Basic Information | |
---|---|
Family ID | F019200 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 231 |
Average Sequence Length | 45 residues |
Representative Sequence | MNARTRQATITFVALCAFAMLSWLIFRGYLTPEMMVYFLSFKWCF |
Number of Associated Samples | 169 |
Number of Associated Scaffolds | 231 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 30.87 % |
% of genes near scaffold ends (potentially truncated) | 19.48 % |
% of genes from short scaffolds (< 2000 bps) | 86.15 % |
Associated GOLD sequencing projects | 148 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.50 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (63.203 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (10.822 % of family members) |
Environment Ontology (ENVO) | Unclassified (40.693 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (48.918 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.68% β-sheet: 0.00% Coil/Unstructured: 49.32% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 231 Family Scaffolds |
---|---|---|
PF07690 | MFS_1 | 38.10 |
PF13619 | KTSC | 2.60 |
PF01381 | HTH_3 | 2.16 |
PF01625 | PMSR | 1.73 |
PF00480 | ROK | 0.87 |
PF04226 | Transgly_assoc | 0.43 |
PF01339 | CheB_methylest | 0.43 |
PF05199 | GMC_oxred_C | 0.43 |
PF01385 | OrfB_IS605 | 0.43 |
PF00005 | ABC_tran | 0.43 |
PF00664 | ABC_membrane | 0.43 |
PF01594 | AI-2E_transport | 0.43 |
PF13560 | HTH_31 | 0.43 |
PF13502 | AsmA_2 | 0.43 |
PF13098 | Thioredoxin_2 | 0.43 |
PF03928 | HbpS-like | 0.43 |
PF02576 | RimP_N | 0.43 |
PF12867 | DinB_2 | 0.43 |
PF09285 | Elong-fact-P_C | 0.43 |
PF11954 | DUF3471 | 0.43 |
COG ID | Name | Functional Category | % Frequency in 231 Family Scaffolds |
---|---|---|---|
COG0225 | Peptide methionine sulfoxide reductase MsrA | Posttranslational modification, protein turnover, chaperones [O] | 1.73 |
COG1940 | Sugar kinase of the NBD/HSP70 family, may contain an N-terminal HTH domain | Transcription [K] | 1.73 |
COG2201 | Chemotaxis response regulator CheB, contains REC and protein-glutamate methylesterase domains | Signal transduction mechanisms [T] | 0.87 |
COG0628 | Predicted PurR-regulated permease PerM | General function prediction only [R] | 0.43 |
COG0675 | Transposase | Mobilome: prophages, transposons [X] | 0.43 |
COG0779 | Ribosome maturation factor RimP | Translation, ribosomal structure and biogenesis [J] | 0.43 |
COG2261 | Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family | General function prediction only [R] | 0.43 |
COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 0.43 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 63.20 % |
Unclassified | root | N/A | 36.80 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2199352024|deeps__Contig_179890 | Not Available | 965 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_105800813 | Not Available | 1432 | Open in IMG/M |
3300000956|JGI10216J12902_100391234 | Not Available | 516 | Open in IMG/M |
3300000956|JGI10216J12902_102431918 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 500 | Open in IMG/M |
3300002907|JGI25613J43889_10017320 | All Organisms → cellular organisms → Bacteria | 2016 | Open in IMG/M |
3300002917|JGI25616J43925_10168081 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 866 | Open in IMG/M |
3300003315|P22013IDBA_10010180 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 4639 | Open in IMG/M |
3300004114|Ga0062593_100037908 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2848 | Open in IMG/M |
3300004114|Ga0062593_102726579 | Not Available | 563 | Open in IMG/M |
3300004156|Ga0062589_102131797 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 572 | Open in IMG/M |
3300004157|Ga0062590_101892519 | Not Available | 615 | Open in IMG/M |
3300004157|Ga0062590_102301071 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Usitatibacteraceae → Usitatibacter → Usitatibacter palustris | 566 | Open in IMG/M |
3300004463|Ga0063356_100105647 | All Organisms → cellular organisms → Bacteria | 3072 | Open in IMG/M |
3300004463|Ga0063356_101004072 | All Organisms → cellular organisms → Bacteria | 1192 | Open in IMG/M |
3300004463|Ga0063356_101857732 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
3300004463|Ga0063356_104634303 | Not Available | 591 | Open in IMG/M |
3300004463|Ga0063356_104734810 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
3300004463|Ga0063356_104858804 | Not Available | 578 | Open in IMG/M |
3300004463|Ga0063356_105749654 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 532 | Open in IMG/M |
3300004643|Ga0062591_100335118 | All Organisms → cellular organisms → Bacteria | 1213 | Open in IMG/M |
3300004778|Ga0062383_10473955 | Not Available | 624 | Open in IMG/M |
3300005327|Ga0070658_10191984 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1721 | Open in IMG/M |
3300005327|Ga0070658_10267511 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1453 | Open in IMG/M |
3300005330|Ga0070690_100291688 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1167 | Open in IMG/M |
3300005334|Ga0068869_100051489 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2988 | Open in IMG/M |
3300005340|Ga0070689_100282992 | Not Available | 1376 | Open in IMG/M |
3300005340|Ga0070689_101171433 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 689 | Open in IMG/M |
3300005343|Ga0070687_100772378 | Not Available | 678 | Open in IMG/M |
3300005344|Ga0070661_100445192 | Not Available | 1030 | Open in IMG/M |
3300005354|Ga0070675_100076623 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2782 | Open in IMG/M |
3300005356|Ga0070674_100475027 | All Organisms → cellular organisms → Bacteria | 1037 | Open in IMG/M |
3300005438|Ga0070701_10016732 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 3415 | Open in IMG/M |
3300005438|Ga0070701_10667776 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 695 | Open in IMG/M |
3300005441|Ga0070700_100161098 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1544 | Open in IMG/M |
3300005456|Ga0070678_100546448 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Usitatibacteraceae → Usitatibacter → Usitatibacter palustris | 1028 | Open in IMG/M |
3300005468|Ga0070707_101766009 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
3300005471|Ga0070698_101029346 | Not Available | 771 | Open in IMG/M |
3300005530|Ga0070679_101095577 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Usitatibacteraceae → Usitatibacter → Usitatibacter palustris | 741 | Open in IMG/M |
3300005538|Ga0070731_10004167 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 12593 | Open in IMG/M |
3300005539|Ga0068853_101543537 | Not Available | 643 | Open in IMG/M |
3300005539|Ga0068853_102326938 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Usitatibacteraceae → Usitatibacter → Usitatibacter palustris | 519 | Open in IMG/M |
3300005543|Ga0070672_100105632 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2290 | Open in IMG/M |
3300005543|Ga0070672_100845660 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
3300005547|Ga0070693_100447076 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Usitatibacteraceae → Usitatibacter → Usitatibacter palustris | 906 | Open in IMG/M |
3300005575|Ga0066702_10440390 | Not Available | 798 | Open in IMG/M |
