Metagenome / Metatranscriptome Family F019365

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F019365
Family Type	Metagenome / Metatranscriptome
Number of Sequences	230
Average Sequence Length	41 residues
Representative Sequence	MIKRTLGCVALCGWLMAGGSLQAHHSLAGVYDMKKEMEM
Number of Associated Samples	186
Number of Associated Scaffolds	230

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	99.56 %
% of genes near scaffold ends (potentially truncated)	97.83 %
% of genes from short scaffolds (< 2000 bps)	90.43 %
Associated GOLD sequencing projects	176
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.32

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Bacteria (92.174 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (6.522 % of family members)
Environment Ontology (ENVO)	Unclassified (35.217 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (46.957 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	Yes	Secondary Structure distribution:	α-helix: 52.24% β-sheet: 0.00% Coil/Unstructured: 47.76%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.32
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.32
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 230 Family Scaffolds
PF00903	Glyoxalase	3.48
PF00135	COesterase	3.48
PF13620	CarboxypepD_reg	1.74
PF12681	Glyoxalase_2	1.30
PF07638	Sigma70_ECF	1.30
PF00216	Bac_DNA_binding	1.30
PF00929	RNase_T	0.87
PF11141	DUF2914	0.87
PF01494	FAD_binding_3	0.87
PF07995	GSDH	0.87
PF12543	DUF3738	0.87
PF02146	SIR2	0.87
PF07366	SnoaL	0.87
PF07519	Tannase	0.87
PF12847	Methyltransf_18	0.43
PF00550	PP-binding	0.43
PF09579	Spore_YtfJ	0.43
PF04248	NTP_transf_9	0.43
PF01081	Aldolase	0.43
PF01436	NHL	0.43
PF13847	Methyltransf_31	0.43
PF03795	YCII	0.43
PF01979	Amidohydro_1	0.43
PF03551	PadR	0.43
PF00583	Acetyltransf_1	0.43
PF00034	Cytochrom_C	0.43
PF04273	BLH_phosphatase	0.43
PF12680	SnoaL_2	0.43
PF02775	TPP_enzyme_C	0.43
PF00440	TetR_N	0.43
PF00174	Oxidored_molyb	0.43
PF16576	HlyD_D23	0.43
PF00535	Glycos_transf_2	0.43
PF08818	DUF1801	0.43
PF01609	DDE_Tnp_1	0.43
PF00271	Helicase_C	0.43
PF01717	Meth_synt_2	0.43
PF01909	NTP_transf_2	0.43
PF01694	Rhomboid	0.43
PF02537	CRCB	0.43
PF13460	NAD_binding_10	0.43
PF01381	HTH_3	0.43
PF07746	LigA	0.43
PF04909	Amidohydro_2	0.43
PF09720	Unstab_antitox	0.43
PF03951	Gln-synt_N	0.43
PF00593	TonB_dep_Rec	0.43
PF07676	PD40	0.43
PF00691	OmpA	0.43
PF00374	NiFeSe_Hases	0.43
PF01799	Fer2_2	0.43
PF13683	rve_3	0.43
PF12840	HTH_20	0.43
PF02687	FtsX	0.43
PF07883	Cupin_2	0.43
PF07244	POTRA	0.43
PF01266	DAO	0.43
PF04366	Ysc84	0.43
PF07714	PK_Tyr_Ser-Thr	0.43
PF13557	Phenol_MetA_deg	0.43
PF03683	UPF0175	0.43
PF01425	Amidase	0.43
PF00702	Hydrolase	0.43
PF00561	Abhydrolase_1	0.43

COG ID	Name	Functional Category	% Frequency in 230 Family Scaffolds
COG2272	Carboxylesterase type B	Lipid transport and metabolism [I]	3.48
COG0515	Serine/threonine protein kinase	Signal transduction mechanisms [T]	1.74
COG0654	2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases	Energy production and conversion [C]	1.74
COG0776	Bacterial nucleoid DNA-binding protein IHF-alpha	Replication, recombination and repair [L]	1.30
COG1595	DNA-directed RNA polymerase specialized sigma subunit, sigma24 family	Transcription [K]	1.30
COG2133	Glucose/arabinose dehydrogenase, beta-propeller fold	Carbohydrate transport and metabolism [G]	0.87
COG0578	Glycerol-3-phosphate dehydrogenase	Energy production and conversion [C]	0.87
COG0644	Dehydrogenase (flavoprotein)	Energy production and conversion [C]	0.87
COG0665	Glycine/D-amino acid oxidase (deaminating)	Amino acid transport and metabolism [E]	0.87
COG0846	NAD-dependent protein deacetylase, SIR2 family	Posttranslational modification, protein turnover, chaperones [O]	0.87
COG2041	Molybdopterin-dependent catalytic subunit of periplasmic DMSO/TMAO and protein-methionine-sulfoxide reductases	Energy production and conversion [C]	0.43
COG2343	Uncharacterized conserved protein, DUF427 family	Function unknown [S]	0.43
COG2350	YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis	Secondary metabolites biosynthesis, transport and catabolism [Q]	0.43
COG2886	Predicted antitoxin, contains HTH domain	General function prediction only [R]	0.43
COG2930	Lipid-binding SYLF domain, Ysc84/FYVE family	Lipid transport and metabolism [I]	0.43
COG3039	Transposase and inactivated derivatives, IS5 family	Mobilome: prophages, transposons [X]	0.43
COG3259	Coenzyme F420-reducing hydrogenase, alpha subunit	Energy production and conversion [C]	0.43
COG3293	Transposase	Mobilome: prophages, transposons [X]	0.43
COG3385	IS4 transposase InsG	Mobilome: prophages, transposons [X]	0.43
COG3453	Predicted phosphohydrolase, protein tyrosine phosphatase (PTP) superfamily, DUF442 family	General function prediction only [R]	0.43
COG3915	Uncharacterized conserved protein	Function unknown [S]	0.43
COG4430	Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family	Function unknown [S]	0.43
COG5421	Transposase	Mobilome: prophages, transposons [X]	0.43
COG5433	Predicted transposase YbfD/YdcC associated with H repeats	Mobilome: prophages, transposons [X]	0.43
COG5646	Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis)	Posttranslational modification, protein turnover, chaperones [O]	0.43
COG5649	Uncharacterized conserved protein, DUF1801 domain	Function unknown [S]	0.43
COG5659	SRSO17 transposase	Mobilome: prophages, transposons [X]	0.43
COG0154	Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase	Translation, ribosomal structure and biogenesis [J]	0.43
COG0174	Glutamine synthetase	Amino acid transport and metabolism [E]	0.43
COG0239	Fluoride ion exporter CrcB/FEX, affects chromosome condensation	Cell cycle control, cell division, chromosome partitioning [D]	0.43
COG0374	Ni,Fe-hydrogenase I large subunit	Energy production and conversion [C]	0.43
COG0620	Methionine synthase II (cobalamin-independent)	Amino acid transport and metabolism [E]	0.43
COG0705	Membrane-associated serine protease, rhomboid family	Posttranslational modification, protein turnover, chaperones [O]	0.43
COG0800	2-keto-3-deoxy-6-phosphogluconate aldolase	Carbohydrate transport and metabolism [G]	0.43
COG1695	DNA-binding transcriptional regulator, PadR family	Transcription [K]	0.43
COG1733	DNA-binding transcriptional regulator, HxlR family	Transcription [K]	0.43
COG1846	DNA-binding transcriptional regulator, MarR family	Transcription [K]	0.43

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	92.17 %
Unclassified	root	N/A	7.83 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	92.17 %
Unclassified	root	N/A	7.83 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	92.17 %
Unclassified	root	N/A	7.83 %

Name	Rank	Taxonomy	Distribution
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	53.91 %
Unclassified	root	N/A	7.83 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	4.78 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1.30 %
Nitrospirae	phylum	All Organisms → cellular organisms → Bacteria → Nitrospirae	0.43 %

Name	Rank	Taxonomy	Distribution
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	9.57 %
Unclassified	root	N/A	7.83 %
Acidobacteriia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	1.74 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1.30 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1.30 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1.30 %
Blastocatellia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia	0.43 %
Nitrospira	class	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira	0.43 %

Name	Rank	Taxonomy	Distribution
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	9.13 %
Unclassified	root	N/A	7.83 %
Bryobacterales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales	1.30 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	1.30 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1.30 %
Acidobacteria bacterium RIFCSPLOWO2_12_FULL_66_21	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_12_FULL_66_21	0.43 %
unclassified Blastocatellia	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia	0.43 %
Nitrospirales	order	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales	0.43 %
Acidobacteriales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales	0.43 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.43 %

Name	Rank	Taxonomy	Distribution
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	9.13 %
Unclassified	root	N/A	7.83 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1.30 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	0.43 %
Bryobacteraceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae	0.43 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	0.43 %
Corynebacteriales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales	0.43 %
Streptosporangiales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales	0.43 %
Nitrospiraceae	family	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae	0.43 %
Acidobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	0.43 %
Acidobacteria bacterium RIFCSPLOWO2_12_FULL_66_21	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_12_FULL_66_21	0.43 %
Solibacteraceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae	0.87 %

Name	Rank	Taxonomy	Distribution
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	9.13 %
Unclassified	root	N/A	7.83 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1.30 %
Bryobacter	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter	0.43 %
Gordoniaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Gordoniaceae	0.43 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.43 %
Nitrospira	genus	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira	0.43 %
Nocardiopsaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Nocardiopsaceae	0.43 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	0.43 %
Acidobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	0.43 %
Acidobacteria bacterium RIFCSPLOWO2_12_FULL_66_21	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_12_FULL_66_21	0.43 %
Candidatus Solibacter	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter	0.87 %

Name	Rank	Taxonomy	Distribution
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	9.13 %
Unclassified	root	N/A	7.83 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1.30 %
unclassified Bradyrhizobium	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium	0.43 %
Bryobacter aggregatus	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus	0.43 %
Allosalinactinospora	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Nocardiopsaceae → Allosalinactinospora	0.43 %
Gordonia	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Gordoniaceae → Gordonia	0.43 %
Nitrospira	genus	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira	0.43 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	0.43 %
Acidobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	0.43 %
Acidobacteria bacterium RIFCSPLOWO2_12_FULL_66_21	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_12_FULL_66_21	0.43 %
Candidatus Solibacter usitatus	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus	0.87 %

Name	Rank	Taxonomy	Distribution
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	9.13 %
Unclassified	root	N/A	7.83 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1.30 %
Bradyrhizobium sp. STM 3843	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. STM 3843	0.43 %
Allosalinactinospora lopnorensis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Nocardiopsaceae → Allosalinactinospora → Allosalinactinospora lopnorensis	0.43 %
Gordonia rhizosphera	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Gordoniaceae → Gordonia → Gordonia rhizosphera	0.43 %
Bryobacter aggregatus	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus	0.43 %
Nitrospira	genus	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira	0.43 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	0.43 %
Acidobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	0.43 %
Acidobacteria bacterium RIFCSPLOWO2_12_FULL_66_21	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_12_FULL_66_21	0.43 %
Candidatus Solibacter usitatus Ellin6076	isolate	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076	0.87 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000890\|JGI11643J12802_11780708	All Organisms → cellular organisms → Bacteria → Acidobacteria	659	Open in IMG/M
3300001686\|C688J18823_10530577	All Organisms → cellular organisms → Bacteria → Acidobacteria	753	Open in IMG/M
3300004156\|Ga0062589_102869773	All Organisms → cellular organisms → Bacteria	503	Open in IMG/M
3300004157\|Ga0062590_100586581	All Organisms → cellular organisms → Bacteria	975	Open in IMG/M
3300004480\|Ga0062592_101026658	All Organisms → cellular organisms → Bacteria	756	Open in IMG/M
3300004480\|Ga0062592_101937389	All Organisms → cellular organisms → Bacteria	580	Open in IMG/M
3300004643\|Ga0062591_101354796	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	703	Open in IMG/M
3300005179\|Ga0066684_11044146	All Organisms → cellular organisms → Bacteria → Acidobacteria	525	Open in IMG/M
3300005187\|Ga0066675_10274577	All Organisms → cellular organisms → Bacteria	1212	Open in IMG/M
3300005332\|Ga0066388_107725314	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	539	Open in IMG/M
3300005335\|Ga0070666_10294061	All Organisms → cellular organisms → Bacteria	1156	Open in IMG/M
3300005337\|Ga0070682_100592944	All Organisms → cellular organisms → Bacteria	874	Open in IMG/M
3300005345\|Ga0070692_10264588	All Organisms → cellular organisms → Bacteria	1035	Open in IMG/M
3300005354\|Ga0070675_101242141	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	686	Open in IMG/M
3300005354\|Ga0070675_101451201	All Organisms → cellular organisms → Bacteria	633	Open in IMG/M
3300005356\|Ga0070674_101421737	All Organisms → cellular organisms → Bacteria → Acidobacteria	621	Open in IMG/M
3300005356\|Ga0070674_102160008	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076	508	Open in IMG/M
3300005367\|Ga0070667_101452570	All Organisms → cellular organisms → Bacteria → Acidobacteria	644	Open in IMG/M
3300005440\|Ga0070705_101329964	All Organisms → cellular organisms → Bacteria → Acidobacteria	597	Open in IMG/M
3300005451\|Ga0066681_10359825	All Organisms → cellular organisms → Bacteria → Proteobacteria	894	Open in IMG/M
3300005466\|Ga0070685_10297946	All Organisms → cellular organisms → Bacteria → Proteobacteria	1086	Open in IMG/M
3300005471\|Ga0070698_101305654	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	676	Open in IMG/M
3300005533\|Ga0070734_10694359	All Organisms → cellular organisms → Bacteria → Acidobacteria	579	Open in IMG/M
3300005534\|Ga0070735_10588361	All Organisms → cellular organisms → Bacteria → Acidobacteria	660	Open in IMG/M
3300005535\|Ga0070684_100286769	All Organisms → cellular organisms → Bacteria	1509	Open in IMG/M
3300005541\|Ga0070733_11073414	All Organisms → cellular organisms → Bacteria → Acidobacteria	540	Open in IMG/M
3300005544\|Ga0070686_100858469	All Organisms → cellular organisms → Bacteria → Acidobacteria	736	Open in IMG/M
3300005558\|Ga0066698_10657494	All Organisms → cellular organisms → Bacteria	698	Open in IMG/M
3300005591\|Ga0070761_10429439	All Organisms → cellular organisms → Bacteria → Acidobacteria	809	Open in IMG/M
3300005598\|Ga0066706_11183630	All Organisms → cellular organisms → Bacteria	581	Open in IMG/M
3300005615\|Ga0070702_100167801	All Organisms → cellular organisms → Bacteria → Acidobacteria	1425	Open in IMG/M
3300005618\|Ga0068864_101016000	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_12_FULL_66_21	823	Open in IMG/M
3300005712\|Ga0070764_10840464	All Organisms → cellular organisms → Bacteria → Acidobacteria	573	Open in IMG/M
3300005718\|Ga0068866_11287903	All Organisms → cellular organisms → Bacteria → Acidobacteria	531	Open in IMG/M
3300005764\|Ga0066903_101223758	All Organisms → cellular organisms → Bacteria	1396	Open in IMG/M
3300005764\|Ga0066903_101654918	All Organisms → cellular organisms → Bacteria	1216	Open in IMG/M
3300005764\|Ga0066903_104117091	All Organisms → cellular organisms → Bacteria	779	Open in IMG/M
3300005764\|Ga0066903_107766592	All Organisms → cellular organisms → Bacteria → Acidobacteria	552	Open in IMG/M
3300005836\|Ga0074470_11175040	All Organisms → cellular organisms → Bacteria	551	Open in IMG/M
3300005836\|Ga0074470_11630206	All Organisms → cellular organisms → Bacteria	1169	Open in IMG/M
3300005840\|Ga0068870_11459874	All Organisms → cellular organisms → Bacteria → Acidobacteria	503	Open in IMG/M
3300005841\|Ga0068863_100262022	All Organisms → cellular organisms → Bacteria	1671	Open in IMG/M
3300005841\|Ga0068863_102025253	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Nocardiopsaceae → Allosalinactinospora → Allosalinactinospora lopnorensis	586	Open in IMG/M
3300005842\|Ga0068858_100244666	All Organisms → cellular organisms → Bacteria	1703	Open in IMG/M
3300005844\|Ga0068862_101891896	All Organisms → cellular organisms → Bacteria → Acidobacteria	607	Open in IMG/M
3300005921\|Ga0070766_10251733	All Organisms → cellular organisms → Bacteria → Acidobacteria	1121	Open in IMG/M
3300005937\|Ga0081455_10966579	All Organisms → cellular organisms → Bacteria	528	Open in IMG/M
3300006034\|Ga0066656_10387076	All Organisms → cellular organisms → Bacteria → Acidobacteria	904	Open in IMG/M
3300006046\|Ga0066652_101612904	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	596	Open in IMG/M
3300006049\|Ga0075417_10475455	All Organisms → cellular organisms → Bacteria	626	Open in IMG/M
3300006057\|Ga0075026_101057776	All Organisms → cellular organisms → Bacteria → Acidobacteria	508	Open in IMG/M
3300006059\|Ga0075017_100160556	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Gordoniaceae → Gordonia → Gordonia rhizosphera	1606	Open in IMG/M
3300006174\|Ga0075014_100687135	All Organisms → cellular organisms → Bacteria → Acidobacteria	594	Open in IMG/M
3300006174\|Ga0075014_100908513	All Organisms → cellular organisms → Bacteria → Acidobacteria	528	Open in IMG/M
3300006237\|Ga0097621_100387230	All Organisms → cellular organisms → Bacteria	1250	Open in IMG/M
3300006237\|Ga0097621_100585330	All Organisms → cellular organisms → Bacteria → Acidobacteria	1019	Open in IMG/M
3300006237\|Ga0097621_100676449	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	949	Open in IMG/M
3300006358\|Ga0068871_100001598	All Organisms → cellular organisms → Bacteria → Proteobacteria	15233	Open in IMG/M
3300006358\|Ga0068871_101041332	All Organisms → cellular organisms → Bacteria → Acidobacteria	763	Open in IMG/M
3300006358\|Ga0068871_101599182	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	617	Open in IMG/M
3300006796\|Ga0066665_10830322	All Organisms → cellular organisms → Bacteria → Acidobacteria	725	Open in IMG/M
3300006804\|Ga0079221_11319235	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	569	Open in IMG/M
3300006844\|Ga0075428_100645947	Not Available	1129	Open in IMG/M
3300006844\|Ga0075428_100825835	Not Available	985	Open in IMG/M
3300006854\|Ga0075425_101531718	All Organisms → cellular organisms → Bacteria	752	Open in IMG/M
3300006904\|Ga0075424_101108059	All Organisms → cellular organisms → Bacteria	843	Open in IMG/M
3300006914\|Ga0075436_101553627	All Organisms → cellular organisms → Bacteria → Acidobacteria	503	Open in IMG/M
3300006918\|Ga0079216_11179822	All Organisms → cellular organisms → Bacteria	613	Open in IMG/M
