga0307408_10031916413300031548RhizosphereMNARVRNAAFVFAGLLAFAAASWAIFRGYLTPEMMVYFLTFQWCL
Ga0307408_10096224123300031548RhizosphereMNPRTRGALWMFLGMLAFAMASWLIFRGYLTPEMMVYFLSFRWCF
Ga0307408_10227414913300031548RhizosphereNAAFVFAGLLAFAAASWAIFRGYLTPEMMVYFLTFQWCL
Ga0310886_1108406623300031562SoilMNARTRNAGLAFVGLLGFALASWAIFRGYLTPEMMVYFLTFQWCL
Ga0307405_1050248523300031731RhizosphereMNARTRNATLAFMGLLLFALASWAIFRGYLTPEMMVYFLTFQWCL
Ga0307468_10165110423300031740Hardwood Forest SoilMNARTRNASLAFVGLLGFALASWAIFRGYLTPEMMVYFLSFKWCF
Ga0307413_1081201523300031824RhizosphereMTTGTNPTLRRATVTFVVLCGFAMLSWLIFRGYLTPEMMVYFLTFQWCL
Ga0307413_1109401623300031824RhizosphereMDANVRKAAAGFVALCAFALLSWAIFRGYLTPEMMVYFLSFKWCL
Ga0310904_1036241223300031854SoilMTNARTRRAALAFVALCAFALVSCAVFRGYLTPEMMVYYLTFQWCL
Ga0307406_1063802423300031901RhizosphereMNPRTRNATLGFVALLGFAVVSWAVFRGYLTPEMMVYFLTFQWCL
Ga0307412_1075098223300031911RhizosphereMNARTRGALWMFLGMLAFAMASWLIFRGYLTPEMMVYFLSFRWCF
Ga0308175_10009678223300031938SoilMTRQTRRAAWTFAALAAFAMASWAAFRGYLTPEMLVYFISFRWCL
Ga0308174_1113232723300031939SoilMNASALKPLWIFMGLCAFAVVSWLIFLGYLTPEMMVYFLTFRWCL
Ga0310901_1051709713300031940SoilVNPRTRQGLIVFAATLAFAAASWVIFRGYLTPEMMVYFLSFKWCF
Ga0307416_10335651913300032002RhizosphereEAMNARVRNAAFLFAGLLAFAAASWAIFRGYLTPEMMVYFLTFQWCL
Ga0307411_1080147423300032005RhizosphereMNPRTRNATLGFVALLGFAVVSWAVFRGYLTPEMMVYFLTF
Ga0310890_1165571413300032075SoilPRPPEMTNARTRRAALAFVALCAFALVSWAIFRGYLTPEMMVYYLTFQWCL
Ga0315910_1159987023300032144SoilMNARTRRSLLVFVGLCAFAMLSWLIFVGYLTPEMMVYFLSFRWCF
Ga0310812_1027596723300032421SoilMNAQTRRSLWIFLALCAFAMLSWLIFVGYLTPEMMVYFLTFRWCL
Ga0335085_1039401123300032770SoilMSARARRAGWVFVGLCAFAAASWVIFRGYLTPDMMVYFLSFKWCF
Ga0335082_1011408653300032782SoilMDARVRRASWIVVGVAAFAAASFLAFRGYLTADMMVYFLSFKWCF
Ga0335082_1015897723300032782SoilMNARTRQATWVFVGLCAFAAASWAIFRGYLTPDMMVYFLSFRWCF
Ga0335079_1004310033300032783SoilMSARARQAGWVFVGLCAFAAASWVIFRGYLTPDMMVYFLSFKWCF
Ga0335070_1001427563300032829SoilMSARARQAGWVFAGLCAFAAASWVIFRGYLTPDMMVYFLSFKWCF
Ga0335070_1027971613300032829SoilMNPRTRRSTWTFVGLCAFAMASWAVFRGYLTPDMAVYYL
Ga0335083_1026202523300032954SoilAGERVMNARTRQATWVFVGLCAFAAASWAIFRGYLTPDMMVYFLSFRWCF
Ga0335084_1023307423300033004SoilMNARTRNASLAFVGLCLFALASWLIFRGYLTPGMMVYFLSFKWCL
Ga0335084_1133034923300033004SoilMSARTRQATWVFVGLCAFAAASWAIFRGYLTPDMMVYFLSFRWCF
Ga0214472_1026991023300033407SoilMNARIRQAAVVFALMLAFAMLSWMIFRGYLTPEMMVYFLTFQWCF
Ga0247829_1175907513300033550SoilMNARTRNATLAFIGLLAFALASWAIFRGYLTPEMMVYFLTFQWCL
Ga0247830_1078246013300033551SoilGGRRRRPPEAMNARTRNATLAFIGLLAFALASWAIFRGYLTPEMMVYFLTFQWCL
Ga0314864_0049112_154_2943300033805PeatlandVTTARARQATWVFVGLCAFAAASWVIFRGYLTPDMMMYFLSFKWCF
Ga0372946_0075433_871_10083300034384SoilMNARTRQSLYVFLGMCVFAAVSWLIFRGYLTPEMMVYFISFKWCL


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.