3300005578|Ga0068854_101184509 | Not Available | 684 | Open in IMG/M |
3300005615|Ga0070702_100416454 | Not Available | 965 | Open in IMG/M |
3300005617|Ga0068859_102179657 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Usitatibacteraceae → Usitatibacter → Usitatibacter palustris | 611 | Open in IMG/M |
3300005719|Ga0068861_100602085 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1009 | Open in IMG/M |
3300005836|Ga0074470_10526495 | Not Available | 506 | Open in IMG/M |
3300005840|Ga0068870_11126585 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
3300005841|Ga0068863_100614080 | All Organisms → cellular organisms → Bacteria | 1077 | Open in IMG/M |
3300006102|Ga0075015_100194306 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1077 | Open in IMG/M |
3300006173|Ga0070716_100760517 | Not Available | 746 | Open in IMG/M |
3300006237|Ga0097621_100319808 | Not Available | 1374 | Open in IMG/M |
3300006358|Ga0068871_100827818 | Not Available | 855 | Open in IMG/M |
3300006755|Ga0079222_10706054 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae | 799 | Open in IMG/M |
3300006797|Ga0066659_11696048 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 533 | Open in IMG/M |
3300006844|Ga0075428_102341195 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
3300006854|Ga0075425_103025957 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
3300006876|Ga0079217_10002870 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 4884 | Open in IMG/M |
3300006894|Ga0079215_11014552 | Not Available | 612 | Open in IMG/M |
3300006918|Ga0079216_10142002 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Usitatibacteraceae → Usitatibacter → Usitatibacter palustris | 1237 | Open in IMG/M |
3300006918|Ga0079216_10543747 | Not Available | 781 | Open in IMG/M |
3300006918|Ga0079216_10566642 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
3300006931|Ga0097620_101078585 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
3300007004|Ga0079218_10069172 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2288 | Open in IMG/M |
3300007004|Ga0079218_10468778 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1101 | Open in IMG/M |
3300007004|Ga0079218_11054698 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
3300007004|Ga0079218_11662447 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
3300007004|Ga0079218_13741801 | Not Available | 517 | Open in IMG/M |
3300007076|Ga0075435_101786208 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Usitatibacteraceae → Usitatibacter → Usitatibacter palustris | 540 | Open in IMG/M |
3300009012|Ga0066710_104376207 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Usitatibacteraceae → Usitatibacter → Usitatibacter palustris | 528 | Open in IMG/M |
3300009078|Ga0105106_10165510 | Not Available | 1622 | Open in IMG/M |
3300009087|Ga0105107_10848291 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 636 | Open in IMG/M |
3300009094|Ga0111539_12335732 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
3300009148|Ga0105243_10265674 | Not Available | 1538 | Open in IMG/M |
3300009148|Ga0105243_11668868 | Not Available | 665 | Open in IMG/M |
3300009553|Ga0105249_11231018 | Not Available | 820 | Open in IMG/M |
3300009609|Ga0105347_1038538 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1689 | Open in IMG/M |
3300009609|Ga0105347_1498614 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Usitatibacteraceae → Usitatibacter → Usitatibacter palustris | 529 | Open in IMG/M |
3300009870|Ga0131092_10145559 | All Organisms → cellular organisms → Bacteria | 2624 | Open in IMG/M |
3300009873|Ga0131077_10503113 | All Organisms → cellular organisms → Bacteria | 1121 | Open in IMG/M |
3300010337|Ga0134062_10578776 | Not Available | 575 | Open in IMG/M |
3300010397|Ga0134124_11389610 | Not Available | 727 | Open in IMG/M |
3300010397|Ga0134124_12773671 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Usitatibacteraceae → Usitatibacter → Usitatibacter palustris | 534 | Open in IMG/M |
3300010399|Ga0134127_11900640 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 672 | Open in IMG/M |
3300010401|Ga0134121_12519590 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Usitatibacteraceae → Usitatibacter → Usitatibacter palustris | 557 | Open in IMG/M |
3300010401|Ga0134121_12858482 | Not Available | 529 | Open in IMG/M |
3300010403|Ga0134123_10078142 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2570 | Open in IMG/M |
3300010403|Ga0134123_13358477 | Not Available | 517 | Open in IMG/M |
3300010877|Ga0126356_10537197 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Usitatibacteraceae → Usitatibacter → Usitatibacter palustris | 907 | Open in IMG/M |
3300010880|Ga0126350_12033382 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1443 | Open in IMG/M |
3300011420|Ga0137314_1096904 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
3300012212|Ga0150985_112526273 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 603 | Open in IMG/M |
3300012353|Ga0137367_11215852 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
3300012668|Ga0157216_10134325 | Not Available | 1197 | Open in IMG/M |
3300012668|Ga0157216_10176678 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Usitatibacteraceae → Usitatibacter → Usitatibacter palustris | 1020 | Open in IMG/M |
3300012684|Ga0136614_11193567 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 515 | Open in IMG/M |
3300012895|Ga0157309_10355562 | Not Available | 511 | Open in IMG/M |
3300012901|Ga0157288_10136374 | Not Available | 715 | Open in IMG/M |
3300012905|Ga0157296_10354340 | Not Available | 533 | Open in IMG/M |
3300012916|Ga0157310_10294962 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Usitatibacteraceae → Usitatibacter → Usitatibacter palustris | 633 | Open in IMG/M |
3300012944|Ga0137410_11554938 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Usitatibacteraceae → Usitatibacter → Usitatibacter palustris | 578 | Open in IMG/M |
3300012961|Ga0164302_11739379 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Usitatibacteraceae → Usitatibacter → Usitatibacter palustris | 524 | Open in IMG/M |
3300012984|Ga0164309_11277585 | Not Available | 620 | Open in IMG/M |
3300013306|Ga0163162_11751819 | Not Available | 710 | Open in IMG/M |
3300013306|Ga0163162_12190012 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 635 | Open in IMG/M |
3300014166|Ga0134079_10107495 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1073 | Open in IMG/M |
3300014326|Ga0157380_11503551 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 726 | Open in IMG/M |
3300014326|Ga0157380_11747970 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Usitatibacteraceae → Usitatibacter → Usitatibacter palustris | 680 | Open in IMG/M |
3300014326|Ga0157380_12062565 | Not Available | 633 | Open in IMG/M |
3300014866|Ga0180090_1013839 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1198 | Open in IMG/M |
3300015079|Ga0167657_1000874 | All Organisms → cellular organisms → Bacteria | 6695 | Open in IMG/M |
3300015086|Ga0167655_1033387 | Not Available | 829 | Open in IMG/M |
3300015200|Ga0173480_10741882 | Not Available | 620 | Open in IMG/M |
3300015245|Ga0137409_10514779 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1021 | Open in IMG/M |