3300007076\|Ga0075435_100280480	All Organisms → cellular organisms → Bacteria	1422	Open in IMG/M
3300007076\|Ga0075435_100383640	All Organisms → cellular organisms → Bacteria → Acidobacteria	1207	Open in IMG/M
3300007788\|Ga0099795_10585330	All Organisms → cellular organisms → Bacteria → Acidobacteria	529	Open in IMG/M
3300009101\|Ga0105247_10016178	All Organisms → cellular organisms → Bacteria	4468	Open in IMG/M
3300009156\|Ga0111538_12072240	All Organisms → cellular organisms → Bacteria	715	Open in IMG/M
3300009177\|Ga0105248_11428788	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	783	Open in IMG/M
3300009551\|Ga0105238_11701237	All Organisms → cellular organisms → Bacteria → Acidobacteria	662	Open in IMG/M
3300009553\|Ga0105249_12761978	All Organisms → cellular organisms → Bacteria → Acidobacteria	563	Open in IMG/M
3300010038\|Ga0126315_10953499	All Organisms → cellular organisms → Bacteria → Acidobacteria	573	Open in IMG/M
3300010046\|Ga0126384_12162567	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. STM 3843	535	Open in IMG/M
3300010047\|Ga0126382_10111289	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1794	Open in IMG/M
3300010047\|Ga0126382_10143394	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1624	Open in IMG/M
3300010048\|Ga0126373_10141916	All Organisms → cellular organisms → Bacteria	2273	Open in IMG/M
3300010048\|Ga0126373_10299205	All Organisms → cellular organisms → Bacteria	1604	Open in IMG/M
3300010358\|Ga0126370_12578192	All Organisms → cellular organisms → Bacteria → Acidobacteria	508	Open in IMG/M
3300010358\|Ga0126370_12612221	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	505	Open in IMG/M
3300010360\|Ga0126372_11202542	All Organisms → cellular organisms → Bacteria → Acidobacteria	782	Open in IMG/M
3300010375\|Ga0105239_12859331	All Organisms → cellular organisms → Bacteria → Acidobacteria	563	Open in IMG/M
3300010376\|Ga0126381_104421138	All Organisms → cellular organisms → Bacteria → Acidobacteria	543	Open in IMG/M
3300011120\|Ga0150983_15165805	All Organisms → cellular organisms → Bacteria → Acidobacteria	869	Open in IMG/M
3300012519\|Ga0157352_1060801	All Organisms → cellular organisms → Bacteria	588	Open in IMG/M
3300012685\|Ga0137397_10019875	All Organisms → cellular organisms → Bacteria	4712	Open in IMG/M
3300012930\|Ga0137407_11472793	All Organisms → cellular organisms → Bacteria → Acidobacteria	647	Open in IMG/M
3300012948\|Ga0126375_10199453	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus	1312	Open in IMG/M
3300012948\|Ga0126375_10247846	Not Available	1204	Open in IMG/M
3300012984\|Ga0164309_11491902	Not Available	578	Open in IMG/M
3300013306\|Ga0163162_13401436	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076	508	Open in IMG/M
3300013308\|Ga0157375_12521460	All Organisms → cellular organisms → Bacteria	614	Open in IMG/M
3300014745\|Ga0157377_11595280	All Organisms → cellular organisms → Bacteria → Acidobacteria	522	Open in IMG/M
3300015077\|Ga0173483_10385552	All Organisms → cellular organisms → Bacteria	715	Open in IMG/M
3300015200\|Ga0173480_11048158	All Organisms → cellular organisms → Bacteria	540	Open in IMG/M
3300015201\|Ga0173478_10040715	All Organisms → cellular organisms → Bacteria → Acidobacteria	1467	Open in IMG/M
3300015372\|Ga0132256_100770298	All Organisms → cellular organisms → Bacteria	1078	Open in IMG/M
3300015373\|Ga0132257_100269511	All Organisms → cellular organisms → Bacteria	2038	Open in IMG/M
3300015374\|Ga0132255_102867963	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	737	Open in IMG/M
3300016404\|Ga0182037_10440133	All Organisms → cellular organisms → Bacteria → Acidobacteria	1082	Open in IMG/M
3300016422\|Ga0182039_11499778	All Organisms → cellular organisms → Bacteria	614	Open in IMG/M
3300016422\|Ga0182039_11877628	All Organisms → cellular organisms → Bacteria → Acidobacteria	550	Open in IMG/M
3300017659\|Ga0134083_10162587	All Organisms → cellular organisms → Bacteria → Proteobacteria	908	Open in IMG/M
3300017792\|Ga0163161_10657617	Not Available	869	Open in IMG/M
3300017792\|Ga0163161_11653731	Not Available	566	Open in IMG/M
3300017933\|Ga0187801_10396355	All Organisms → cellular organisms → Bacteria	573	Open in IMG/M
3300017947\|Ga0187785_10711526	All Organisms → cellular organisms → Bacteria → Acidobacteria	528	Open in IMG/M
3300017965\|Ga0190266_10238290	All Organisms → cellular organisms → Bacteria	902	Open in IMG/M
3300018013\|Ga0187873_1026096	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	2864	Open in IMG/M
3300018057\|Ga0187858_10256681	All Organisms → cellular organisms → Bacteria → Acidobacteria	1120	Open in IMG/M
3300018060\|Ga0187765_10526683	All Organisms → cellular organisms → Bacteria	752	Open in IMG/M
3300018083\|Ga0184628_10659766	All Organisms → cellular organisms → Bacteria → Acidobacteria	524	Open in IMG/M
3300018088\|Ga0187771_11827942	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	516	Open in IMG/M
3300018469\|Ga0190270_12797302	All Organisms → cellular organisms → Bacteria	551	Open in IMG/M
3300018476\|Ga0190274_10912435	All Organisms → cellular organisms → Bacteria → Acidobacteria	946	Open in IMG/M
3300018481\|Ga0190271_11970935	All Organisms → cellular organisms → Bacteria → Acidobacteria	693	Open in IMG/M
3300019269\|Ga0184644_1641563	All Organisms → cellular organisms → Bacteria → Acidobacteria	588	Open in IMG/M
3300019362\|Ga0173479_10871574	All Organisms → cellular organisms → Bacteria → Acidobacteria	506	Open in IMG/M
3300020580\|Ga0210403_10610849	All Organisms → cellular organisms → Bacteria	880	Open in IMG/M
3300021181\|Ga0210388_11616651	All Organisms → cellular organisms → Bacteria → Acidobacteria	538	Open in IMG/M
3300021402\|Ga0210385_10322062	All Organisms → cellular organisms → Bacteria	1150	Open in IMG/M
3300021404\|Ga0210389_10493464	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	963	Open in IMG/M
3300021406\|Ga0210386_11381419	All Organisms → cellular organisms → Bacteria → Acidobacteria	591	Open in IMG/M
3300021432\|Ga0210384_11691954	Not Available	538	Open in IMG/M
3300021433\|Ga0210391_11441849	All Organisms → cellular organisms → Bacteria → Acidobacteria	529	Open in IMG/M
3300021445\|Ga0182009_10121695	Not Available	1214	Open in IMG/M
3300021474\|Ga0210390_10344247	Not Available	1262	Open in IMG/M
3300025324\|Ga0209640_10431640	All Organisms → cellular organisms → Bacteria → Acidobacteria	1083	Open in IMG/M
3300025326\|Ga0209342_11295310	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	529	Open in IMG/M
3300025862\|Ga0209483_1059370	All Organisms → cellular organisms → Bacteria → Acidobacteria	1770	Open in IMG/M
3300025899\|Ga0207642_10007640	All Organisms → cellular organisms → Bacteria → Proteobacteria	3661	Open in IMG/M
3300025900\|Ga0207710_10049185	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	1888	Open in IMG/M
3300025901\|Ga0207688_10636644	All Organisms → cellular organisms → Bacteria	673	Open in IMG/M
3300025906\|Ga0207699_10814872	All Organisms → cellular organisms → Bacteria → Acidobacteria	687	Open in IMG/M
3300025911\|Ga0207654_10024271	All Organisms → cellular organisms → Bacteria	3258	Open in IMG/M
3300025917\|Ga0207660_11082960	All Organisms → cellular organisms → Bacteria → Acidobacteria	653	Open in IMG/M
3300025918\|Ga0207662_10703801	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	708	Open in IMG/M
3300025923\|Ga0207681_10276228	Not Available	1321	Open in IMG/M
3300025923\|Ga0207681_10991993	All Organisms → cellular organisms → Bacteria	704	Open in IMG/M
3300025923\|Ga0207681_11297724	All Organisms → cellular organisms → Bacteria → Acidobacteria	611	Open in IMG/M
3300025925\|Ga0207650_10831459	All Organisms → cellular organisms → Bacteria	783	Open in IMG/M
3300025926\|Ga0207659_10915928	Not Available	754	Open in IMG/M
3300025926\|Ga0207659_11772541	All Organisms → cellular organisms → Bacteria → Acidobacteria	525	Open in IMG/M
3300025930\|Ga0207701_10810382	Not Available	788	Open in IMG/M
3300025931\|Ga0207644_11249229	All Organisms → cellular organisms → Bacteria	624	Open in IMG/M
3300025935\|Ga0207709_11068975	All Organisms → cellular organisms → Bacteria → Acidobacteria	662	Open in IMG/M
3300025936\|Ga0207670_10091362	All Organisms → cellular organisms → Bacteria → Acidobacteria	2153	Open in IMG/M
3300025936\|Ga0207670_11012801	All Organisms → cellular organisms → Bacteria → Acidobacteria	699	Open in IMG/M
3300025936\|Ga0207670_11320764	All Organisms → cellular organisms → Bacteria → Acidobacteria	612	Open in IMG/M
3300025936\|Ga0207670_11855933	All Organisms → cellular organisms → Bacteria → Acidobacteria	512	Open in IMG/M
3300025940\|Ga0207691_10050942	All Organisms → cellular organisms → Bacteria → Acidobacteria	3788	Open in IMG/M
3300025941\|Ga0207711_10839941	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	855	Open in IMG/M
3300025941\|Ga0207711_11179100	Not Available	707	Open in IMG/M
3300025941\|Ga0207711_11345161	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira	657	Open in IMG/M
3300025941\|Ga0207711_11497584	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	618	Open in IMG/M
3300025941\|Ga0207711_12028743	All Organisms → cellular organisms → Bacteria → Acidobacteria	518	Open in IMG/M
3300025945\|Ga0207679_10852210	All Organisms → cellular organisms → Bacteria	832	Open in IMG/M
3300025960\|Ga0207651_11030866	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	736	Open in IMG/M
3300025961\|Ga0207712_10009781	All Organisms → cellular organisms → Bacteria	6077	Open in IMG/M
3300025986\|Ga0207658_11295097	All Organisms → cellular organisms → Bacteria	666	Open in IMG/M
3300026023\|Ga0207677_10622624	All Organisms → cellular organisms → Bacteria	949	Open in IMG/M
3300026075\|Ga0207708_11490030	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	594	Open in IMG/M
3300026088\|Ga0207641_11536958	All Organisms → cellular organisms → Bacteria	667	Open in IMG/M
3300026088\|Ga0207641_11695614	All Organisms → cellular organisms → Bacteria	634	Open in IMG/M
3300026095\|Ga0207676_10433158	All Organisms → cellular organisms → Bacteria	1236	Open in IMG/M
3300026095\|Ga0207676_11935625	All Organisms → cellular organisms → Bacteria → Acidobacteria	588	Open in IMG/M
3300026095\|Ga0207676_11973978	All Organisms → cellular organisms → Bacteria → Acidobacteria	582	Open in IMG/M
3300026116\|Ga0207674_10136640	All Organisms → cellular organisms → Bacteria	2413	Open in IMG/M
3300026118\|Ga0207675_101971138	All Organisms → cellular organisms → Bacteria	602	Open in IMG/M
3300026121\|Ga0207683_10007588	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	9293	Open in IMG/M
3300026121\|Ga0207683_10354129	All Organisms → cellular organisms → Bacteria → Acidobacteria	1348	Open in IMG/M
3300026121\|Ga0207683_11160728	All Organisms → cellular organisms → Bacteria	716	Open in IMG/M
3300026121\|Ga0207683_11553767	All Organisms → cellular organisms → Bacteria → Acidobacteria	611	Open in IMG/M
3300026320\|Ga0209131_1030396	All Organisms → cellular organisms → Bacteria → Acidobacteria	3170	Open in IMG/M
3300027045\|Ga0207726_1054204	All Organisms → cellular organisms → Bacteria → Acidobacteria	531	Open in IMG/M
3300027063\|Ga0207762_1065720	All Organisms → cellular organisms → Bacteria → Acidobacteria	524	Open in IMG/M
3300027609\|Ga0209221_1002708	All Organisms → cellular organisms → Bacteria	4418	Open in IMG/M
3300027880\|Ga0209481_10523064	All Organisms → cellular organisms → Bacteria	613	Open in IMG/M
3300027895\|Ga0209624_10736643	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	649	Open in IMG/M
3300027907\|Ga0207428_10323124	All Organisms → cellular organisms → Bacteria	1139	Open in IMG/M
3300027908\|Ga0209006_11120382	All Organisms → cellular organisms → Bacteria → Acidobacteria	619	Open in IMG/M
3300028381\|Ga0268264_11561520	All Organisms → cellular organisms → Bacteria → Acidobacteria	671	Open in IMG/M
3300028803\|Ga0307281_10413033	All Organisms → cellular organisms → Bacteria	518	Open in IMG/M
3300028884\|Ga0307308_10347274	All Organisms → cellular organisms → Bacteria → Acidobacteria	711	Open in IMG/M
3300028906\|Ga0308309_11259700	All Organisms → cellular organisms → Bacteria	636	Open in IMG/M
3300029636\|Ga0222749_10549890	All Organisms → cellular organisms → Bacteria → Acidobacteria	628	Open in IMG/M
3300029910\|Ga0311369_10847211	All Organisms → cellular organisms → Bacteria → Acidobacteria	735	Open in IMG/M
3300030007\|Ga0311338_11380396	All Organisms → cellular organisms → Bacteria → Acidobacteria	657	Open in IMG/M
3300030047\|Ga0302286_10655036	All Organisms → cellular organisms → Bacteria → Acidobacteria	535	Open in IMG/M
3300030058\|Ga0302179_10044272	All Organisms → cellular organisms → Bacteria	2021	Open in IMG/M
3300030617\|Ga0311356_11540103	All Organisms → cellular organisms → Bacteria → Acidobacteria	600	Open in IMG/M
3300031057\|Ga0170834_108096727	All Organisms → cellular organisms → Bacteria → Acidobacteria	1098	Open in IMG/M
3300031231\|Ga0170824_117883661	All Organisms → cellular organisms → Bacteria → Acidobacteria	1329	Open in IMG/M
3300031236\|Ga0302324_101238638	All Organisms → cellular organisms → Bacteria	990	Open in IMG/M
3300031366\|Ga0307506_10353737	All Organisms → cellular organisms → Bacteria	590	Open in IMG/M
3300031562\|Ga0310886_10504529	All Organisms → cellular organisms → Bacteria	730	Open in IMG/M
3300031573\|Ga0310915_11211534	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	522	Open in IMG/M
3300031708\|Ga0310686_105098501	All Organisms → cellular organisms → Bacteria	886	Open in IMG/M
3300031708\|Ga0310686_107712599	All Organisms → cellular organisms → Bacteria → Acidobacteria	1360	Open in IMG/M
3300031708\|Ga0310686_109546785	All Organisms → cellular organisms → Bacteria → Acidobacteria	669	Open in IMG/M
3300031845\|Ga0318511_10289667	All Organisms → cellular organisms → Bacteria → Acidobacteria	739	Open in IMG/M
3300031854\|Ga0310904_10492169	All Organisms → cellular organisms → Bacteria	821	Open in IMG/M
3300031858\|Ga0310892_10797088	All Organisms → cellular organisms → Bacteria → Acidobacteria	655	Open in IMG/M
3300031910\|Ga0306923_11226018	All Organisms → cellular organisms → Bacteria → Acidobacteria	800	Open in IMG/M
3300031910\|Ga0306923_12160971	All Organisms → cellular organisms → Bacteria → Acidobacteria	560	Open in IMG/M
3300031943\|Ga0310885_10004489	All Organisms → cellular organisms → Bacteria → Acidobacteria	4385	Open in IMG/M
3300031944\|Ga0310884_10726785	All Organisms → cellular organisms → Bacteria → Acidobacteria	602	Open in IMG/M
3300031946\|Ga0310910_10364184	All Organisms → cellular organisms → Bacteria → Acidobacteria	1143	Open in IMG/M
3300031947\|Ga0310909_11415652	Not Available	556	Open in IMG/M
3300031947\|Ga0310909_11471953	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	543	Open in IMG/M
3300031954\|Ga0306926_11810759	Not Available	693	Open in IMG/M
3300032094\|Ga0318540_10112615	All Organisms → cellular organisms → Bacteria → Acidobacteria	1287	Open in IMG/M
3300032122\|Ga0310895_10299074	All Organisms → cellular organisms → Bacteria	760	Open in IMG/M
3300032782\|Ga0335082_10640829	All Organisms → cellular organisms → Bacteria → Acidobacteria	924	Open in IMG/M
3300032805\|Ga0335078_10009266	All Organisms → cellular organisms → Bacteria	14592	Open in IMG/M
3300032805\|Ga0335078_10949455	All Organisms → cellular organisms → Bacteria → Acidobacteria	1026	Open in IMG/M
3300032805\|Ga0335078_11687782	All Organisms → cellular organisms → Bacteria → Acidobacteria	696	Open in IMG/M
3300032828\|Ga0335080_10485766	All Organisms → cellular organisms → Bacteria	1313	Open in IMG/M
3300032892\|Ga0335081_10169676	All Organisms → cellular organisms → Bacteria → Acidobacteria	3080	Open in IMG/M
3300032892\|Ga0335081_11003822	All Organisms → cellular organisms → Bacteria → Acidobacteria	972	Open in IMG/M
3300032893\|Ga0335069_12115032	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	591	Open in IMG/M
3300033513\|Ga0316628_103568213	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	561	Open in IMG/M
3300034670\|Ga0314795_069307	All Organisms → cellular organisms → Bacteria → Acidobacteria	659	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	64.35%
Host-Associated	Host-Associated	35.65%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	59.57%
Plants	Host-Associated → Plants	35.65%
Aquatic	Environmental → Aquatic	4.78%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	56.96%
Rhizosphere	Host-Associated → Plants → Rhizosphere	20.87%
Rhizoplane	Host-Associated → Plants → Rhizoplane	12.17%
Sediment	Environmental → Aquatic → Sediment	3.04%
Peat	Environmental → Terrestrial → Peat	2.61%
Roots	Host-Associated → Plants → Roots	2.61%
Freshwater	Environmental → Aquatic → Freshwater	1.74%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	36.96%
Loam	Environmental → Terrestrial → Soil → Loam	14.78%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	12.17%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	9.57%
Soil	Host-Associated → Plants → Rhizosphere → Soil	8.70%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	5.22%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	3.04%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	2.61%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	2.61%
Soil	Host-Associated → Plants → Rhizoplane → Soil	1.74%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	1.30%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	0.87%
Sediment	Environmental → Aquatic → Freshwater → Sediment	0.43%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	15.65%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	12.17%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	10.00%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	9.57%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	8.70%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	6.96%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	6.52%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	5.22%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	4.78%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	3.04%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	3.04%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	3.04%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	2.61%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	2.61%
Unclassified	Host-Associated → Plants → Rhizoplane → Soil → Unclassified	1.74%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog	0.87%
Unclassified	Environmental → Terrestrial → Soil → Loam → Unclassified	0.87%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	0.87%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	0.43%
Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment	0.43%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost	0.43%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	0.43%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	6.52%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	6.52%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	5.22%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	4.78%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	4.78%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	4.35%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	3.91%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	3.91%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	3.91%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	3.91%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	3.04%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	3.04%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	3.04%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	2.61%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	2.61%