3300015371|Ga0132258_10243815 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium GR16-43 | 4388 | Open in IMG/M |
3300015371|Ga0132258_10249726 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium GR16-43 | 4336 | Open in IMG/M |
3300015371|Ga0132258_10482630 | Not Available | 3096 | Open in IMG/M |
3300015373|Ga0132257_101206419 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 958 | Open in IMG/M |
3300015373|Ga0132257_101411038 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Usitatibacteraceae → Usitatibacter → Usitatibacter palustris | 886 | Open in IMG/M |
3300017792|Ga0163161_11391533 | Not Available | 612 | Open in IMG/M |
3300017792|Ga0163161_11445161 | Not Available | 602 | Open in IMG/M |
3300017965|Ga0190266_10298400 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
3300017965|Ga0190266_10917738 | Not Available | 577 | Open in IMG/M |
3300018029|Ga0187787_10074073 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1050 | Open in IMG/M |
3300018063|Ga0184637_10598690 | Not Available | 624 | Open in IMG/M |
3300018075|Ga0184632_10019781 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium GR16-43 | 2849 | Open in IMG/M |
3300018084|Ga0184629_10028964 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2378 | Open in IMG/M |
3300018429|Ga0190272_10368178 | Not Available | 1155 | Open in IMG/M |
3300018429|Ga0190272_13293310 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Usitatibacteraceae → Usitatibacter → Usitatibacter palustris | 504 | Open in IMG/M |
3300018476|Ga0190274_10673629 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1074 | Open in IMG/M |
3300018476|Ga0190274_10687267 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1065 | Open in IMG/M |
3300018476|Ga0190274_11574449 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Usitatibacteraceae → Usitatibacter → Usitatibacter palustris | 749 | Open in IMG/M |
3300018476|Ga0190274_11604707 | Not Available | 743 | Open in IMG/M |
3300018476|Ga0190274_11764027 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 713 | Open in IMG/M |
3300018476|Ga0190274_12833393 | Not Available | 581 | Open in IMG/M |
3300018476|Ga0190274_12860605 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Usitatibacteraceae → Usitatibacter → Usitatibacter palustris | 579 | Open in IMG/M |
3300018481|Ga0190271_10985958 | All Organisms → cellular organisms → Bacteria | 967 | Open in IMG/M |
3300018481|Ga0190271_11760090 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 732 | Open in IMG/M |
3300018481|Ga0190271_11803467 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
3300018481|Ga0190271_12913962 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Usitatibacteraceae → Usitatibacter → Usitatibacter palustris | 574 | Open in IMG/M |
3300018481|Ga0190271_13682707 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Usitatibacteraceae → Usitatibacter → Usitatibacter palustris | 513 | Open in IMG/M |
3300018482|Ga0066669_11106785 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 715 | Open in IMG/M |
3300020146|Ga0196977_1000046 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 87786 | Open in IMG/M |
3300020202|Ga0196964_10220069 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Usitatibacteraceae → Usitatibacter → Usitatibacter palustris | 883 | Open in IMG/M |
3300020215|Ga0196963_10106610 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1180 | Open in IMG/M |
3300020581|Ga0210399_10697258 | Not Available | 835 | Open in IMG/M |
3300021384|Ga0213876_10337521 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
3300021445|Ga0182009_10739374 | Not Available | 535 | Open in IMG/M |
3300024347|Ga0179591_1065879 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2372 | Open in IMG/M |
3300025901|Ga0207688_10017542 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3891 | Open in IMG/M |
3300025903|Ga0207680_10548496 | Not Available | 825 | Open in IMG/M |
3300025907|Ga0207645_10700102 | Not Available | 689 | Open in IMG/M |
3300025909|Ga0207705_10415486 | Not Available | 1041 | Open in IMG/M |
3300025909|Ga0207705_10641170 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Usitatibacteraceae → Usitatibacter → Usitatibacter palustris | 826 | Open in IMG/M |
3300025918|Ga0207662_10667134 | Not Available | 727 | Open in IMG/M |
3300025918|Ga0207662_10779144 | Not Available | 673 | Open in IMG/M |
3300025922|Ga0207646_10469132 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1135 | Open in IMG/M |
3300025923|Ga0207681_10467817 | Not Available | 1028 | Open in IMG/M |
3300025924|Ga0207694_11479544 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Usitatibacteraceae → Usitatibacter → Usitatibacter palustris | 573 | Open in IMG/M |
3300025926|Ga0207659_10167385 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1731 | Open in IMG/M |
3300025926|Ga0207659_10248011 | Not Available | 1444 | Open in IMG/M |
3300025934|Ga0207686_10061157 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2387 | Open in IMG/M |
3300025937|Ga0207669_10275216 | Not Available | 1267 | Open in IMG/M |
3300025937|Ga0207669_11193707 | Not Available | 644 | Open in IMG/M |
3300025944|Ga0207661_12155124 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Usitatibacteraceae → Usitatibacter → Usitatibacter palustris | 504 | Open in IMG/M |
3300025960|Ga0207651_10336539 | Not Available | 1267 | Open in IMG/M |
3300025960|Ga0207651_11854695 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Usitatibacteraceae → Usitatibacter → Usitatibacter palustris | 542 | Open in IMG/M |
3300025961|Ga0207712_12127492 | Not Available | 502 | Open in IMG/M |
3300025981|Ga0207640_11680354 | Not Available | 573 | Open in IMG/M |
3300026035|Ga0207703_11125239 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Usitatibacteraceae → Usitatibacter → Usitatibacter palustris | 754 | Open in IMG/M |
3300026041|Ga0207639_10268332 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1496 | Open in IMG/M |
3300026075|Ga0207708_10560980 | All Organisms → cellular organisms → Bacteria | 964 | Open in IMG/M |
3300026088|Ga0207641_10365778 | All Organisms → cellular organisms → Bacteria | 1378 | Open in IMG/M |
3300026088|Ga0207641_11344644 | Not Available | 715 | Open in IMG/M |
3300026089|Ga0207648_11788688 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 576 | Open in IMG/M |
3300026089|Ga0207648_11792661 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 575 | Open in IMG/M |
3300026121|Ga0207683_10795160 | Not Available | 878 | Open in IMG/M |
3300026142|Ga0207698_10556525 | Not Available | 1125 | Open in IMG/M |
3300026142|Ga0207698_10815949 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 936 | Open in IMG/M |
3300026320|Ga0209131_1000662 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium GR16-43 | 24408 | Open in IMG/M |
3300027639|Ga0209387_1205295 | Not Available | 543 | Open in IMG/M |
3300027645|Ga0209117_1089283 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Usitatibacteraceae → Usitatibacter → Usitatibacter palustris | 853 | Open in IMG/M |
3300027691|Ga0209485_1075790 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 909 | Open in IMG/M |
3300027695|Ga0209966_1049011 | Not Available | 895 | Open in IMG/M |
3300027818|Ga0209706_10570262 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 511 | Open in IMG/M |
3300027869|Ga0209579_10031916 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2871 | Open in IMG/M |
3300027886|Ga0209486_10082949 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1670 | Open in IMG/M |
3300027886|Ga0209486_10706869 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 650 | Open in IMG/M |
3300027979|Ga0209705_10555546 | Not Available | 554 | Open in IMG/M |
3300028380|Ga0268265_10645442 | All Organisms → cellular organisms → Bacteria | 1017 | Open in IMG/M |
3300030997|Ga0073997_11812162 | Not Available | 549 | Open in IMG/M |
3300031231|Ga0170824_110519498 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2273 | Open in IMG/M |
(restricted) 3300031248|Ga0255312_1139576 | Not Available | 601 | Open in IMG/M |
3300031548|Ga0307408_100283825 | All Organisms → cellular organisms → Bacteria | 1380 | Open in IMG/M |
3300031548|Ga0307408_100319164 | All Organisms → cellular organisms → Bacteria | 1308 | Open in IMG/M |
3300031548|Ga0307408_100962241 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Usitatibacteraceae → Usitatibacter → Usitatibacter palustris | 785 | Open in IMG/M |
3300031548|Ga0307408_102274149 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Usitatibacteraceae → Usitatibacter → Usitatibacter palustris | 525 | Open in IMG/M |
3300031562|Ga0310886_11084066 | Not Available | 516 | Open in IMG/M |
3300031731|Ga0307405_10502485 | Not Available | 972 | Open in IMG/M |
3300031740|Ga0307468_101651104 | Not Available | 601 | Open in IMG/M |
3300031824|Ga0307413_10812015 | Not Available | 787 | Open in IMG/M |
3300031824|Ga0307413_11094016 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 688 | Open in IMG/M |
3300031854|Ga0310904_10362412 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 938 | Open in IMG/M |
3300031901|Ga0307406_10638024 | Not Available | 883 | Open in IMG/M |
3300031911|Ga0307412_10750982 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
3300031938|Ga0308175_100096782 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2707 | Open in IMG/M |
3300031939|Ga0308174_11132327 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 666 | Open in IMG/M |
3300031940|Ga0310901_10517097 | Not Available | 537 | Open in IMG/M |
3300032002|Ga0307416_103356519 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Usitatibacteraceae → Usitatibacter → Usitatibacter palustris | 536 | Open in IMG/M |
3300032005|Ga0307411_10801474 | Not Available | 829 | Open in IMG/M |
3300032075|Ga0310890_11655714 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Usitatibacteraceae → Usitatibacter → Usitatibacter palustris | 530 | Open in IMG/M |
3300032144|Ga0315910_11599870 | Not Available | 508 | Open in IMG/M |
3300032421|Ga0310812_10275967 | Not Available | 744 | Open in IMG/M |
3300032770|Ga0335085_10394011 | Not Available | 1609 | Open in IMG/M |
3300032782|Ga0335082_10114086 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium GR16-43 | 2660 | Open in IMG/M |
3300032782|Ga0335082_10158977 | All Organisms → cellular organisms → Bacteria | 2180 | Open in IMG/M |
3300032783|Ga0335079_10043100 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium GR16-43 | 5179 | Open in IMG/M |
3300032829|Ga0335070_10014275 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium GR16-43 | 9242 | Open in IMG/M |
3300032829|Ga0335070_10279716 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1625 | Open in IMG/M |
3300032954|Ga0335083_10262025 | All Organisms → cellular organisms → Bacteria | 1539 | Open in IMG/M |
3300033004|Ga0335084_10233074 | Not Available | 1910 | Open in IMG/M |
3300033004|Ga0335084_11330349 | Not Available | 714 | Open in IMG/M |
3300033407|Ga0214472_10269910 | Not Available | 1626 | Open in IMG/M |
3300033550|Ga0247829_11759075 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 511 | Open in IMG/M |
3300033551|Ga0247830_10782460 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Usitatibacteraceae → Usitatibacter → Usitatibacter palustris | 759 | Open in IMG/M |
3300033805|Ga0314864_0049112 | Not Available | 959 | Open in IMG/M |
3300034384|Ga0372946_0075433 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Usitatibacteraceae → Usitatibacter → Usitatibacter palustris | 1556 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 10.82% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 6.49% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 4.76% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.33% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.90% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 3.90% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.46% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.46% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 3.46% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.03% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.03% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.60% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 2.60% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.16% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.16% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.16% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.16% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.73% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.73% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.73% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 1.73% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.73% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.73% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.73% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.73% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.30% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.30% |
Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 1.30% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 1.30% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.30% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.30% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.87% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.87% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.87% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.87% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.87% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.87% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.87% |
Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.43% |
Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.43% |
Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.43% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.43% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.43% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.43% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.43% |
Ore Pile And Mine Drainage Contaminated Soil | Environmental → Terrestrial → Soil → Unclassified → Mine Drainage → Ore Pile And Mine Drainage Contaminated Soil | 0.43% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.43% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.43% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.43% |
Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 0.43% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.43% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.43% |
Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.43% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.43% |
Wastewater | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater | 0.43% |
Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 0.43% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2199352024 | Bare-fallow DEEP SOIL | Environmental | Open in IMG/M |
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300002907 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm | Environmental | Open in IMG/M |
3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
3300003315 | Ore pile and mine drainage contaminated soil microbial communities from Mina do Sossego, Brazil - P2 sample | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300004778 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh | Environmental | Open in IMG/M |
3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) | Host-Associated | Open in IMG/M |
3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009078 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
3300009087 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300009609 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 | Environmental | Open in IMG/M |
3300009870 | Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Linkou plant | Engineered | Open in IMG/M |
3300009873 | Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Wenshan plant | Engineered | Open in IMG/M |
3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300010877 | Boreal forest soil eukaryotic communities from Alaska, USA - W3-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300011420 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT199_2 | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
3300012668 | Arctic soils microbial communities. Combined Assembly of 23 SPs | Environmental | Open in IMG/M |
3300012684 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ279 (21.06) | Environmental | Open in IMG/M |
3300012895 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S208-509C-2 | Environmental | Open in IMG/M |
3300012901 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1 | Environmental | Open in IMG/M |
3300012905 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2 | Environmental | Open in IMG/M |
3300012916 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S213-509R-2 | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300014866 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT890_16_10D | Environmental | Open in IMG/M |
3300015079 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-6b, vegetation/snow interface) | Environmental | Open in IMG/M |
3300015086 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-5c, rocky medial moraine) | Environmental | Open in IMG/M |
3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
3300018029 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MG | Environmental | Open in IMG/M |
3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300020146 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S3+v_10-13C | Environmental | Open in IMG/M |
3300020202 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S1_10 | Environmental | Open in IMG/M |
3300020215 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S1_5 | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Host-Associated | Open in IMG/M |
3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
3300024347 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
3300027639 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control (SPAdes) | Environmental | Open in IMG/M |
3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027691 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 (SPAdes) | Environmental | Open in IMG/M |
3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) | Host-Associated | Open in IMG/M |
3300027818 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 (SPAdes) | Environmental | Open in IMG/M |
3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
3300027979 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 (SPAdes) | Environmental | Open in IMG/M |
3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300030997 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-3B (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031248 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH5_T0_E5 | Environmental | Open in IMG/M |
3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
3300031940 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2 | Environmental | Open in IMG/M |
3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
3300032144 | Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soil | Environmental | Open in IMG/M |
3300032421 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3 | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
3300033407 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175 | Environmental | Open in IMG/M |
3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
3300033805 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_10 | Environmental | Open in IMG/M |
3300034384 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_KNG_2.2 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
deeps_03361650 | 2199352024 | Soil | MNARTRNASLAFVFLCAFALLSWAIFRGYMTPEMMIYFLSFKWCFG |
INPhiseqgaiiFebDRAFT_1058008132 | 3300000364 | Soil | MNAQTRKSLWIFLGLCAFAMLSWLIFVGYLTPEMMVYFLSFRWCF* |
JGI10216J12902_1003912341 | 3300000956 | Soil | MNARTRRSLFVFLALCAFASLSWLIFVGYLTPEMMVYFLSFRWCF* |
JGI10216J12902_1024319182 | 3300000956 | Soil | MMNARTRNATLAFVGLLVFALASWAIFRGYLTPEMMVYYLTFQWCL* |
JGI25613J43889_100173203 | 3300002907 | Grasslands Soil | MSVRTRQSLWVVLAVCAFAALSWVIFRGYLTPEMMVYFLSFRWCF* |
JGI25616J43925_101680812 | 3300002917 | Grasslands Soil | MGEAPRRTRRAAVALLALCAFAALSWVIFRGYLTPEMMVYFLSFKWCL* |
P22013IDBA_100101802 | 3300003315 | Ore Pile And Mine Drainage Contaminated Soil | MNARTRQAAVVFALMLAFAMLSWMIFRGYLTPEMMVYFLTFQWCF* |
Ga0062593_1000379083 | 3300004114 | Soil | VKARARQGLIVFAAALAFAAASWVIFRGYLTPEMMVYFISFKWCF* |
Ga0062593_1027265792 | 3300004114 | Soil | MNARTRQSFLVCLGLCAFALLSWIIFRGYLTPEMMVYFLSFRWCL* |
Ga0062589_1021317972 | 3300004156 | Soil | MNARTRNATVAFVGLLAFALASWAIFRGYLTPEMMVYYLTFQWCL* |
Ga0062590_1018925192 | 3300004157 | Soil | VKARARQGLIVFAAALAFAAASWVIFRGYLTPEMMVYFLSFKWCF* |
Ga0062590_1023010711 | 3300004157 | Soil | RQSLWVVIALCAFAALSWVIFRGYLTPEMMVYFLSFRWCF* |
Ga0063356_1001056471 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MSRTANPRVRRATVTFVLLCGFAVLSWMIFRGYLTPEMMVYFLSFKWCF |
Ga0063356_1010040722 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MNTRARNASLAFVGLLVFVLASWAIFRGYLTPEMMVYFLTFQWCL* |
Ga0063356_1018577322 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MNARIRNASLAFVGLLGFALASWAIFRGYLTPEMMVYFLTFQWCL* |
Ga0063356_1046343031 | 3300004463 | Arabidopsis Thaliana Rhizosphere | VTPRTRQSIIVAAAALAFIAASWVIFRGYLTPEMMVYFLTFKWCL* |
Ga0063356_1047348102 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MNARTRQSFVVFLMLCAFAALSWVVFRGYLTPEMMVYFLSFRWCF* |
Ga0063356_1048588042 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MNARTRQATVVFVLMLGFAMLSWLIFRGYLTPEMMVYFLTFQWCF* |
Ga0063356_1057496542 | 3300004463 | Arabidopsis Thaliana Rhizosphere | VNARTRQSLFVFLGLCVFALVSWAVFIGYLTPEMMVYFLTFRWCF* |
Ga0062591_1003351181 | 3300004643 | Soil | VKARARQGLIVFAAALAFAAASWVIFRGYLTPEMMVYFLS |
Ga0062383_104739552 | 3300004778 | Wetland Sediment | MSREIRRAAVVFVAMLGFAMLSWLIFRGYLTPEMMVYFLTFQWCL |
Ga0070658_101919841 | 3300005327 | Corn Rhizosphere | VNARTRNASLAFIFLCAFALLSWAIFRGYMTPDMMIYFLSFKWCFG* |
Ga0070658_102675112 | 3300005327 | Corn Rhizosphere | MTRETRRAAWTFAALAAFAMASWAAFRGYLTPEMLVYFISFRWCL* |
Ga0070690_1002916882 | 3300005330 | Switchgrass Rhizosphere | MNAQTRRSLWIFLALCAFAMLSWLIFVGYLTPEMMVYFLSFRWCL* |
Ga0068869_1000514892 | 3300005334 | Miscanthus Rhizosphere | VNSRTRQGLIVFAAALAFAAASWVIFRGYLTPEMMVYFLSFKWCF* |
Ga0070689_1002829922 | 3300005340 | Switchgrass Rhizosphere | MNRPVRQALVAFLAMCAFATVSWMIFRGYLTPEMMVYFLSFKWCL* |
Ga0070689_1011714332 | 3300005340 | Switchgrass Rhizosphere | MNARTRRASVVFVALCAFATISWLVFRGYLTPEMMVYFLSFRWCF* |
Ga0070687_1007723781 | 3300005343 | Switchgrass Rhizosphere | VNSRTRQRLIVFAAALAFAAASWVIFRGYLTPEMMVYFLSFKWCF* |
Ga0070661_1004451921 | 3300005344 | Corn Rhizosphere | MTRGARRAAVGFVAMLAFAVVSWMAFVGYLTPDMLVYFLSFKWCL* |
Ga0070675_1000766231 | 3300005354 | Miscanthus Rhizosphere | QGLIVFAAALAFAAASWVIFRGYLTPEMMVYFLSFKWCF* |
Ga0070674_1004750272 | 3300005356 | Miscanthus Rhizosphere | MTNARTRRAALAFVALCAFALVSWAVFRGYLTPEMMVYYLTFQWCL* |
Ga0070701_100167323 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | MNARTRRASVVFVALCAFATVSWLVFRGYLTPEMMVYFLSFRWCF* |
Ga0070701_106677762 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | MNARTRQSFLVCLGLCAFALLSWIIFRGYLTPEMMVYFLTFRWCF* |
Ga0070700_1001610982 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | VNPRTRQGLIFFAATLAFAAASWVIFRGYLTPEMMVYFLSFKWCF* |
Ga0070678_1005464482 | 3300005456 | Miscanthus Rhizosphere | MNPRALRAAAISAAVLGFAALSWLIFLGYLTPEMLVYFLSFRWCF* |
Ga0070678_1008139791 | 3300005456 | Miscanthus Rhizosphere | VTVTPRARQSLIAVAATIAFAGASWLIFRGYLTPEMMVYFLSFKWCF* |
Ga0070707_1017660092 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MNPRTRHSLYVFLGLCAFATLSWMIFRGYLTPEMMVYFLSFKWCF* |
Ga0070698_1010293461 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MQARTRQSLYAFLALCAFAALTWLIFLGYLTPEMMVYFLSFKWCF* |
Ga0070679_1010955771 | 3300005530 | Corn Rhizosphere | MTRQARRAALTFAALAAFAVASWAAFRGYLTPEMLVYFISFRWCL* |
Ga0070731_1000416714 | 3300005538 | Surface Soil | MNPRTRQATWVFVGLCAFAAASWAIFRGYLTPDMMVYFLSFKWCF* |
Ga0068853_1015435372 | 3300005539 | Corn Rhizosphere | MTRGARRAAVGFVAMLAFAVVSWMAFVGYLTPGMLVYFLSFKWCL* |
Ga0068853_1023269382 | 3300005539 | Corn Rhizosphere | MNARTRNASLAFIFLCAFALLSWAIFRGYMTPEMMIYFLSFKWCFG* |
Ga0070672_1001056325 | 3300005543 | Miscanthus Rhizosphere | VKARARQGLIVFAAALAFAAASWVIFRGYLTPEMMVYFIS |
Ga0070672_1008456601 | 3300005543 | Miscanthus Rhizosphere | RQGLIVFAAALAFAAASWVIFRGYLTPEMMVYFLSFKWCF* |
Ga0070693_1004470762 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | AGARGAGAGAMNARTRRASVVFVALCAFATVSWLVFRGYLTPEMMVYFLSFRWCF* |
Ga0066702_104403901 | 3300005575 | Soil | MTPETRRATFGFAALLAFALASWAAFRGYLTPDMLVYFLSFKWCL* |
Ga0068854_1011845092 | 3300005578 | Corn Rhizosphere | MNAQTRRSLWIFLALCAFAMLSLLIFVGYLTPEMMVYFLSFRWCL* |
Ga0070702_1004164541 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | VNSRTRQGLIVFAAALAFAAASWVIFRGYLTPEMMVYFLSF |
Ga0068859_1021796572 | 3300005617 | Switchgrass Rhizosphere | GARGAGAGAMNARTRRASVVFVALCAFATVSWLVFRGYLTPEMMVYFLSFRWCF* |
Ga0068861_1006020852 | 3300005719 | Switchgrass Rhizosphere | VNSRTRQALIVFAAALAFAAASWVIFRGYLTPEMMVYFLSFKWCF* |
Ga0074470_105264952 | 3300005836 | Sediment (Intertidal) | MNARTRNASLAFVGLLGFALASWAIFRGYLTPEMMVYFLTFQWCL* |
Ga0068870_111265852 | 3300005840 | Miscanthus Rhizosphere | MSRTANPRVRRATVTFVLLCGFAVLSWMIFRGYLTPEMMVYFLTFQWCL* |
Ga0068863_1006140801 | 3300005841 | Switchgrass Rhizosphere | MNRPVRQALVAFLAMCAFATVSWMIFRGYLTPEMMVYFLSFKWCL |
Ga0075015_1001943062 | 3300006102 | Watersheds | VSPRTHQASWIFVGLCAFAAASWAIFRGYLTPEMMVYFLSFKWCF* |
Ga0070716_1007605172 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MNPETRRATFGFAALLLFALASWAAFRGYLTPDMLVYFLSFKWCL* |
Ga0097621_1003198082 | 3300006237 | Miscanthus Rhizosphere | MNARTRQSFVVFVAVCAFALVSWVIFRGYLTPEMMVYFLSFRWCF* |
Ga0068871_1008278182 | 3300006358 | Miscanthus Rhizosphere | VNSRTRQGLIVFAAALAFAAGSWVIFRGYLTPEMMVYFLSFKWCF* |
Ga0079222_107060542 | 3300006755 | Agricultural Soil | MTPRVRQSLIAFIAMLAFLSASWLIFRGYLTPEMMVYFISFKWCF* |
Ga0066659_116960482 | 3300006797 | Soil | VTPRTRQSLYVFVAMAAFAAASWLIFRGYLTPEMMAYFLSFKWCF* |
Ga0075428_1023411951 | 3300006844 | Populus Rhizosphere | MNARTRNATLAFVGMLGFALASWAIFRGYLTPEMMVYFLTFQW |
Ga0075425_1030259572 | 3300006854 | Populus Rhizosphere | MESDPIIRKGNARVRGAALAFVFLCAFAALSWAIFRGYMTPDMMIYFLSFKWCFG* |
Ga0079217_100028703 | 3300006876 | Agricultural Soil | MNARTRNATLAFVGLLVFALASWAIFRGYLTPEMMVYYLTFQWCL* |
Ga0079215_110145522 | 3300006894 | Agricultural Soil | MNARTRNATLAFVGLLVFALASWAIFRGYLTPEMMVYYLTF |
Ga0079216_101420021 | 3300006918 | Agricultural Soil | RRAGARRAMNARTRQSLWGFLALCAFAVMSWLIFRGYLTPEMMVYFLSFRWCF* |
Ga0079216_105437471 | 3300006918 | Agricultural Soil | MNAKTRQAAVAFVALLAFAALSWAIFRGYLTPEMLVYFLSFRWCF* |
Ga0079216_105666422 | 3300006918 | Agricultural Soil | MNARTRNATLAFVGLLIFALVSWAIFRGYLTPEMMVYFLTFQWCL* |
Ga0097620_1010785852 | 3300006931 | Switchgrass Rhizosphere | MSARARQSLWVVIALCAFAALSWVIFRGYLTPEMMVYFLSFRWCF* |
Ga0079218_100691722 | 3300007004 | Agricultural Soil | MNARTRQSFVVFIALCAFALASWAIFVGYLTPEMMVYFLTFRWCF* |
Ga0079218_104687784 | 3300007004 | Agricultural Soil | MHESHRPGRARTRNATLAFAGLLAFAVASWAIFRGYLTPEMMVYFLTFQWCL* |
Ga0079218_110546982 | 3300007004 | Agricultural Soil | MSAMNARTRNATLAFLGLLAFALGSWAIFRGYLTPEMMVYFLTFQWCL* |
Ga0079218_116624472 | 3300007004 | Agricultural Soil | MNARTRNASLAFVGLLLFALASWAIFRGYLTPEMMVYFLTFQWCL* |
Ga0079218_137418012 | 3300007004 | Agricultural Soil | MMNPRTRQSLWIFLGLGAFASLSWAIFRGYLTPEMMVYFLSFRWCF* |
Ga0075435_1017862081 | 3300007076 | Populus Rhizosphere | RVRGAALAFVFLCAFAALSWAIFRGYMTPDMMIYFLSFKWCFG* |
Ga0066710_1043762072 | 3300009012 | Grasslands Soil | MNARTRQSLWVVLGVSAFAAISWLVFLGYLTPEMMVYFLSFRWCF |
Ga0105106_101655102 | 3300009078 | Freshwater Sediment | MNARTRQAAVVFVLMLAFAMLSWMIFRGYLTPEMMVYFLTFQWCF* |
Ga0105107_108482911 | 3300009087 | Freshwater Sediment | MNARTRQAAVVFVLMLGFAMLSWMIFRGYLTPEMMVYFLTFQWCF* |
Ga0111539_123357321 | 3300009094 | Populus Rhizosphere | MNARTRNAGLAFVGLLGFALASWAIFRGYLTPEMMVYFLTFQWCL* |
Ga0105243_102656741 | 3300009148 | Miscanthus Rhizosphere | MNARTRRASVVFVALCAFATVSWLVFRGYLTPEMMVYFL |
Ga0105243_116688682 | 3300009148 | Miscanthus Rhizosphere | MNARTRQATITFVALCAFAMLSWLIFRGYLTPEMMVYFLSFKWCF* |
Ga0105249_112310182 | 3300009553 | Switchgrass Rhizosphere | MNARTRKALWIFLALCAFAMLSWLIFVGYLTPEMMVYFLSFRWCL* |
Ga0105347_10385382 | 3300009609 | Soil | MNARTRNATLAFIGMLLFALASWAIFRGYLTPEMMVYYLTLQWCF* |
Ga0105347_14986142 | 3300009609 | Soil | MNARTRNATLAFAGLLLFALVSWAIFRGYLTPEMMVYFLTFQWCL* |
Ga0131092_101455593 | 3300009870 | Activated Sludge | MSPRTRNALVAAVVLGAFAAVSFLVFRGYLTPEMMAYFLSFKWCF* |
Ga0131077_105031132 | 3300009873 | Wastewater | MNARTRNASLAFVGMLVFALASWAIFRGYLTPEMMVYFLTFQWCM* |
Ga0134062_105787761 | 3300010337 | Grasslands Soil | MNARTRQSLWVFLGVCAFAAISWLVFLGYLTPEMMVYFLSFKWCF* |
Ga0134124_113896102 | 3300010397 | Terrestrial Soil | MNARTRQASVAIAALCAFATVSWLVFRGYLTPEMMVYFLSFRWCF* |
Ga0134124_127736712 | 3300010397 | Terrestrial Soil | ASAGARGAGAGAMNARTRRASVVFVALCAFATISWLVFRGYLTPEMMVYFLSFRWCF* |
Ga0134127_119006402 | 3300010399 | Terrestrial Soil | MSVRARQSLWVVLALCAFAALSWVIFRGYLTPEMMVYFLSFRWCF* |
Ga0134121_125195902 | 3300010401 | Terrestrial Soil | LNQRARHSLYAFFAMCAFAALSWTIFRGYLTPEMMVYFLSFKWCF* |
Ga0134121_128584821 | 3300010401 | Terrestrial Soil | MNARTRQATITFVALCAFAMVSWLIFRGYLTPEMMVYFLSFKWCF* |
Ga0134123_100781422 | 3300010403 | Terrestrial Soil | MNARTRQSLVLFLVLCAFAMLSWVIFRGYLTPEMMVYFLSFRWCF* |
Ga0134123_133584772 | 3300010403 | Terrestrial Soil | MNARTRNAILAFAGVLAFAAASWAIFRGYLTPEMMVYFLTF |
Ga0126356_105371972 | 3300010877 | Boreal Forest Soil | MNARTRQASWVVVGLCAFAAASWAIFREYLTPDMMVYFLSFKWCF* |
Ga0126350_120333822 | 3300010880 | Boreal Forest Soil | MNPRTRRATWVFVGLCAFAAASWAIFRGYLTPDMMVYFLSFKWCF* |
Ga0137314_10969042 | 3300011420 | Soil | MNARTRNATVAFVGLLAFALASWAIFRGYLTPEMMVYYLTLQWCF* |
Ga0150985_1125262732 | 3300012212 | Avena Fatua Rhizosphere | MNAKTRKASLAFVFLCAFALLSWAIFRGYMTPEMMIYFLSFKWCFG* |
Ga0137367_112158521 | 3300012353 | Vadose Zone Soil | MNPQTTRATAIFLALCAFAVVSWVIFRGYLTPEMMVYFLSFRWCI* |
Ga0157216_101343252 | 3300012668 | Glacier Forefield Soil | VNARTRNAALAFTALCAFAIVSWMIFLGYLTPEMMVYFLTFQWCF* |
Ga0157216_101766782 | 3300012668 | Glacier Forefield Soil | MNARIRNATLAFVGLLVFALASWAIFRGYLTPEMMVYYLTFQWCL* |
Ga0136614_111935671 | 3300012684 | Polar Desert Sand | MNARTRQAAVAFVAMLAFAMLSWLIFRGYLTPEMMVYFLSFKWCF* |
Ga0157309_103555621 | 3300012895 | Soil | RLIVFAAALAFAAASWVIFRGYLTPEMMVYFLSFKWCF* |
Ga0157288_101363741 | 3300012901 | Soil | VKARARQGLIVFAAALAFAAASWVIFRGYLTPEMMVY |
Ga0157296_103543402 | 3300012905 | Soil | MNARARQSLVVFLALCAFALLSWIIFRGYLTPEMMVYFLSFRWCL* |
Ga0157310_102949621 | 3300012916 | Soil | MNARTRNASLAFGGLLIFALASWAIFRGYLTPEMMVYFLTFQWCL* |
Ga0137410_115549381 | 3300012944 | Vadose Zone Soil | TRQAAVALLALGAFAALSFVIFRGYLTPEMMVYFLSFKWCF* |
Ga0164302_117393792 | 3300012961 | Soil | MNARTRRASLAFIFLCAFALLSWAIFRGYMTPEMMIYFLSFKWCFG* |
Ga0164309_112775851 | 3300012984 | Soil | TRGARRAAVGFIAMLAFAVVSGMAFVGYLTPGMLVYFLSFKWCL* |
Ga0163162_117518192 | 3300013306 | Switchgrass Rhizosphere | MNAQTRRSLWIFLALCAFVMLSWLIFVGYLTPEMMVYFLSFRWC |
Ga0163162_121900122 | 3300013306 | Switchgrass Rhizosphere | MNARTRRSLWIFLALCAFAMLSWLIFVGYLTPEMMVYFLSFRWCL* |
Ga0134079_101074952 | 3300014166 | Grasslands Soil | STRARARGAMNARTRRSLWIFLALCAFAMLSWVIFVGYLTPEMMVYFLTFRCCL* |
Ga0157380_115035512 | 3300014326 | Switchgrass Rhizosphere | MNARTRNATLAFIGLLAFAFASLAIFRGYLTPEMMVYFLTFQWCL* |
Ga0157380_117479702 | 3300014326 | Switchgrass Rhizosphere | MNARTRNATLAFAAVLAFAAASWAIFRGYLTPEMMVYFLTFQWCL* |
Ga0157380_120625652 | 3300014326 | Switchgrass Rhizosphere | MNARTRQSLVVFVVLCAFALVSWVVFRGYLTPEMMVYFLTFRWCF* |
Ga0180090_10138391 | 3300014866 | Soil | MNARTRNATLAFAGLLLFALVSWAIFRGYLTPEMMVYYLTLQWCF* |
Ga0167657_10008742 | 3300015079 | Glacier Forefield Soil | MMTNASPPRRTRQALVALLALSAFAALSWVIFRGYLTPEMMVYFLSFKWCF* |
Ga0167655_10333872 | 3300015086 | Glacier Forefield Soil | MNPETRRAGYLFIALCAFALLSWVIFRGYLTPEMMVYFLSFKWCF* |
Ga0173480_107418822 | 3300015200 | Soil | MNARTRNATLAFAGVLAFAAASWAIFRGYLTPEMMVYFLTFQWCL* |
Ga0137409_105147792 | 3300015245 | Vadose Zone Soil | MDEASRPRRTRQAAVALLALCAFAALSWVIFAGYLTPEMMVYFLSFKWCF* |
Ga0132258_102438152 | 3300015371 | Arabidopsis Rhizosphere | MNPNARRSLWIFLALCAFAMLSWLIFVGYLTPEMMVYFLSFRWCL* |
Ga0132258_102497262 | 3300015371 | Arabidopsis Rhizosphere | MQAKTRQSLVAFVALCAFALLSWAVFRGYLTPEMMVYFLSFKWCL* |
Ga0132258_104826303 | 3300015371 | Arabidopsis Rhizosphere | VNPRTRQGLIVFAATLVFAAASWVIFRGYLTPEMMVYFLSFKWCF* |
Ga0132257_1012064192 | 3300015373 | Arabidopsis Rhizosphere | VNPRTRQGLIVFAATLAFAAASWVIFRGYLTPEMMVYFLSFKWCF* |
Ga0132257_1014110383 | 3300015373 | Arabidopsis Rhizosphere | KATLAFAFLCAFALLSWAIFRGYMTPEMMLYFLSFKWCF* |
Ga0163161_113915332 | 3300017792 | Switchgrass Rhizosphere | MNARTRKSLGIFLALCAFAMLSWLIFVGYLTPEMMVYFLSFRWCL |
Ga0163161_114451612 | 3300017792 | Switchgrass Rhizosphere | MKLQVRQSLVAFLAMCAFATVSWLVFRGYLTPEMMVYFLSFKWCF |
Ga0190266_102984002 | 3300017965 | Soil | MTPRARQAAVTCVAVLGFATLSWLIFRGYLTPEMMVYFLSFRWCF |
Ga0190266_109177382 | 3300017965 | Soil | MNARTRQAFGVFFALCAFAMLSWLIFVGYLTPEMMVYFLSFRWCF |
Ga0187787_100740732 | 3300018029 | Tropical Peatland | MPARTRRAAWIVAGAAAFAAASYFAFRGYLTADMMVYFLSFKWCF |
Ga0184637_105986902 | 3300018063 | Groundwater Sediment | MNARMRRATLAFVALLGFAMLSWLIFLGYLTPEMMVYFLTFQWCF |
Ga0184632_100197812 | 3300018075 | Groundwater Sediment | MTDVSRSRRLRQSTLVFLGLCAFAALSWLIFRGYLTPEMMVYFLSFKWCF |
Ga0184629_100289643 | 3300018084 | Groundwater Sediment | VSARLRQQVAIFVGLCAFAVVSWLIFRGYLTPEMMVYFLSFKWCF |
Ga0190272_103681782 | 3300018429 | Soil | MNARTRNATLAFVGLLVFALASWAIFRGYLTAEMMVYYLTFQWCL |
Ga0190272_132933102 | 3300018429 | Soil | MSARTRQSLWVVLALCAFAALSWVIFRGYLTPEMMVYFLSFRWCF |
Ga0190274_106736292 | 3300018476 | Soil | MNARTRRSFAVFLALCAFASLSWLIFVGYLTPEMMVYFLSFRWCF |
Ga0190274_106872672 | 3300018476 | Soil | MNARTRQSFVVFLGLCAFALLSWIIFRGYLTPEMMVYFLSFRWCF |
Ga0190274_115744493 | 3300018476 | Soil | PPRHEPMNARTRNATMAFVGLLAFALASWAIFRGYLTPEMMVYYLTFQWCL |
Ga0190274_116047071 | 3300018476 | Soil | MNPRTRNATLGFMALLAFALASWMIFRGYLTPEMMVYFLTFQWCL |
Ga0190274_117640272 | 3300018476 | Soil | MAPHTRQSLYVFLGMCAFAAASWLIFRGYLTPEMMVYFLSFKWCF |
Ga0190274_128333932 | 3300018476 | Soil | MNARTRQSFVVFVVLCAFAVVSWIIFRGYLTPEMMVYFLSFRWCL |
Ga0190274_128606052 | 3300018476 | Soil | MNARTRNASLAFGGLLIFALASWAIFRGYLTPEMMVYFLTFQWCL |
Ga0190271_109859582 | 3300018481 | Soil | MNARTRNATVAFVGLLAFALASWAIFRGYLTPEMMVYYLTFQWCL |
Ga0190271_117600902 | 3300018481 | Soil | MNARTRRSLFVFLALCAFASLSWLIFVGYLTPEMMVYFLSFRWCF |
Ga0190271_118034672 | 3300018481 | Soil | MNTRTRNATLAFIGMLLFALASWAIFRGYLTPEMMVYFLTFQWCL |
Ga0190271_129139622 | 3300018481 | Soil | VNARARQATIAFVALLAFAALSWALFRGYLTPEMMVYFLSFKWCF |
Ga0190271_136827072 | 3300018481 | Soil | MNARVRNASLAFVGLLVFALASWAIFRGYLTPDMMVYYLTFQWCL |
Ga0066669_111067852 | 3300018482 | Grasslands Soil | VTTRARHALVFLGLGAFAAVSWLVFRGYLTPEMMVYFLSFRWCF |
Ga0196977_100004650 | 3300020146 | Soil | MNAKTRQAAIAFAALCGFAALSWAIFRGYLTPEMMVYFLSFRWCF |
Ga0196964_102200691 | 3300020202 | Soil | PAGDAGARVMQPRTLKATAGFIALLAFALLSWLIFRGYVTPEMLVYFLSFRWCF |
Ga0196963_101066102 | 3300020215 | Soil | VSPHPEVRRAAIGFALLLAMALLSWLIFRGYLTPEMMVYFLTFQWCF |
Ga0210399_106972582 | 3300020581 | Soil | MNARTRRATWVFVGLCAFAAASWAIFRGYLTPDMMVYFLSFKWCF |
Ga0213876_103375212 | 3300021384 | Plant Roots | MTRDTRRAAWTFAALAAFAVASWAAFRGYLTPEMLVYFISFRWCL |
Ga0182009_107393742 | 3300021445 | Soil | MTREMRRAAWTIAALAAFAAASWAAFRGYLTPEMLVYFISFRWCL |
Ga0179591_10658793 | 3300024347 | Vadose Zone Soil | MQPRVKNSLYVVVGTTAFVVASWAAFAGYLSPEMMVYFLSFKWCF |
Ga0207688_100175424 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | VNSRTRQGLIVVAAALAFAAASWVIFRGYLTPEMMVYFLSFKWCF |
Ga0207680_105484962 | 3300025903 | Switchgrass Rhizosphere | MNAQTRRSLWIFLALCAFAMLSWLIFVGYLTPEMMVYFLSFRWCL |
Ga0207645_107001022 | 3300025907 | Miscanthus Rhizosphere | VKARARQGLIVFAAALAFAAASWVIFRGYLTPEMMVYFLSFKWCF |
Ga0207705_104154862 | 3300025909 | Corn Rhizosphere | MTRETRRAAWTFAALAAFAMASWAAFRGYLTPEMLVYFISFRWCL |
Ga0207705_106411701 | 3300025909 | Corn Rhizosphere | VNARTRNASLAFIFLCAFALLSWAIFRGYMTPDMMIYFLSFKWCFG |
Ga0207662_106671342 | 3300025918 | Switchgrass Rhizosphere | MNARTRRASVVFVALCAFATISWLVFRGYLTPEMMVYFL |
Ga0207662_107791442 | 3300025918 | Switchgrass Rhizosphere | MNARTRRSLWIFLALCAFAMLSWLIFVGYLTPEMMVYFLSFRWCL |
Ga0207646_104691322 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MNPRTRHSLYVFLGLCAFATLSWMIFRGYLTPEMMVYFLSFKWCF |
Ga0207681_104678171 | 3300025923 | Switchgrass Rhizosphere | VKARARQGLIVFAAALAFAAASWVIFRGYLTPEMMVYFISFKWCF |
Ga0207694_114795442 | 3300025924 | Corn Rhizosphere | MNARTRQSFVVFVAVCAFALVSWVIFRGYLTPEMMVYFLSFRWCF |
Ga0207659_101673854 | 3300025926 | Miscanthus Rhizosphere | VNSRTRQGLIVFAAALAFAAASWVIFRGYLTPEMMVYFLSFKWCF |
Ga0207659_102480112 | 3300025926 | Miscanthus Rhizosphere | MNARTRQSLLVFLGLCAFALLSWIIFRGYLTPEMMVYFLSFRWCL |
Ga0207686_100611575 | 3300025934 | Miscanthus Rhizosphere | MNARTRQSFVVFVAVCAFALVSWVIFRGYLTPEMMVYFLTFRWCF |
Ga0207669_102752162 | 3300025937 | Miscanthus Rhizosphere | MTNARTRRAALAFVALCAFALVSWAVFRGYLTPEMMVYYLTFQWCL |
Ga0207669_111937071 | 3300025937 | Miscanthus Rhizosphere | MNARTRNATLAFAGVLAFAAASWAIFRGYLTPEMMVYFLTFQWCL |
Ga0207661_121551241 | 3300025944 | Corn Rhizosphere | FIFLCAFALLSWAIFRGYMTPEMMIYFLSFKWCFG |
Ga0207651_103365392 | 3300025960 | Switchgrass Rhizosphere | MNARTRQSFLVCLGLCAFALLSWIIFRGYLTPEMMVYFLSFRWCL |
Ga0207651_118546952 | 3300025960 | Switchgrass Rhizosphere | AARGPHGAGAGAMSARTRQSLVVFVVVCAFALVSWVVFRGYLTPEMMVYFLTFRWCF |
Ga0207712_121274922 | 3300025961 | Switchgrass Rhizosphere | MNARTRKALWIFLALCAFAMLSWLIFVGYLTPEMMVYFLSFRWCL |
Ga0207640_116803541 | 3300025981 | Corn Rhizosphere | RAAAGFVAMLAFAVVSWMAFVGYLTPGMLVYFLSFKWCL |
Ga0207703_111252392 | 3300026035 | Switchgrass Rhizosphere | MNARTRRASVVFVALCAFATISWLVFRGYLTPEMMVYFLSFRWCF |
Ga0207639_102683322 | 3300026041 | Corn Rhizosphere | MTRGARRAAVGFVAMLAFAVVSWMAFVGYLTPGMLVYFLSFKWCL |
Ga0207708_105609802 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | VNPRTRQGLIFFAATLAFAAASWVIFRGYLTPEMMVYFLSFKWCF |
Ga0207641_103657782 | 3300026088 | Switchgrass Rhizosphere | MNRPVRQALVAFLAMCAFATVSWMIFRGYLTPEMMVYFLSFKWCLYKQA |
Ga0207641_113446441 | 3300026088 | Switchgrass Rhizosphere | MNAQTRRSLWIFLALCAFAMLSWVIFVGYLTPDMMVYFLTFKWCL |
Ga0207648_117886882 | 3300026089 | Miscanthus Rhizosphere | VNSRTRQALIVFAAALAFAAASWVIFRGYLTPEMMVYFLSFKWCF |
Ga0207648_117926612 | 3300026089 | Miscanthus Rhizosphere | MTNARTRGAALAFVALCAFALVSWAVFRGYLTPEMMVYYLTFQWCL |
Ga0207683_107951602 | 3300026121 | Miscanthus Rhizosphere | MNPRALRAAAISAAVLGFAALSWLIFLGYLTPEMLVYFLSFRWCF |
Ga0207698_105565252 | 3300026142 | Corn Rhizosphere | MTRGARRAAVGFVAMLAFAVVSWMAFVGYLTPGMLVYFLS |
Ga0207698_108159492 | 3300026142 | Corn Rhizosphere | VNARTRNASLAFIFLCAFALLSWAIFRGYMTPEMMIYFLSFKWCFG |
Ga0209131_100066215 | 3300026320 | Grasslands Soil | MSVRTRQSLWVVLAVCAFAALSWVIFRGYLTPEMMVYFLSFRWCF |
Ga0209387_12052952 | 3300027639 | Agricultural Soil | MNARTRNATLAFVGLLVFALASWAIFRGYLTPEMMVYYLTFQWCL |
Ga0209117_10892832 | 3300027645 | Forest Soil | MNARTRQSLAVFFALCLFAMASWLIFLGYLTPEMMTYFLSFKWCF |
Ga0209485_10757902 | 3300027691 | Agricultural Soil | MNARTRNATLAFVGLLVFALASWAIFRGYLTPEMMVYY |
Ga0209966_10490111 | 3300027695 | Arabidopsis Thaliana Rhizosphere | MNARTRQSFVVFLMLCAFAALSWVVFRGYLTPEMMVYFLSFRWCF |
Ga0209706_105702621 | 3300027818 | Freshwater Sediment | MNARTRQAAVVFVLMLGFAMLSWMIFRGYLTPEMMVYFLTFQWCF |
Ga0209579_100319163 | 3300027869 | Surface Soil | MNPRTRQATWVFVGLCAFAAASWAIFRGYLTPDMMVYFLSFKWCF |
Ga0209486_100829493 | 3300027886 | Agricultural Soil | MNARTRQSFVVFIALCAFALASWAIFVGYLTPEMMVYFLTFRWCF |
Ga0209486_107068692 | 3300027886 | Agricultural Soil | MHESHRPGRARTRNATLAFAGLLAFAVASWAIFRGYLTPEMMVYFLTFQWCL |
Ga0209705_105555462 | 3300027979 | Freshwater Sediment | MNARTRQAAVVFVLMLAFAMLSWMIFRGYLTPEMM |
Ga0268265_106454421 | 3300028380 | Switchgrass Rhizosphere | VRARARQSLIVFAAALAFAAASWVIFRGYLTPEMMVYFLSFKW |
Ga0073997_118121622 | 3300030997 | Soil | VNEARRPRRTRRAAVAVLALGAFAALSFVIFRGYLTPEMMVYFLSFKWCF |
Ga0170824_1105194982 | 3300031231 | Forest Soil | MNPRTRRATWVFVGLCAFAAASWAIFLGYLTPDMMVYFLSFKWCF |
(restricted) Ga0255312_11395762 | 3300031248 | Sandy Soil | MNARARKATLAFAGALVFALASWAIFRGYLTPEMMVYFLSFQWCL |
Ga0307408_1002838252 | 3300031548 | Rhizosphere | MNARTRNASLAFVGMLLFALASWAIFRGYLTADMMVYFLTFQWCM |
Ga0307408_1003191641 | 3300031548 | Rhizosphere | MNARVRNAAFVFAGLLAFAAASWAIFRGYLTPEMMVYFLTFQWCL |
Ga0307408_1009622412 | 3300031548 | Rhizosphere | MNPRTRGALWMFLGMLAFAMASWLIFRGYLTPEMMVYFLSFRWCF |
Ga0307408_1022741491 | 3300031548 | Rhizosphere | NAAFVFAGLLAFAAASWAIFRGYLTPEMMVYFLTFQWCL |
Ga0310886_110840662 | 3300031562 | Soil | MNARTRNAGLAFVGLLGFALASWAIFRGYLTPEMMVYFLTFQWCL |
Ga0307405_105024852 | 3300031731 | Rhizosphere | MNARTRNATLAFMGLLLFALASWAIFRGYLTPEMMVYFLTFQWCL |
Ga0307468_1016511042 | 3300031740 | Hardwood Forest Soil | MNARTRNASLAFVGLLGFALASWAIFRGYLTPEMMVYFLSFKWCF |
Ga0307413_108120152 | 3300031824 | Rhizosphere | MTTGTNPTLRRATVTFVVLCGFAMLSWLIFRGYLTPEMMVYFLTFQWCL |
Ga0307413_110940162 | 3300031824 | Rhizosphere | MDANVRKAAAGFVALCAFALLSWAIFRGYLTPEMMVYFLSFKWCL |
Ga0310904_103624122 | 3300031854 | Soil | MTNARTRRAALAFVALCAFALVSCAVFRGYLTPEMMVYYLTFQWCL |
Ga0307406_106380242 | 3300031901 | Rhizosphere | MNPRTRNATLGFVALLGFAVVSWAVFRGYLTPEMMVYFLTFQWCL |
Ga0307412_107509822 | 3300031911 | Rhizosphere | MNARTRGALWMFLGMLAFAMASWLIFRGYLTPEMMVYFLSFRWCF |
Ga0308175_1000967822 | 3300031938 | Soil | MTRQTRRAAWTFAALAAFAMASWAAFRGYLTPEMLVYFISFRWCL |
Ga0308174_111323272 | 3300031939 | Soil | MNASALKPLWIFMGLCAFAVVSWLIFLGYLTPEMMVYFLTFRWCL |
Ga0310901_105170971 | 3300031940 | Soil | VNPRTRQGLIVFAATLAFAAASWVIFRGYLTPEMMVYFLSFKWCF |
Ga0307416_1033565191 | 3300032002 | Rhizosphere | EAMNARVRNAAFLFAGLLAFAAASWAIFRGYLTPEMMVYFLTFQWCL |
Ga0307411_108014742 | 3300032005 | Rhizosphere | MNPRTRNATLGFVALLGFAVVSWAVFRGYLTPEMMVYFLTF |
Ga0310890_116557141 | 3300032075 | Soil | PRPPEMTNARTRRAALAFVALCAFALVSWAIFRGYLTPEMMVYYLTFQWCL |
Ga0315910_115998702 | 3300032144 | Soil | MNARTRRSLLVFVGLCAFAMLSWLIFVGYLTPEMMVYFLSFRWCF |
Ga0310812_102759672 | 3300032421 | Soil | MNAQTRRSLWIFLALCAFAMLSWLIFVGYLTPEMMVYFLTFRWCL |
Ga0335085_103940112 | 3300032770 | Soil | MSARARRAGWVFVGLCAFAAASWVIFRGYLTPDMMVYFLSFKWCF |
Ga0335082_101140865 | 3300032782 | Soil | MDARVRRASWIVVGVAAFAAASFLAFRGYLTADMMVYFLSFKWCF |
Ga0335082_101589772 | 3300032782 | Soil | MNARTRQATWVFVGLCAFAAASWAIFRGYLTPDMMVYFLSFRWCF |
Ga0335079_100431003 | 3300032783 | Soil | MSARARQAGWVFVGLCAFAAASWVIFRGYLTPDMMVYFLSFKWCF |
Ga0335070_100142756 | 3300032829 | Soil | MSARARQAGWVFAGLCAFAAASWVIFRGYLTPDMMVYFLSFKWCF |
Ga0335070_102797161 | 3300032829 | Soil | MNPRTRRSTWTFVGLCAFAMASWAVFRGYLTPDMAVYYL |
Ga0335083_102620252 | 3300032954 | Soil | AGERVMNARTRQATWVFVGLCAFAAASWAIFRGYLTPDMMVYFLSFRWCF |
Ga0335084_102330742 | 3300033004 | Soil | MNARTRNASLAFVGLCLFALASWLIFRGYLTPGMMVYFLSFKWCL |
Ga0335084_113303492 | 3300033004 | Soil | MSARTRQATWVFVGLCAFAAASWAIFRGYLTPDMMVYFLSFRWCF |
Ga0214472_102699102 | 3300033407 | Soil | MNARIRQAAVVFALMLAFAMLSWMIFRGYLTPEMMVYFLTFQWCF |
Ga0247829_117590751 | 3300033550 | Soil | MNARTRNATLAFIGLLAFALASWAIFRGYLTPEMMVYFLTFQWCL |
Ga0247830_107824601 | 3300033551 | Soil | GGRRRRPPEAMNARTRNATLAFIGLLAFALASWAIFRGYLTPEMMVYFLTFQWCL |
Ga0314864_0049112_154_294 | 3300033805 | Peatland | VTTARARQATWVFVGLCAFAAASWVIFRGYLTPDMMMYFLSFKWCF |
Ga0372946_0075433_871_1008 | 3300034384 | Soil | MNARTRQSLYVFLGMCVFAAVSWLIFRGYLTPEMMVYFISFKWCL |
⦗Top⦘ |