Miscanthus Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere	2.61%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	2.17%
Palsa	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa	2.17%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	1.74%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	1.74%
Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil	1.74%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	1.74%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere	1.74%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	1.30%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	1.30%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	1.30%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	1.30%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	1.30%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	1.30%
Peatland	Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland	0.87%
Sediment (Intertidal)	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)	0.87%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	0.87%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	0.87%
Soil	Environmental → Terrestrial → Soil → Loam → Unclassified → Soil	0.87%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	0.87%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.87%
Groundwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment	0.43%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment	0.43%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.43%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	0.43%
Serpentine Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil	0.43%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	0.43%
Unplanted Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil	0.43%
Arctic Peat Soil	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil	0.43%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	0.43%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere	0.43%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	0.43%
Fen	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen	0.43%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	0.43%
Tabebuia Heterophylla Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere	0.43%
Corn, Switchgrass And Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	0.43%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.43%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.43%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	0.43%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere	0.43%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000890	Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil	Environmental	Open in IMG/M
3300001686	Grasslands soil microbial communities from Hopland, California, USA	Environmental	Open in IMG/M
3300004156	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1	Environmental	Open in IMG/M
3300004157	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2	Environmental	Open in IMG/M
3300004480	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4	Environmental	Open in IMG/M
3300004643	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3	Environmental	Open in IMG/M
3300005179	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133	Environmental	Open in IMG/M
3300005187	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124	Environmental	Open in IMG/M
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental	Open in IMG/M
3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Host-Associated	Open in IMG/M
3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Host-Associated	Open in IMG/M
3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Environmental	Open in IMG/M
3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Environmental	Open in IMG/M
3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Host-Associated	Open in IMG/M
3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Host-Associated	Open in IMG/M
3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Host-Associated	Open in IMG/M
3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Environmental	Open in IMG/M
3300005451	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130	Environmental	Open in IMG/M
3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Environmental	Open in IMG/M
3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Environmental	Open in IMG/M
3300005533	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1	Environmental	Open in IMG/M
3300005534	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1	Environmental	Open in IMG/M
3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Environmental	Open in IMG/M
3300005541	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1	Environmental	Open in IMG/M
3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Environmental	Open in IMG/M
3300005558	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147	Environmental	Open in IMG/M
3300005591	Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1	Environmental	Open in IMG/M
3300005598	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155	Environmental	Open in IMG/M
3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Environmental	Open in IMG/M
3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Host-Associated	Open in IMG/M
3300005712	Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4	Environmental	Open in IMG/M
3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Host-Associated	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300005836	Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB	Environmental	Open in IMG/M
3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Host-Associated	Open in IMG/M
3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Host-Associated	Open in IMG/M
3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Host-Associated	Open in IMG/M
3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Host-Associated	Open in IMG/M
3300005921	Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6	Environmental	Open in IMG/M
3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Host-Associated	Open in IMG/M
3300006034	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105	Environmental	Open in IMG/M
3300006046	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101	Environmental	Open in IMG/M
3300006049	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1	Host-Associated	Open in IMG/M
3300006057	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012	Environmental	Open in IMG/M
3300006059	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012	Environmental	Open in IMG/M
3300006174	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014	Environmental	Open in IMG/M
3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)	Host-Associated	Open in IMG/M
3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Host-Associated	Open in IMG/M
3300006796	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114	Environmental	Open in IMG/M
3300006804	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200	Environmental	Open in IMG/M
3300006844	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Host-Associated	Open in IMG/M
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated	Open in IMG/M
3300006904	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3	Host-Associated	Open in IMG/M
3300006914	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Host-Associated	Open in IMG/M
3300006918	Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100	Environmental	Open in IMG/M
3300007076	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Host-Associated	Open in IMG/M
3300007788	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2	Environmental	Open in IMG/M
3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Host-Associated	Open in IMG/M
3300009156	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)	Host-Associated	Open in IMG/M
3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Host-Associated	Open in IMG/M
3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Host-Associated	Open in IMG/M
3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Host-Associated	Open in IMG/M
3300010038	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106	Environmental	Open in IMG/M
3300010046	Tropical forest soil microbial communities from Panama - MetaG Plot_36	Environmental	Open in IMG/M
3300010047	Tropical forest soil microbial communities from Panama - MetaG Plot_30	Environmental	Open in IMG/M
3300010048	Tropical forest soil microbial communities from Panama - MetaG Plot_11	Environmental	Open in IMG/M
3300010358	Tropical forest soil microbial communities from Panama - MetaG Plot_3	Environmental	Open in IMG/M
3300010360	Tropical forest soil microbial communities from Panama - MetaG Plot_6	Environmental	Open in IMG/M
3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Host-Associated	Open in IMG/M
3300010376	Tropical forest soil microbial communities from Panama - MetaG Plot_28	Environmental	Open in IMG/M
3300011120	Combined assembly of Microbial Forest Soil metaT	Environmental	Open in IMG/M
3300012519	Unplanted soil (control) microbial communities from North Carolina - M.Soil.7.yng.070610	Environmental	Open in IMG/M
3300012685	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG	Environmental	Open in IMG/M
3300012930	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012948	Tropical forest soil microbial communities from Panama - MetaG Plot_14	Environmental	Open in IMG/M
3300012984	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG	Environmental	Open in IMG/M
3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Host-Associated	Open in IMG/M
3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Host-Associated	Open in IMG/M
3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Host-Associated	Open in IMG/M
3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Host-Associated	Open in IMG/M
3300015077	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)	Environmental	Open in IMG/M
3300015200	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2)	Environmental	Open in IMG/M
3300015201	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2)	Environmental	Open in IMG/M
3300015372	Soil combined assembly	Host-Associated	Open in IMG/M
3300015373	Combined assembly of cpr5 rhizosphere	Host-Associated	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300016404	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082	Environmental	Open in IMG/M
3300016422	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111	Environmental	Open in IMG/M
3300017659	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG	Environmental	Open in IMG/M
3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Host-Associated	Open in IMG/M
3300017933	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1	Environmental	Open in IMG/M
3300017947	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG	Environmental	Open in IMG/M
3300017965	Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T	Environmental	Open in IMG/M
3300018013	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100	Environmental	Open in IMG/M
3300018057	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150	Environmental	Open in IMG/M
3300018060	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG	Environmental	Open in IMG/M
3300018083	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1	Environmental	Open in IMG/M
3300018088	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG	Environmental	Open in IMG/M
3300018469	Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T	Environmental	Open in IMG/M
3300018476	Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T	Environmental	Open in IMG/M
3300018481	Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T	Environmental	Open in IMG/M
3300019269	Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300019362	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)	Environmental	Open in IMG/M
3300020580	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M	Environmental	Open in IMG/M
3300021181	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O	Environmental	Open in IMG/M
3300021402	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O	Environmental	Open in IMG/M
3300021404	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O	Environmental	Open in IMG/M
3300021406	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O	Environmental	Open in IMG/M
3300021432	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M	Environmental	Open in IMG/M
3300021433	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O	Environmental	Open in IMG/M
3300021445	Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG	Environmental	Open in IMG/M
3300021474	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O	Environmental	Open in IMG/M
3300025324	Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes)	Environmental	Open in IMG/M
3300025326	Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_2 (SPAdes)	Environmental	Open in IMG/M
3300025862	Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A (SPAdes)	Environmental	Open in IMG/M
3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)	Host-Associated	Open in IMG/M
3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)	Environmental	Open in IMG/M
3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)	Environmental	Open in IMG/M
3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025930	Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)	Environmental	Open in IMG/M
3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)	Environmental	Open in IMG/M
3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026320	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes)	Environmental	Open in IMG/M
3300027045	Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 40 (SPAdes)	Environmental	Open in IMG/M
3300027063	Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 37 (SPAdes)	Environmental	Open in IMG/M
3300027609	Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O2 (SPAdes)	Environmental	Open in IMG/M
3300027880	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)	Host-Associated	Open in IMG/M
3300027895	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes)	Environmental	Open in IMG/M
3300027907	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)	Host-Associated	Open in IMG/M
3300027908	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)	Environmental	Open in IMG/M
3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300028803	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120	Environmental	Open in IMG/M
3300028884	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195	Environmental	Open in IMG/M
3300028906	Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)	Environmental	Open in IMG/M
3300029636	Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300029910	III_Palsa_E2 coassembly	Environmental	Open in IMG/M
3300030007	I_Palsa_E1 coassembly	Environmental	Open in IMG/M
3300030047	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E2_3	Environmental	Open in IMG/M
3300030058	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1	Environmental	Open in IMG/M
3300030617	II_Palsa_N2 coassembly	Environmental	Open in IMG/M
3300031057	Oak Coassembly Site 11 - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031231	Coassembly Site 11 (all samples) - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031236	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1	Environmental	Open in IMG/M
3300031366	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 25_S	Environmental	Open in IMG/M
3300031562	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3	Environmental	Open in IMG/M
3300031573	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111	Environmental	Open in IMG/M
3300031708	FICUS49499 Metagenome Czech Republic combined assembly	Environmental	Open in IMG/M
3300031845	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18	Environmental	Open in IMG/M
3300031854	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1	Environmental	Open in IMG/M
3300031858	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2	Environmental	Open in IMG/M
3300031910	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)	Environmental	Open in IMG/M
3300031943	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2	Environmental	Open in IMG/M
3300031944	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1	Environmental	Open in IMG/M
3300031946	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172	Environmental	Open in IMG/M
3300031947	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H	Environmental	Open in IMG/M
3300031954	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)	Environmental	Open in IMG/M
3300032094	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25	Environmental	Open in IMG/M
3300032122	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4	Environmental	Open in IMG/M
3300032782	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1	Environmental	Open in IMG/M
3300032805	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2	Environmental	Open in IMG/M
3300032828	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4	Environmental	Open in IMG/M
3300032892	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5	Environmental	Open in IMG/M
3300032893	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1	Environmental	Open in IMG/M
3300033513	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C	Environmental	Open in IMG/M
3300034670	Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R4 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
JGI11643J12802_117807083	3300000890	Soil	MIGRALGCVVVCGCLMASASLQAHHSLAGVYDMKAEK
C688J18823_105305772	3300001686	Soil	MTGRISGCLILCAAMLAGVSLQAHHSLAGVYDMKKETELS
Ga0062589_1028697732	3300004156	Soil	MNKRMLVCVVLCGFMTAGSLLAHHSLAGVYDMKKDMELSG
Ga0062590_1005865811	3300004157	Soil	MSRRTLGGVVLCGWLLAAGSLQAHHSLAGVYDMHKEAEVHGAVEKIQ
Ga0062592_1010266582	3300004480	Soil	MIGRALGYVVACGCLMAGASLQAHHSLAGVYDMKGEKEIAGTLTQIK
Ga0062592_1019373891	3300004480	Soil	MIKRVLGCVVVCGCLMASASLQAHHSLAGVFDMKAEKEIDGTLTAIKFVN
Ga0062591_1013547963	3300004643	Soil	MIGRALGCVVLCGCLMAGASLQAHHSLAGVFDMKAEKEIDGTLTAIKFVN
Ga0066684_110441461	3300005179	Soil	MIGRALGCVVVCGCLVAGASLQAHHSLAGVYDMKAEKEIAGTLTTIKFVNPH
Ga0066675_102745773	3300005187	Soil	MIKRTLGCVALYGCLMGLLASGQLQAHHSLAGVYDMKKESEM
Ga0066388_1077253141	3300005332	Tropical Forest Soil	MLKRTLGRAALLGLLMASGPLQAHHSLAGVYDMKAEKEVSG
Ga0070677_106262212	3300005333	Miscanthus Rhizosphere	MTKRILGCVLVCGWLGAAASLQAHHSLAGVYDMNREEEKSGALTSI
Ga0070666_102940611	3300005335	Switchgrass Rhizosphere	MIGRALGCVVVCGCLMLGASVQAHHSLAGVYDMKAEKEIAGTLTAI
Ga0070682_1005929441	3300005337	Corn Rhizosphere	MIGRALGCVVVCGCLMLGASVQAHHSLAGVYDMKAEKEIAG
Ga0070692_102645881	3300005345	Corn, Switchgrass And Miscanthus Rhizosphere	MIKRTLGCVALFGWLMASGLQAHHSLAGVYDMKAEKEITG
Ga0070675_1012421411	3300005354	Miscanthus Rhizosphere	MIKRTLVGCLALVGLMASVSLQAHHSLAGVYDMKADKEVS
Ga0070675_1014512011	3300005354	Miscanthus Rhizosphere	MIGRTLGCALVCGCLLAGAALQAHHSLAGVYDMKAEKEIAG
Ga0070674_1014217372	3300005356	Miscanthus Rhizosphere	MVRRALGCVVVCGCLMAGASLQAHHSLAGVFDMKAEKEIDGTLTA
Ga0070674_1021600081	3300005356	Miscanthus Rhizosphere	MFKRTLGCVAVAGWLLASGSLFAHHSLAGVYDMKDEKEIA
Ga0070667_1014525702	3300005367	Switchgrass Rhizosphere	MIGRALGCVVVCGCLMAGASLQAHHSLAGVYDMKAEKEIAGTLTAIK
Ga0070705_1013299642	3300005440	Corn, Switchgrass And Miscanthus Rhizosphere	MIRRALGCVVVCGCLMAGASLQAHHSLAGVYDMKAEKEIAG
Ga0066681_103598251	3300005451	Soil	MIKRTFGYLALCGLLASGSLQAHHSLAGVYDMKKEMEMSGSVE
Ga0070685_102979462	3300005466	Switchgrass Rhizosphere	MIKRILGGVALLGLMASTTLLAHHSLAGVYDMKAEKELSG
Ga0070698_1013056542	3300005471	Corn, Switchgrass And Miscanthus Rhizosphere	MTKRTVGCVLLGGLLMAGVSVQAHHSLAGVYDMKKEAEVSGSVEKIQFV
Ga0070734_106943593	3300005533	Surface Soil	MIKRTLVCVVLCGFMTAGSLMAHHSLAGVYDMKKDMELS
Ga0070735_105883612	3300005534	Surface Soil	MIKRTLGWVALCGFLMTASVSLQAHHSLAGVYDMKK
Ga0070684_1002867691	3300005535	Corn Rhizosphere	MKRTLKCVALCGWLMAGKSLLAHHSLAATYDVKKEMELSGE
Ga0070733_110734141	3300005541	Surface Soil	MIKRTFEYVALCVSFMAATGLMQAHHSLAEVYDMKAEKELTGT
Ga0070686_1008584692	3300005544	Switchgrass Rhizosphere	MIGRALGCIVVCGCLMAGASLQAHHSLAGVYDMKAEKEIAGTL
Ga0066698_106574942	3300005558	Soil	MIKRTLGCVALCGWLMAGGSLQAHHSLAGVYDMKKEMEM
Ga0070761_104294391	3300005591	Soil	MIKRIFGCVALCGWLVAGAGLLQAHHSLAGVYDMKNEKEMSGT
Ga0066706_111836301	3300005598	Soil	MIKRTLGYVALYGCVMGLLASGQLQAHHSLAGVYDMKADKEVSGTIK
Ga0070702_1001678011	3300005615	Corn, Switchgrass And Miscanthus Rhizosphere	MNKRTVGCVLVGGLLMAGVSLQAHHSLAGVYDMKKEAEVSGSVEKIQFV
Ga0068864_1010160002	3300005618	Switchgrass Rhizosphere	MIKRTLGCVALFGWLMASGLQAHHSLAGVYDMKAEKE
Ga0070764_108404641	3300005712	Soil	MTQRTLGTLALFGWLMAASSTLQAHHSLAGVYDMKKETVMSGTVASIKFSNP
Ga0068866_112879032	3300005718	Miscanthus Rhizosphere	MVRRALGCVVVCGCLMTGVSLQAHHSLAGVFDMKAEKEIDGTLTA
Ga0066903_1012237583	3300005764	Tropical Forest Soil	MIKRTLVCVVLCGFMTAGSLLAHHSLAGVYDMKKDMELSG
Ga0066903_1016549181	3300005764	Tropical Forest Soil	MIKRTLGCVVLFSLMATISLQAHHSLAGVYDMKKEVEMEGSLDS
Ga0066903_1041170911	3300005764	Tropical Forest Soil	MKGRTLGWVVCGWLMAGGAVMAHHSLAGVYDMKAKDSEVAGTL
Ga0066903_1077665922	3300005764	Tropical Forest Soil	MIKRTLGCLAFCGLLASGSLQAHHSLAGVYDMKKEMEM
Ga0074470_111750402	3300005836	Sediment (Intertidal)	MITRTLGCVALWGWLMASGSLQAHHSLAGVYDMKKDMELSGAVET
Ga0074470_116302063	3300005836	Sediment (Intertidal)	MIKRTLAGCLALGGLCVWMASVSLQAHHSLAGVYDMKKDMELAG
Ga0068870_114598742	3300005840	Miscanthus Rhizosphere	MIGRALGCIVVCGCLMAGASLQAHHSLAGVYDMKAEKEIAGTLT
Ga0068863_1002620223	3300005841	Switchgrass Rhizosphere	MTKRIMGCVALGAWLLAGVALQAHHSLAGVYDMKKESE
Ga0068863_1020252532	3300005841	Switchgrass Rhizosphere	MLKRTLVPVAFFCGWLIANGSLQAHHSLAGVYDMKAEKEIAGTVEKVQ
Ga0068858_1002446661	3300005842	Switchgrass Rhizosphere	MTKRIMGCVALGAWLLAGVALQAHHSLAGVYDMKKESEVAGSVEKIQFV
Ga0068862_1018918961	3300005844	Switchgrass Rhizosphere	MIGRALGCVVVCGCLMAGASLQAHHSLAGVYDMKAEK
Ga0070766_102517331	3300005921	Soil	MIQRTLGSLALLGWLMAASVSLQAHHSLAGVYDMKKETNVEGT
Ga0081455_109665791	3300005937	Tabebuia Heterophylla Rhizosphere	MIKRTLGCVALCGWLMGSGSLQAHHSLAGVYDMKKEMEMSGEVES
Ga0066656_103870761	3300006034	Soil	MIKRTLGCVALCGWLMANGSLQAHHSLAGVYDMKKETELS
Ga0066652_1016129041	3300006046	Soil	MIKRTLGCVALCGCLLSLLASGQLQAHHSLAGVYDMKKEMELSG
Ga0075417_104754552	3300006049	Populus Rhizosphere	MIKRTLGCVAVCGWLMASGSLQAHHSLAGVYDMKKEMEMSGE
Ga0075026_1010577761	3300006057	Watersheds	MKRTQMMQRTLGYAVLCGWLMASATLQAHHSLAGVYDMKKDME
Ga0075017_1001605561	3300006059	Watersheds	MIKRTLGCVALFGWLMATNTSLQAHHSLAVVYDMEAEKEMSGT
Ga0075014_1006871351	3300006174	Watersheds	MLKRILGCVALCGCLMIASGTLQAHHSLAGVYDMKAEKELSG
Ga0075014_1009085133	3300006174	Watersheds	MIGRALGRVVVCGCLMAGVSLEAHHSLAGVYDMKAEKEI
Ga0097621_1003872301	3300006237	Miscanthus Rhizosphere	MIGRALGCVVVCGCLMLGASVQAHHSLAGVYDMKAEKEI
Ga0097621_1005853301	3300006237	Miscanthus Rhizosphere	MIGRALGCVVVCGCLMAGASLQAHHSLAGVYDMKAEKEIVGT
Ga0097621_1006764491	3300006237	Miscanthus Rhizosphere	MIGRALGYVVVCGCLMAGASLQAHHSLAGVYDMKAEKEIAGTLTAIKFVNP
Ga0068871_1000015981	3300006358	Miscanthus Rhizosphere	MKRTLKCVALCGWLMAGKSLLAHHSLAATYDVKKEMELSGEVEQI
Ga0068871_1010413322	3300006358	Miscanthus Rhizosphere	MTKRTLGCVVVYGVLMASGVLQAHHSLAGVYDMKKESEVAGSVEK
Ga0068871_1015991822	3300006358	Miscanthus Rhizosphere	MIKRILGGVALLGLMASTTLLAHHSLAGVYDMKSEKELTGTVK
Ga0066665_108303221	3300006796	Soil	MMKRILACVVLCGFMTAGSLLAHHSLAGVYDMKKDMELSGSL
Ga0079221_113192351	3300006804	Agricultural Soil	MIKRTIVCVVLCGFIMAGSLLAHHSLAGVYDMKKD
Ga0075428_1006459471	3300006844	Populus Rhizosphere	MNARTLGCVVMFGWLMAGTMAQAHHSLAATYDIRKESE
Ga0075428_1008258351	3300006844	Populus Rhizosphere	MIGRALGCVVLCGWLMAGASLQAHHSLAGVYDMKAEKE
Ga0075425_1015317181	3300006854	Populus Rhizosphere	MTKRILVCVVLCGFMTAGSLLAHHSLAGVYDMKKDMELSG
Ga0075424_1011080591	3300006904	Populus Rhizosphere	MIKRILVCVVLCGFMTAGSLLAHHSLAGVYDMKKDMELSG
Ga0075436_1015536271	3300006914	Populus Rhizosphere	MKRTLGCLALFGWLMMGSLQAHHSLAGVYDMKGEKELSGEV
Ga0079216_111798222	3300006918	Agricultural Soil	MTKRIAGCIALCGFVMAASLQAHHSLAGVYDMKKEAEMAGAVE
Ga0075435_1002804803	3300007076	Populus Rhizosphere	MIKRTLGCLALCGWLMAGGPLQAHHSLAGVYDMKKEM
Ga0075435_1003836401	3300007076	Populus Rhizosphere	MIKRTLGCVVLCGLMASVSLQAHHSLAGVYDMKKDMELS
Ga0099795_105853301	3300007788	Vadose Zone Soil	MIKRTLGSVVVLGAVLIAGASLQAHHSLAGVYDMKAEKEIAGT
Ga0105247_100161781	3300009101	Switchgrass Rhizosphere	MVKKAMGVLVAVSGLMMAGASLQAHHSLAGVYDMKAEKEINGTLTAI
Ga0111538_120722402	3300009156	Populus Rhizosphere	VIKRTLGCLVLGGLMASGSLLAHHSLAGVYDMKGEME
Ga0105248_114287881	3300009177	Switchgrass Rhizosphere	VALLGLLMASGSLQAHHSLAGVYDMKAEKELTGTVEK
Ga0105238_117012372	3300009551	Corn Rhizosphere	MIKRIPGCVALLASLIAASGSLQAHHSLAGVYDMKKE
Ga0105249_127619781	3300009553	Switchgrass Rhizosphere	MTKWTVGCVVLCGCLIAGVSLQAHHSLAGVYDVKANDG*
Ga0126315_109534991	3300010038	Serpentine Soil	MIARTLGCVVLGGWVMAGAAVQAHHSLAGVYDMKKETEL
Ga0126384_121625671	3300010046	Tropical Forest Soil	MVKRTLGRIVLCGLIASSSLLAHHSLAGVYDMKKEME
Ga0126382_101112891	3300010047	Tropical Forest Soil	MIKRILVFVVLCEFMTAGSLLAHHSLAGVYDMKKDMELSGAVESVKFV
Ga0126382_101433942	3300010047	Tropical Forest Soil	MIKRTLVCVVLCGFMTAGSLLAHHSLAGVYDMKKDMEVSG
Ga0126373_101419165	3300010048	Tropical Forest Soil	MVKRSLGYAALFGWLMATGPLQAHHSLAGVYDMKAEKELSGEVAQIKFS
Ga0126373_102992053	3300010048	Tropical Forest Soil	MIKRTLGFVATLCAAAGLLQAHHSLAGVYDMKAEKELQGEVAQIKFSNPHGSL
Ga0126370_125781921	3300010358	Tropical Forest Soil	MIKRTLVCVALCGFMTAGSLLAHHSLAGVYDMKKDMEL
Ga0126370_126122212	3300010358	Tropical Forest Soil	MIKRTLGWAALGAWLMAGSLQAHHSLAGVYDMKAE
Ga0126372_112025421	3300010360	Tropical Forest Soil	MFKRILGSVAVFGWLMAVGPLQAHHSLAGVYDMKTDKELSGT
Ga0105239_128593311	3300010375	Corn Rhizosphere	MMKRTSGFVALCGWLMASGSLLAHHSLAATYDVKKEME
Ga0126381_1044211382	3300010376	Tropical Forest Soil	MIKRILGCAAVVALMTGSLLAHHSLAGVYDMKGDKEVSGEVSSIKFS
Ga0150983_151658053	3300011120	Forest Soil	MKRILGSVALLGLLLTGSVTLQAHHSLAGVYDMKNPKEMSGTVA
Ga0157352_10608011	3300012519	Unplanted Soil	MIGRIFGCLVVCGLVASVSLQAHHSLAGVYDMKAEK
Ga0137397_100198755	3300012685	Vadose Zone Soil	MIKRTLVCIVLCGFMTAGSLLAHHSLAGVYDMKKDME
Ga0137407_114727931	3300012930	Vadose Zone Soil	MLKRTLGCAALLCGWLMASGSLWAHHSLAGVYDMK
Ga0126375_101994531	3300012948	Tropical Forest Soil	MIKRTLVCVVLCGFMTAGSLLAHHSLAGVYDMKKD
Ga0126375_102478461	3300012948	Tropical Forest Soil	MVKRTLGCVALCGWLMAGSSLQAHHSLAGVYDMKKEMEM
Ga0164309_114919022	3300012984	Soil	MIKRTLGGLALLGLLMAGALQAHHSLAGVYDMKAQ
Ga0163162_134014362	3300013306	Switchgrass Rhizosphere	MFKRTLGCVAVAGWLLASGSLFAHHSLAGVYDMKDEK
Ga0157375_125214602	3300013308	Miscanthus Rhizosphere	VALLGLLMASGSLQAHHSLAGVYDMKAEKELTGTVE
Ga0157380_112318391	3300014326	Switchgrass Rhizosphere	MTKRILGCVLVCGWLGAAASLQAHHSLAGVYDMNREEEKSGALTSIRL
Ga0157377_115952801	3300014745	Miscanthus Rhizosphere	MTKRTVGCVLLGGLLMAGVSLQAHHSLAGVYDMKK
Ga0173483_103855522	3300015077	Soil	MIRRAVGCVVVCGCLMAGASLQAHHSLAGVYDMKAEK
Ga0173480_110481581	3300015200	Soil	MIGRALGCVVLCGCLMAGASLQAHHSLAGVFDMKAEKE
Ga0173478_100407153	3300015201	Soil	MIGRALGCVVLCGCLMASASLQAHHSLAGVFDMKAE
Ga0132256_1007702981	3300015372	Arabidopsis Rhizosphere	MIARTLGCVVLGGWLMASVSLQAHHSLAGVYDMKKE
Ga0132257_1002695111	3300015373	Arabidopsis Rhizosphere	MFYGGALMIGRTLGCALVGGCLVAGVALEAHPSLAGVYDMKKETELS
Ga0132255_1028679632	3300015374	Arabidopsis Rhizosphere	MIKRILVCVVLCGFMTAGSLLAHHSLAGVYDMKKDM
Ga0182037_104401332	3300016404	Soil	MIKRALGCVVACGCLMAGASLQAHHSLAGVYDMKSE
Ga0182039_114997782	3300016422	Soil	MIKRTLVCVVLGGFMTAGSLLAHHSLAGVYDMKKDMELS
Ga0182039_118776281	3300016422	Soil	MIKRTLVCVVLCGFMTAGSLLAHHSLAGVYDMKKDMEL
Ga0134083_101625871	3300017659	Grasslands Soil	MIKRTFGYLALCGLLASGSLQAHHSLAGVYDMKKEMEMS
Ga0163161_106576172	3300017792	Switchgrass Rhizosphere	MTVRTLGCVVLCGCLMTTAVLQAHHSLAGVYDMKQES
Ga0163161_116537311	3300017792	Switchgrass Rhizosphere	MIKRTLLCLAIFGLTASTTLLAHHSLAGVYDMQAKDGEVS
Ga0187801_103963552	3300017933	Freshwater Sediment	MIKRTLGYVALFGCLMAASSSLQAHHSLAGVYDMKKETN
Ga0187785_107115261	3300017947	Tropical Peatland	MIKRTLGCVALYGLLATGLLQAHHSLAGVYDMKAEKELAGTVTSIK
Ga0190266_102382901	3300017965	Soil	MIGRTFGCVVLCGWLMVIASLQAHHSLAGVYDMRKEG
Ga0187873_10260961	3300018013	Peatland	MIQRTLGCVALFGWLMAASVSLQAHHSLAGVYDMKK
Ga0187858_102566814	3300018057	Peatland	MIKRTLGFVAMWGLMATGLLQAHHSLAGVYDMKKDMELSGTVGQI
Ga0187765_105266832	3300018060	Tropical Peatland	MIKRALGCVVACGFLMAGVSLQAHHSLAGVYDMKSEKEIVG
Ga0184628_106597662	3300018083	Groundwater Sediment	MNKRTVGCALLGGLLMAGVSLQAHHSLAGVYDMKK
Ga0187771_118279421	3300018088	Tropical Peatland	MIKRTFACLALLGLLMAAGVSLWAHHSLAGVYDMKNEKE
Ga0190270_127973022	3300018469	Soil	MIGRILGCVVLCGWLMAGVALQAHHSLAATYDIRKESEMS
Ga0190274_109124352	3300018476	Soil	MNKRTVGCVVVYGVLMASGVLQAHHSLAGVYDMKKESEV
Ga0190271_119709351	3300018481	Soil	MAGRILGCVVLGGWLVASVSLQAHHSLAGVYDMKKDAE
Ga0184644_16415632	3300019269	Groundwater Sediment	MMGRMWGCVIVCGWLMAGGSLQAHHSLAGVYDMKGEK
Ga0173479_108715741	3300019362	Soil	MIGRVLGCVVVCGILMAGASLQAHHSLAGVYDMKSEKE
Ga0210403_106108492	3300020580	Soil	MIQRTLGFVALCGWLMAASGSLQAHHSLAGVYDMKKETN
Ga0210388_116166512	3300021181	Soil	MIKRTLGCVALFGWLTVAAVSLQAHHSLAGVYDMKKETNIEGTVASIKFS
Ga0210385_103220621	3300021402	Soil	MIKRTLGCVALCGWLLASTGLLQAHHSLAGVYDMKNE
Ga0210389_104934641	3300021404	Soil	MIKRTLGYVALFGWLMTSAVSLQAHHSLAGVYDMKAEKELQGTVTS
Ga0210386_113814192	3300021406	Soil	MIKRTLGCAALFGWLMAASVSLQAHHSLAGVYDMKKETN
Ga0210384_116919541	3300021432	Soil	MIKRTALCVALCGLMASGSLLAHHSLAGVYDTKAKDSEISGSVETIKFVN
Ga0210391_114418491	3300021433	Soil	MKRTLGCVALLGWLMTAAVSLQAHHSLAGVYDMKKETNLEGTVASIKF
Ga0182009_101216953	3300021445	Soil	MVKRIFGSVLVGVCVMGGASLQAHHSLAGVYDMSAEKEI
Ga0210390_103442473	3300021474	Soil	MFQRTLGCVALFGCLMATSVSLQAHHSLAGVYDMKKETNVEG
Ga0209640_104316401	3300025324	Soil	MIKRTLGCVVVGGWLIASVSLQAHHSLAATYDIRKE
Ga0209342_112953101	3300025326	Soil	MIKRTLVCVALFGLMATGSLLAHHSLAGVYDMVGNKE
Ga0209483_10593701	3300025862	Arctic Peat Soil	MIRRAFGCVVVCGCLMAGASLQAHHSLAGVYDMKGEKEVTGTLTIIKFVN
Ga0207682_105905421	3300025893	Miscanthus Rhizosphere	MTKRIWKSVLVCGWLLAAASLQAHHSLAGVYDMNKEEEKTGTLASIR
Ga0207642_100076406	3300025899	Miscanthus Rhizosphere	MIGRALGCVVVCGCLMLGASVQAHHSLAGVYDMKAEKEIAGTL
Ga0207710_100491852	3300025900	Switchgrass Rhizosphere	MVKKAMGVLVAVSGLMMAGASLQAHHSLAGVYDMKAEKEINGTLTAIKFVN
Ga0207688_106366442	3300025901	Corn, Switchgrass And Miscanthus Rhizosphere	MIRRALGCVVVCGCLMAGASLQAHHSLAGVYDMKA
Ga0207699_108148722	3300025906	Corn, Switchgrass And Miscanthus Rhizosphere	MIKRTLICVVLCGFMTAGSLLAHHSLAGVYDMKKDM
Ga0207654_100242714	3300025911	Corn Rhizosphere	MVKRTLASVVLLYGWLMTSGLLQAHHSLAGVYDMKAEKELTGTVEKVQFV
Ga0207660_110829601	3300025917	Corn Rhizosphere	MIGRALGCVVVCGCLMAGASLQAHHSLAGVFDMKAEKEI
Ga0207662_107038011	3300025918	Switchgrass Rhizosphere	MIKRILGGVAVLGLLASTTLQAHHSLAGVYDMKSEKELTGTVKSIKF
Ga0207681_102762281	3300025923	Switchgrass Rhizosphere	MTVRTLGSVVLCGCLTATGVLQAHHSLAGVYDMKQEKELSGS
Ga0207681_109919931	3300025923	Switchgrass Rhizosphere	MIRRALGCVVVCGCLMAGASLQAHHSLAGVYDMKAEKEIAGTL
Ga0207681_112977241	3300025923	Switchgrass Rhizosphere	MIGRALGCVVVCGCLMAGASLQAHHSLAGVFDMKAEKEIDGTL
Ga0207650_108314592	3300025925	Switchgrass Rhizosphere	MIRRVLGCVVVCGCLMAGASLQAHHSLAGVFDMKSE
Ga0207659_109159281	3300025926	Miscanthus Rhizosphere	MTVRTLGSAVFCGCLIATASLGAHHSLAGVYDMKKESEVAG
Ga0207659_117725411	3300025926	Miscanthus Rhizosphere	MIKRTLVGCLALVGLMASVSLQAHHSLAGVYDMKADKEVSGTIKS
Ga0207701_108103822	3300025930	Corn, Switchgrass And Miscanthus Rhizosphere	MSGRILGGVVLCGWLLAAGSLQAHHSLAGVYDMHKEAEVHG
Ga0207644_112492291	3300025931	Switchgrass Rhizosphere	MIRRALGCVVVCGCLMAGASLQAHHSLAGVYDMKAEKE
Ga0207709_110689751	3300025935	Miscanthus Rhizosphere	MIGRALGRVVVCGCLMAGASLQAHHSLAGVYDMKGEKEIAGTLTQI
Ga0207670_100913622	3300025936	Switchgrass Rhizosphere	MIKRTLGCVALLGWLMASGSLQAHHSLAGVYDMKST
Ga0207670_110128013	3300025936	Switchgrass Rhizosphere	IKRILGGVAVLGLLASTTLQAHHSLAGVYDMKSEKELTGTVNRSSL
Ga0207670_113207641	3300025936	Switchgrass Rhizosphere	MIKRTLVCVALVSLMATGSLLAHHSLAGVYDMKADKE
Ga0207670_118559331	3300025936	Switchgrass Rhizosphere	MIGRALGCVVVCGCLMAGASLQAHHSLAGVYDMKAEKEIAG
Ga0207691_100509422	3300025940	Miscanthus Rhizosphere	MNKRTVGCVLVGGLLMAGVSLQAHHSLAGVYDMKKEAEVSGS
Ga0207711_108399411	3300025941	Switchgrass Rhizosphere	MTKRIMGCVALGAWLLAGVALQAHHSLAGVYDMKKESEVAGSV
Ga0207711_111791002	3300025941	Switchgrass Rhizosphere	MIGRALGYIVVCGCLMTGASLQAHHSLAGVYDMKAEKEIAGT
Ga0207711_113451611	3300025941	Switchgrass Rhizosphere	MKRTLKCVALCGWLMAGKSLLAHHSLAATYDVKKEMELS
Ga0207711_114975842	3300025941	Switchgrass Rhizosphere	MTRTLGCVVLCGCLMGGASLQAHHSLAGVYDMKAEKEIAGT
Ga0207711_120287431	3300025941	Switchgrass Rhizosphere	MIGRALGYVVVCGCLMAGASLQAHHSLAGVYDMKAEKEIAGTLTLIK
Ga0207679_108522101	3300025945	Corn Rhizosphere	MIRRALGYVVVCGCLMAGASLQAHHSLAGVYDMKAEKEIAGTL
Ga0207651_110308662	3300025960	Switchgrass Rhizosphere	MIRRTSSCVVLFGWLMASTSLQAHHSLAGVYDMHKE
Ga0207712_100097811	3300025961	Switchgrass Rhizosphere	MVKRTLGCVAVLGLMASVSLQAHHSLAGVYDMKAEKELT
Ga0207658_112950971	3300025986	Switchgrass Rhizosphere	MIRRALGCVVVCGCLMAGASLQAHHSLAGVYDMKAEKEIAGTLTAIKF
Ga0207677_106226242	3300026023	Miscanthus Rhizosphere	MMNRTLGCVALCGWLMSSGSLLAHHSLAASYDVKKEMELSGE
Ga0207708_114900301	3300026075	Corn, Switchgrass And Miscanthus Rhizosphere	MIKRTLFFLAMLGVMASSTLLAHHSLAGVYDMQAKD
Ga0207641_115369581	3300026088	Switchgrass Rhizosphere	MIGRTLGCALVCGCLMAGAALQAHHSLAGVYDMKKETELS
Ga0207641_116956141	3300026088	Switchgrass Rhizosphere	MKRILGCAVVCGWLMASGSLQAHHSLAGVYDMKAEKEIAGTLTKIQFVN
Ga0207676_104331582	3300026095	Switchgrass Rhizosphere	MIRRAVGCVVVCGCLMAGASLQAHHSLAGVYDMKAE
Ga0207676_119356252	3300026095	Switchgrass Rhizosphere	MIGRALGCVVVCGCLMAGASLQAHHSLAGVYDMKAEKE
Ga0207676_119739781	3300026095	Switchgrass Rhizosphere	MVRRILGCVVMFGWLMAGVSLQAHHSLAGVYDMHKEAEVS
Ga0207674_101366401	3300026116	Corn Rhizosphere	MIGRVLRCVVVCGCLMAAAPLQAHHSLAGVYDMKSEKEV
Ga0207675_1019711382	3300026118	Switchgrass Rhizosphere	MTVRTLGSVVLCGYVMAAATLQAHHSLAGVYDMKQA
Ga0207683_100075888	3300026121	Miscanthus Rhizosphere	MVRRALGCVVVCGCLMAGASLQAHHSLAGVFDMKAEKEI
Ga0207683_103541293	3300026121	Miscanthus Rhizosphere	MIKRTLGGLALLGLLMASALQAHHSLAGVYDMKAQKEIAGTLDKIQFV
Ga0207683_111607281	3300026121	Miscanthus Rhizosphere	MIRRVLGCVVVCGCLMAGASLQAHHSLAGVYDMKSEKTI
Ga0207683_115537672	3300026121	Miscanthus Rhizosphere	MIQRTRCSTIVCVALFGLMASGLQAHHSLAGVYDM
Ga0209131_10303961	3300026320	Grasslands Soil	MIGRALGRVVVCGCLMAGASLQAHHSLAGVYDMKAEKEI
Ga0207726_10542042	3300027045	Tropical Forest Soil	MIKRTLGCVALYGFLATGWLQAHHSLAGVYDMKAEKELAGT
Ga0207762_10657201	3300027063	Tropical Forest Soil	MIKRTLGCVALYGFLATGWLQAHHSLAGVYDMKAEKELAG
Ga0209221_10027084	3300027609	Forest Soil	MIKRTVGSVVLVGWLMAASVSLQAHHSLAGVYDMKGRKNFPGW
Ga0209481_105230642	3300027880	Populus Rhizosphere	MIGRALGCVVVCGCLMAGASLQAHHSLAGVYDMKAEKDIAG
Ga0209624_107366431	3300027895	Forest Soil	MIKRTLGWVALAGWFMAASVSLQAHHSLAGVYDMKQDK
Ga0207428_103231241	3300027907	Populus Rhizosphere	MTKRTVGCVLLGGLLMAGVSLQAHHSLAGVYDMKKEAEVS
Ga0209006_111203821	3300027908	Forest Soil	MIKRTLGSVALFGCLMAASSSLQAHHSLAGVYDMKKETNVEGTVASIKFS
Ga0268264_115615201	3300028381	Switchgrass Rhizosphere	MIGRALGCVVVCGCLMAGASLQAHHSLAGVYDMKADKEIA
Ga0307281_104130331	3300028803	Soil	MMKRIFGSVVMCGCLMAGVALQAHHSLAGVYDMKG
Ga0307308_103472741	3300028884	Soil	MIGRALGCVVVCGCLMAGASLQAHHSLAGVYDMKGEKEIAGT
Ga0308309_112597001	3300028906	Soil	MIKRTLGCVALWGVLASGSLQAHHSLAGVYDMKAEKEITG
Ga0222749_105498902	3300029636	Soil	MIGRTLGCSVLCVWLMAGGSLQAHHSLAGVYDMKGEKEVLGTLTIIKFV
Ga0311369_108472111	3300029910	Palsa	MIQRILGCLALFGWLTAASVSLQAHHSLAGVYDMKKETIVSGTVTTIKFSNPHGSL
Ga0311338_113803962	3300030007	Palsa	MIQRILGCLALFGWLTAASVSLQAHHSLAGVYDMKKETIVSGTVTTI
Ga0302286_106550361	3300030047	Fen	MIKRTLGRVALCGWSVVGSGVLQAHHSLAGVYDMKGDKEVAG
Ga0302179_100442724	3300030058	Palsa	MTQRTLGSLALFGWLMAASSTLQAHHSLAGVYDMKKETVVS
Ga0311356_115401032	3300030617	Palsa	MTQRTLGSLALFGWLMAASSTLQAHHSLAGVYDMKK
Ga0170834_1080967274	3300031057	Forest Soil	MIKRTLGFVALCGWLMAASGSLLAHHSLAGVYDMKKETNLSG
Ga0170824_1178836614	3300031231	Forest Soil	MIKRTLGFVALCGWLMAASGSLLAHHSLAGVYDMKKE
Ga0302324_1012386381	3300031236	Palsa	MIYKRPLGPAAFLCGLLMACASLQAHHSLAGVYDMKAE
Ga0307506_103537371	3300031366	Soil	MNKRTVGCALLGGLLMAGVSLQAHHSLAGVYDMKKEAEVSG
Ga0310886_105045292	3300031562	Soil	MTGRILGCAVVCGWLMAAGSLQAHHSLAGVYDMKK
Ga0310915_112115341	3300031573	Soil	MVKRTLVGLALCGLMATGSLLAHHSLAGVYDMKKDMELA
Ga0310686_1050985012	3300031708	Soil	MIKRTLGCVALFGWLMAASVSLQAHHSLAGVYDMKK
Ga0310686_1077125994	3300031708	Soil	MIKRTLGCVALFGCLVASTGLLQAHHSLAGVYDMKNEKEMSGTVASIKF
Ga0310686_1095467851	3300031708	Soil	MVKRTLGSIAFFGLLMTVGGTLQAHHSLAGVYDMKAEKEMAG
Ga0318511_102896672	3300031845	Soil	MLRRILGYVALWGWLMTCGPLQAHHSLAGVYDMKAEKELSGEV
Ga0310904_104921692	3300031854	Soil	MIGRTFGCVVLCGWLMVTASLQAHHSLAGVYDMRK
Ga0310892_107970882	3300031858	Soil	MIGRALGWVVVCGYLMAGASLQAHHSLAGVYDMKA
Ga0306923_112260182	3300031910	Soil	MIKRALGCVVACGCLIAGVSLQAHHSLAGVYDMKAEKEIQGTLSVIK
Ga0306923_121609711	3300031910	Soil	MIKRTLVGVVLCGFMTAGSLLAHHSLAGVYDMKKD
Ga0310885_100044891	3300031943	Soil	MVRRILGCVVMFGWLMAGVSLQAHHSLAGVYDMHKE
Ga0310884_107267852	3300031944	Soil	MIGRALGCIVVCGCLMAGASLQAHHSLAGVYDMKAEKEIAGT
Ga0310910_103641841	3300031946	Soil	MLRRILGYVALCGWLMTCGPLQAHHSLAGVYDMKAEKDVTGSVEK
Ga0310909_114156521	3300031947	Soil	MIRRALGCVVACGCLMAGASLQAHHSLAGVYDMKSEKE
Ga0310909_114719531	3300031947	Soil	MIKRILGCAALCAWLMASGSLQAHHSIAGVYDMRKDMELEGAVEKI
Ga0306926_118107592	3300031954	Soil	MIGRTLGCLVLCGCFFAGVSLQAHHSLAGVYDIRQDAQV
Ga0318540_101126154	3300032094	Soil	MLRRILGYVALWGWLMTCGPLQAHHSLAGVYDMKAEKELSGEVAQIKFS
Ga0310895_102990741	3300032122	Soil	MIRRALGCVVVCGCLMAGASLQAHHSLAGVYDMKAEKDI
Ga0335082_106408291	3300032782	Soil	MKRILGCMALFGWLMAGSLQAHHSLAGVYDMKAEKEVSGEVASIK
Ga0335078_1000926614	3300032805	Soil	MVKRTLGFSALVCGWLMASGLLQAHHSLAGVYDMKAEKEV
Ga0335078_109494553	3300032805	Soil	MFKRTIGCLVLVCGWLVSGGLLQAHHSLAGVYDMKADKELDGTVTSVK
Ga0335078_116877822	3300032805	Soil	MIKRTLGYVALFGLLMGASVSLQAHHSLAGVYDMKKETTVSG
Ga0335080_104857663	3300032828	Soil	MIKRTLGCAALFGWLMAGSLQAHHSLAGVYDMKAEKELSGEV
Ga0335081_101696767	3300032892	Soil	MIKRTLGCVALFGWLMTGSLQAHHSLAGVYDMKAEKELSGEVS
Ga0335081_110038221	3300032892	Soil	MMKRTLGFAALAGLLLAAAGSLQAHHSLAGVYDMKVEKELAGT
Ga0335069_121150322	3300032893	Soil	MIRRILGWAALVGCLMGASVSLVAHHSLAGVYDMKKDMELAGTVTSIKFTNPHGS
Ga0316628_1035682132	3300033513	Soil	MIQRTLGCVALWGLIASGSLQAHHSLAGVYDMKAE
Ga0314795_069307_549_659	3300034670	Soil	MIRRVLGSLVVCGCLMAGASLQAHHSLAGVYDMKAEK

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F019365

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences