NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F019378

Metagenome Family F019378

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F019378
Family Type Metagenome
Number of Sequences 230
Average Sequence Length 46 residues
Representative Sequence LPSGTVDEKLQREMIAVAAQRVKAAQPVPPERVFDFSFAQKVSESLR
Number of Associated Samples 188
Number of Associated Scaffolds 230

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.93 %
% of genes near scaffold ends (potentially truncated) 89.13 %
% of genes from short scaffolds (< 2000 bps) 82.61 %
Associated GOLD sequencing projects 179
AlphaFold2 3D model prediction Yes
3D model pTM-score0.35

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (62.174 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere
(13.913 % of family members)
Environment Ontology (ENVO) Unclassified
(29.565 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(34.348 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 33.33%    β-sheet: 0.00%    Coil/Unstructured: 66.67%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.35
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 230 Family Scaffolds
PF01717Meth_synt_2 30.00
PF09084NMT1 21.30
PF00903Glyoxalase 2.61
PF03446NAD_binding_2 2.17
PF00072Response_reg 1.74
PF00211Guanylate_cyc 1.74
PF01970TctA 1.74
PF14833NAD_binding_11 1.30
PF03401TctC 0.87
PF07331TctB 0.87
PF01321Creatinase_N 0.87
PF04879Molybdop_Fe4S4 0.87
PF00676E1_dh 0.87
PF00248Aldo_ket_red 0.87
PF03328HpcH_HpaI 0.87
PF13417GST_N_3 0.43
PF00384Molybdopterin 0.43
PF01977UbiD 0.43
PF02146SIR2 0.43
PF08240ADH_N 0.43
PF16864Dimerisation2 0.43
PF07669Eco57I 0.43
PF09957VapB_antitoxin 0.43
PF13470PIN_3 0.43
PF00873ACR_tran 0.43
PF00034Cytochrom_C 0.43
PF08281Sigma70_r4_2 0.43
PF04055Radical_SAM 0.43
PF14076DUF4258 0.43
PF00173Cyt-b5 0.43
PF00892EamA 0.43
PF00596Aldolase_II 0.43
PF16868NMT1_3 0.43
PF03886ABC_trans_aux 0.43
PF00005ABC_tran 0.43
PF01850PIN 0.43
PF00528BPD_transp_1 0.43
PF05359DUF748 0.43
PF02629CoA_binding 0.43

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 230 Family Scaffolds
COG0620Methionine synthase II (cobalamin-independent)Amino acid transport and metabolism [E] 30.00
COG0715ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic componentInorganic ion transport and metabolism [P] 21.30
COG4521ABC-type taurine transport system, periplasmic componentInorganic ion transport and metabolism [P] 21.30
COG1784TctA family transporterGeneral function prediction only [R] 1.74
COG2114Adenylate cyclase, class 3Signal transduction mechanisms [T] 1.74
COG3333TctA family transporterGeneral function prediction only [R] 1.74
COG0006Xaa-Pro aminopeptidaseAmino acid transport and metabolism [E] 0.87
COG0469Pyruvate kinaseCarbohydrate transport and metabolism [G] 0.87
COG05672-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, and related enzymesEnergy production and conversion [C] 0.87
COG1071TPP-dependent pyruvate or acetoin dehydrogenase subunit alphaEnergy production and conversion [C] 0.87
COG2301Citrate lyase beta subunitCarbohydrate transport and metabolism [G] 0.87
COG3181Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctCEnergy production and conversion [C] 0.87
COG38362-keto-3-deoxy-L-rhamnonate aldolase RhmACarbohydrate transport and metabolism [G] 0.87
COG00433-polyprenyl-4-hydroxybenzoate decarboxylaseCoenzyme transport and metabolism [H] 0.43
COG0846NAD-dependent protein deacetylase, SIR2 familyPosttranslational modification, protein turnover, chaperones [O] 0.43
COG2982Uncharacterized conserved protein AsmA involved in outer membrane biogenesisCell wall/membrane/envelope biogenesis [M] 0.43


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms62.17 %
UnclassifiedrootN/A37.83 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2140918013|NODE_7635_length_1586_cov_7.028373All Organisms → cellular organisms → Bacteria1618Open in IMG/M
2189573005|GZGK9D401CZE5FNot Available517Open in IMG/M
3300000033|ICChiseqgaiiDRAFT_c0384805Not Available514Open in IMG/M
3300000033|ICChiseqgaiiDRAFT_c0449106Not Available555Open in IMG/M
3300000550|F24TB_11042965All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium599Open in IMG/M
3300000596|KanNP_Total_noBrdU_T14TCDRAFT_1038649All Organisms → cellular organisms → Bacteria537Open in IMG/M
3300001431|F14TB_100189477All Organisms → cellular organisms → Bacteria1401Open in IMG/M
3300002124|C687J26631_10013954All Organisms → cellular organisms → Bacteria2852Open in IMG/M
3300002223|C687J26845_10134448All Organisms → cellular organisms → Bacteria905Open in IMG/M
3300003373|JGI25407J50210_10180865Not Available520Open in IMG/M
3300004067|Ga0055485_10214190All Organisms → cellular organisms → Bacteria552Open in IMG/M
3300004114|Ga0062593_100808469Not Available933Open in IMG/M
3300005174|Ga0066680_10945255All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium508Open in IMG/M
3300005295|Ga0065707_10121512All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2109Open in IMG/M
3300005295|Ga0065707_10874910Not Available574Open in IMG/M
3300005364|Ga0070673_100365442Not Available1283Open in IMG/M
3300005444|Ga0070694_101742453Not Available530Open in IMG/M
3300005526|Ga0073909_10014240All Organisms → cellular organisms → Bacteria → Proteobacteria2479Open in IMG/M
3300005544|Ga0070686_100584328All Organisms → cellular organisms → Bacteria878Open in IMG/M
3300005554|Ga0066661_10034200All Organisms → cellular organisms → Bacteria2828Open in IMG/M
3300005555|Ga0066692_10836082All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium565Open in IMG/M
3300005568|Ga0066703_10753839All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium558Open in IMG/M
3300005617|Ga0068859_100338736Not Available1598Open in IMG/M
3300005713|Ga0066905_100554633All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria965Open in IMG/M
3300005713|Ga0066905_100764062Not Available835Open in IMG/M
3300005713|Ga0066905_100867414All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium788Open in IMG/M
3300005713|Ga0066905_101837921All Organisms → cellular organisms → Bacteria559Open in IMG/M
3300005890|Ga0075285_1048125Not Available567Open in IMG/M
3300005937|Ga0081455_11003654All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300005981|Ga0081538_10204645Not Available805Open in IMG/M
3300006046|Ga0066652_100521843Not Available1107Open in IMG/M
3300006049|Ga0075417_10107219All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1271Open in IMG/M
3300006049|Ga0075417_10626194Not Available549Open in IMG/M
3300006049|Ga0075417_10669614All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium531Open in IMG/M
3300006049|Ga0075417_10688638All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium524Open in IMG/M
3300006058|Ga0075432_10383685All Organisms → cellular organisms → Bacteria603Open in IMG/M
3300006058|Ga0075432_10519730Not Available533Open in IMG/M
3300006173|Ga0070716_100165608Not Available1437Open in IMG/M
3300006237|Ga0097621_100811390Not Available867Open in IMG/M
3300006358|Ga0068871_101597400Not Available617Open in IMG/M
3300006794|Ga0066658_10343257Not Available798Open in IMG/M
3300006794|Ga0066658_10732876Not Available549Open in IMG/M
3300006797|Ga0066659_10814346Not Available774Open in IMG/M
3300006845|Ga0075421_101410372All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium766Open in IMG/M
3300006845|Ga0075421_101592567Not Available711Open in IMG/M
3300006846|Ga0075430_100191583All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1699Open in IMG/M
3300006847|Ga0075431_101298333Not Available689Open in IMG/M
3300006852|Ga0075433_10394800Not Available1221Open in IMG/M
3300006852|Ga0075433_10554970Not Available1010Open in IMG/M
3300006852|Ga0075433_11287228Not Available634Open in IMG/M
3300006903|Ga0075426_10018752All Organisms → cellular organisms → Bacteria4941Open in IMG/M
3300006904|Ga0075424_100899079All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium945Open in IMG/M
3300006914|Ga0075436_100393017Not Available1004Open in IMG/M
3300006969|Ga0075419_10647436All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium746Open in IMG/M
3300007004|Ga0079218_10082841All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2137Open in IMG/M
3300007076|Ga0075435_100078374All Organisms → cellular organisms → Bacteria2709Open in IMG/M
3300009094|Ga0111539_10111196All Organisms → cellular organisms → Bacteria3215Open in IMG/M
3300009094|Ga0111539_13430947Not Available509Open in IMG/M
3300009111|Ga0115026_10819395All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium729Open in IMG/M
3300009147|Ga0114129_13387104All Organisms → cellular organisms → Bacteria513Open in IMG/M
3300009156|Ga0111538_13174965Not Available573Open in IMG/M
3300009157|Ga0105092_10307569Not Available895Open in IMG/M
3300009162|Ga0075423_11252526All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium792Open in IMG/M
3300009167|Ga0113563_11417927All Organisms → cellular organisms → Bacteria816Open in IMG/M
3300009553|Ga0105249_11975683Not Available656Open in IMG/M
3300009777|Ga0105164_10027110All Organisms → cellular organisms → Bacteria3185Open in IMG/M
3300009792|Ga0126374_10003805All Organisms → cellular organisms → Bacteria5049Open in IMG/M
3300009816|Ga0105076_1110728All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300009817|Ga0105062_1070801All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria661Open in IMG/M
3300009818|Ga0105072_1085265All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium623Open in IMG/M
3300010043|Ga0126380_10471964All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium954Open in IMG/M
3300010043|Ga0126380_11859555All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium546Open in IMG/M
3300010046|Ga0126384_10954784All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium778Open in IMG/M
3300010046|Ga0126384_11783747All Organisms → cellular organisms → Bacteria584Open in IMG/M
3300010304|Ga0134088_10604646All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium545Open in IMG/M
3300010358|Ga0126370_12169339All Organisms → cellular organisms → Bacteria547Open in IMG/M
3300010360|Ga0126372_10607046All Organisms → cellular organisms → Bacteria1051Open in IMG/M
3300010362|Ga0126377_11235151All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium818Open in IMG/M
3300010362|Ga0126377_11454403Not Available759Open in IMG/M
3300010391|Ga0136847_11581319All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium622Open in IMG/M
3300010396|Ga0134126_13061210Not Available504Open in IMG/M
3300010397|Ga0134124_11623250Not Available677Open in IMG/M
3300010397|Ga0134124_12233969All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium587Open in IMG/M
3300010399|Ga0134127_10335883Not Available1470Open in IMG/M
3300010400|Ga0134122_10948213Not Available838Open in IMG/M
3300010938|Ga0137716_10114818All Organisms → cellular organisms → Bacteria → Proteobacteria1967Open in IMG/M
3300011434|Ga0137464_1210258All Organisms → cellular organisms → Bacteria591Open in IMG/M
3300011436|Ga0137458_1267356Not Available521Open in IMG/M
3300011438|Ga0137451_1238779Not Available573Open in IMG/M
3300011440|Ga0137433_1305303All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium516Open in IMG/M
3300011444|Ga0137463_1017775All Organisms → cellular organisms → Bacteria2524Open in IMG/M
3300012022|Ga0120191_10023180All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium905Open in IMG/M
3300012034|Ga0137453_1013484Not Available1211Open in IMG/M
3300012035|Ga0137445_1075373Not Available676Open in IMG/M
3300012167|Ga0137319_1093777All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium607Open in IMG/M
3300012171|Ga0137342_1029832All Organisms → cellular organisms → Bacteria1037Open in IMG/M
3300012200|Ga0137382_11091015All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium570Open in IMG/M
3300012200|Ga0137382_11117555All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium562Open in IMG/M
3300012201|Ga0137365_11178146All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium549Open in IMG/M
3300012204|Ga0137374_10026823All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC68606395Open in IMG/M
3300012209|Ga0137379_10580125All Organisms → cellular organisms → Bacteria1028Open in IMG/M
3300012354|Ga0137366_10853788All Organisms → cellular organisms → Bacteria644Open in IMG/M
3300012358|Ga0137368_10016726All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC68607126Open in IMG/M
3300012361|Ga0137360_10358248Not Available1222Open in IMG/M
3300012473|Ga0157340_1016469All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium585Open in IMG/M
3300012509|Ga0157334_1002852All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1232Open in IMG/M
3300012515|Ga0157338_1025485All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium720Open in IMG/M
3300012519|Ga0157352_1108443All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium502Open in IMG/M
3300012532|Ga0137373_10944140Not Available629Open in IMG/M
3300012918|Ga0137396_10321259All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1145Open in IMG/M
3300012929|Ga0137404_10930119All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium794Open in IMG/M
3300012930|Ga0137407_10450124All Organisms → cellular organisms → Bacteria1198Open in IMG/M
3300012930|Ga0137407_10592769All Organisms → cellular organisms → Bacteria1040Open in IMG/M
3300012944|Ga0137410_11919496All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium525Open in IMG/M
3300012948|Ga0126375_10656036All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium810Open in IMG/M
3300012971|Ga0126369_10752634All Organisms → cellular organisms → Bacteria1054Open in IMG/M
3300012971|Ga0126369_11682636All Organisms → cellular organisms → Bacteria724Open in IMG/M
3300012971|Ga0126369_11832320Not Available695Open in IMG/M
3300012986|Ga0164304_10490536Not Available895Open in IMG/M
3300013096|Ga0157307_1120221Not Available580Open in IMG/M
3300014154|Ga0134075_10205523All Organisms → cellular organisms → Bacteria847Open in IMG/M
3300014861|Ga0180061_1009284Not Available1334Open in IMG/M
3300014878|Ga0180065_1160376Not Available518Open in IMG/M
3300014884|Ga0180104_1044612All Organisms → cellular organisms → Bacteria1175Open in IMG/M
3300015264|Ga0137403_10760955All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium827Open in IMG/M
3300015357|Ga0134072_10119193All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria834Open in IMG/M
3300015372|Ga0132256_103581700All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium522Open in IMG/M
3300015374|Ga0132255_100373605All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2070Open in IMG/M
3300018031|Ga0184634_10358463All Organisms → cellular organisms → Bacteria668Open in IMG/M
3300018053|Ga0184626_10086595Not Available1325Open in IMG/M
3300018053|Ga0184626_10131104All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1066Open in IMG/M
3300018054|Ga0184621_10225762All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium670Open in IMG/M
3300018059|Ga0184615_10126192All Organisms → cellular organisms → Bacteria1444Open in IMG/M
3300018064|Ga0187773_10736274All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium619Open in IMG/M
3300018075|Ga0184632_10139557All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1068Open in IMG/M
3300018075|Ga0184632_10427736All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium552Open in IMG/M
3300018076|Ga0184609_10027251All Organisms → cellular organisms → Bacteria2321Open in IMG/M
3300018076|Ga0184609_10492420Not Available559Open in IMG/M
3300018078|Ga0184612_10209917All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1011Open in IMG/M
3300018078|Ga0184612_10375532All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium718Open in IMG/M
3300018084|Ga0184629_10495520All Organisms → cellular organisms → Bacteria637Open in IMG/M
3300018089|Ga0187774_10013323All Organisms → cellular organisms → Bacteria3092Open in IMG/M
3300018422|Ga0190265_12334311All Organisms → cellular organisms → Bacteria636Open in IMG/M
3300018422|Ga0190265_13460965Not Available526Open in IMG/M
3300018431|Ga0066655_10928375All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria597Open in IMG/M
3300018469|Ga0190270_10338840All Organisms → cellular organisms → Bacteria1361Open in IMG/M
3300018482|Ga0066669_11515223All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium610Open in IMG/M
3300019879|Ga0193723_1133064All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium681Open in IMG/M
3300019882|Ga0193713_1147886All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium632Open in IMG/M
3300019882|Ga0193713_1175377All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium561Open in IMG/M
3300019885|Ga0193747_1127473All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium598Open in IMG/M
3300020022|Ga0193733_1037301Not Available1372Open in IMG/M
3300020061|Ga0193716_1080606Not Available1441Open in IMG/M
3300020186|Ga0163153_10017288All Organisms → cellular organisms → Bacteria6195Open in IMG/M
3300021073|Ga0210378_10149286Not Available902Open in IMG/M
3300021073|Ga0210378_10189961Not Available786Open in IMG/M
3300021081|Ga0210379_10361442All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium639Open in IMG/M
3300021081|Ga0210379_10429555Not Available585Open in IMG/M
3300021344|Ga0193719_10113150All Organisms → cellular organisms → Bacteria1180Open in IMG/M
3300021560|Ga0126371_10950797All Organisms → cellular organisms → Bacteria1002Open in IMG/M
3300022208|Ga0224495_10201817Not Available830Open in IMG/M
3300022534|Ga0224452_1200441All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium613Open in IMG/M
3300022534|Ga0224452_1287020All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium502Open in IMG/M
3300022756|Ga0222622_10837301All Organisms → cellular organisms → Bacteria → Proteobacteria673Open in IMG/M
(restricted) 3300023208|Ga0233424_10242940All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium711Open in IMG/M
3300025159|Ga0209619_10136144All Organisms → cellular organisms → Bacteria1432Open in IMG/M
3300025165|Ga0209108_10134830Not Available1310Open in IMG/M
3300025167|Ga0209642_10278837All Organisms → cellular organisms → Bacteria953Open in IMG/M
3300025174|Ga0209324_10028295All Organisms → cellular organisms → Bacteria3848Open in IMG/M
3300025322|Ga0209641_10297629All Organisms → cellular organisms → Bacteria1188Open in IMG/M
3300025906|Ga0207699_10871646All Organisms → cellular organisms → Bacteria664Open in IMG/M
3300025912|Ga0207707_10016840All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC68606368Open in IMG/M
3300025923|Ga0207681_10053396All Organisms → cellular organisms → Bacteria2743Open in IMG/M
3300025930|Ga0207701_11043564Not Available679Open in IMG/M
3300025931|Ga0207644_10990663All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Syntrophomonadaceae → unclassified Syntrophomonadaceae → Syntrophomonadaceae bacterium705Open in IMG/M
3300025933|Ga0207706_10458903Not Available1102Open in IMG/M
3300025940|Ga0207691_10314483All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1343Open in IMG/M
3300025959|Ga0210116_1004318All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2438Open in IMG/M
3300026095|Ga0207676_10752079Not Available948Open in IMG/M
3300026118|Ga0207675_100589729All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1113Open in IMG/M
3300026296|Ga0209235_1104603All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1214Open in IMG/M
3300026313|Ga0209761_1202565All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria869Open in IMG/M
3300026320|Ga0209131_1108966All Organisms → cellular organisms → Bacteria1450Open in IMG/M
3300026330|Ga0209473_1228656All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria669Open in IMG/M
3300026529|Ga0209806_1032568All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2576Open in IMG/M
3300026535|Ga0256867_10034118All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2119Open in IMG/M
3300026714|Ga0207567_101250Not Available553Open in IMG/M
3300027722|Ga0209819_10323140All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300027815|Ga0209726_10434405Not Available604Open in IMG/M
3300027873|Ga0209814_10531729All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium522Open in IMG/M
3300027907|Ga0207428_10462438All Organisms → cellular organisms → Bacteria924Open in IMG/M
3300027907|Ga0207428_10867482All Organisms → cellular organisms → Bacteria639Open in IMG/M
3300027907|Ga0207428_10999480Not Available588Open in IMG/M
3300027909|Ga0209382_10135273All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC68602866Open in IMG/M
3300027957|Ga0209857_1048315All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria753Open in IMG/M
3300028802|Ga0307503_10292581Not Available814Open in IMG/M
3300031548|Ga0307408_101441257Not Available649Open in IMG/M
3300031720|Ga0307469_10080340All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2206Open in IMG/M
3300031720|Ga0307469_10440753All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1125Open in IMG/M
3300031740|Ga0307468_100262973All Organisms → cellular organisms → Bacteria1223Open in IMG/M
3300031740|Ga0307468_100906040All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium765Open in IMG/M
3300031740|Ga0307468_102038495All Organisms → cellular organisms → Bacteria551Open in IMG/M
3300031754|Ga0307475_10163028All Organisms → cellular organisms → Bacteria1775Open in IMG/M
3300031824|Ga0307413_10562217Not Available927Open in IMG/M
3300031854|Ga0310904_11083343Not Available574Open in IMG/M
3300031943|Ga0310885_10513688Not Available654Open in IMG/M
3300031962|Ga0307479_10575783All Organisms → cellular organisms → Bacteria1108Open in IMG/M
3300032005|Ga0307411_11505634Not Available618Open in IMG/M
3300032012|Ga0310902_11222400Not Available530Open in IMG/M
3300032180|Ga0307471_101232564All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium912Open in IMG/M
3300032205|Ga0307472_100057832All Organisms → cellular organisms → Bacteria2460Open in IMG/M
3300032205|Ga0307472_102757254Not Available502Open in IMG/M
3300032421|Ga0310812_10444814Not Available584Open in IMG/M
3300033417|Ga0214471_10435264All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1054Open in IMG/M
3300033433|Ga0326726_11708675Not Available613Open in IMG/M
3300034151|Ga0364935_0176170All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium683Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere13.91%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil6.96%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil6.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil6.52%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil6.09%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment5.65%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil5.22%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil4.35%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.17%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.17%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil2.17%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment1.74%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.74%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand1.74%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment1.30%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.30%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.30%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.30%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.30%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.30%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.30%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.30%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.30%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.30%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.87%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.87%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.87%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.87%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.87%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.87%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.87%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere0.87%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.87%
WetlandEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland0.43%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.43%
Freshwater Microbial MatEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat0.43%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment0.43%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.43%
WastewaterEnvironmental → Aquatic → Freshwater → Drinking Water → Unchlorinated → Wastewater0.43%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater0.43%
SedimentEnvironmental → Aquatic → Marine → Sediment → Unclassified → Sediment0.43%
Hot Spring Fe-Si SedimentEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Neutral → Hot Spring Fe-Si Sediment0.43%
TerrestrialEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial0.43%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil0.43%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.43%
Unplanted SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil0.43%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.43%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.43%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.43%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil0.43%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.43%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.43%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.43%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.43%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.43%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.43%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.43%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.43%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.43%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.43%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2140918013Soil microbial communities from Great Prairies - Iowa soil (MSU Assemblies)EnvironmentalOpen in IMG/M
2189573005Grass soil microbial communities from Rothamsted Park, UK - FG3 (Nitrogen)EnvironmentalOpen in IMG/M
3300000033Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000550Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemlyEnvironmentalOpen in IMG/M
3300000596Amended soil microbial communities from Kansas Great Prairies, USA - Total DNA no BrdU F1.4TCEnvironmentalOpen in IMG/M
3300001431Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemlyEnvironmentalOpen in IMG/M
3300002124Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_3EnvironmentalOpen in IMG/M
3300002223Soil microbial communities from Rifle, Colorado - Rifle CSP2_plank lowO2_1.2EnvironmentalOpen in IMG/M
3300003373Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1Host-AssociatedOpen in IMG/M
3300004067Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqA_D2EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300005174Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129EnvironmentalOpen in IMG/M
3300005295Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3EnvironmentalOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005554Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110EnvironmentalOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005568Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152EnvironmentalOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005890Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_104EnvironmentalOpen in IMG/M
3300005937Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300005981Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1Host-AssociatedOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006058Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1Host-AssociatedOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009111Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009157Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009167Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2)EnvironmentalOpen in IMG/M
3300009168Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015EnvironmentalOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009777Wastewater microbial communities from Netherlands to study Microbial Dark Matter (Phase II) - VDW unchlorinated drinking waterEnvironmentalOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300009816Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10EnvironmentalOpen in IMG/M
3300009817Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20EnvironmentalOpen in IMG/M
3300009818Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010391Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010938Sediment microbial community from Chocolate Pots hot springs, Yellowstone National Park, Wyoming, USA. Combined Assembly of Gp0156111, Gp0156114, Gp0156117EnvironmentalOpen in IMG/M
3300011434Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT814_2EnvironmentalOpen in IMG/M
3300011436Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT642_2EnvironmentalOpen in IMG/M
3300011438Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT500_2EnvironmentalOpen in IMG/M
3300011440Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT840_2EnvironmentalOpen in IMG/M
3300011444Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2EnvironmentalOpen in IMG/M
3300012022Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C6EnvironmentalOpen in IMG/M
3300012034Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT526_2EnvironmentalOpen in IMG/M
3300012035Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT338_2EnvironmentalOpen in IMG/M
3300012167Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT333_2EnvironmentalOpen in IMG/M
3300012171Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT466_2EnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012358Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012473Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610Host-AssociatedOpen in IMG/M
3300012509Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.080610_6EnvironmentalOpen in IMG/M
3300012515Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610Host-AssociatedOpen in IMG/M
3300012519Unplanted soil (control) microbial communities from North Carolina - M.Soil.7.yng.070610EnvironmentalOpen in IMG/M
3300012532Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012931Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaGEnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300013096Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2EnvironmentalOpen in IMG/M
3300014154Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015EnvironmentalOpen in IMG/M
3300014861Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT27_16_10DEnvironmentalOpen in IMG/M
3300014878Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200A_16_10DEnvironmentalOpen in IMG/M
3300014884Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_1DaEnvironmentalOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015357Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300018031Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1EnvironmentalOpen in IMG/M
3300018053Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1EnvironmentalOpen in IMG/M
3300018054Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1EnvironmentalOpen in IMG/M
3300018059Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coexEnvironmentalOpen in IMG/M
3300018064Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018075Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1EnvironmentalOpen in IMG/M
3300018076Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coexEnvironmentalOpen in IMG/M
3300018078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coexEnvironmentalOpen in IMG/M
3300018084Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1EnvironmentalOpen in IMG/M
3300018089Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019879Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2EnvironmentalOpen in IMG/M
3300019882Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2EnvironmentalOpen in IMG/M
3300019885Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2EnvironmentalOpen in IMG/M
3300020022Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2EnvironmentalOpen in IMG/M
3300020061Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c1EnvironmentalOpen in IMG/M
3300020186Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.MP6.IB-1EnvironmentalOpen in IMG/M
3300021073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redoEnvironmentalOpen in IMG/M
3300021081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redoEnvironmentalOpen in IMG/M
3300021344Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2EnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022208Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_4_1EnvironmentalOpen in IMG/M
3300022534Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300023208 (restricted)Freshwater microbial communities from Lake Towuti, South Sulawesi, Indonesia - Watercolumn_Towuti2014_125_MGEnvironmentalOpen in IMG/M
3300025159Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 3EnvironmentalOpen in IMG/M
3300025165Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 1EnvironmentalOpen in IMG/M
3300025167Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 19_2 (SPAdes)EnvironmentalOpen in IMG/M
3300025174Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 3EnvironmentalOpen in IMG/M
3300025322Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_1 (SPAdes)EnvironmentalOpen in IMG/M
3300025326Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_2 (SPAdes)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025959Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqB_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026296Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026313Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026330Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes)EnvironmentalOpen in IMG/M
3300026529Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes)EnvironmentalOpen in IMG/M
3300026535Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (HiSeq)EnvironmentalOpen in IMG/M
3300026547Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes)EnvironmentalOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300026714Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G06A1a-12 (SPAdes)EnvironmentalOpen in IMG/M
3300027722Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027815Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m (SPAdes)EnvironmentalOpen in IMG/M
3300027873Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300027957Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_10_20 (SPAdes)EnvironmentalOpen in IMG/M
3300028802Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_SEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031548Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3Host-AssociatedOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031824Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2Host-AssociatedOpen in IMG/M
3300031854Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1EnvironmentalOpen in IMG/M
3300031943Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032005Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1Host-AssociatedOpen in IMG/M
3300032012Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032421Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3EnvironmentalOpen in IMG/M
3300033417Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT142D155EnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M
3300034151Sediment microbial communities from East River floodplain, Colorado, United States - 2_s17EnvironmentalOpen in IMG/M
3300034176Sediment microbial communities from East River floodplain, Colorado, United States - 21_j17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
Iowa-Corn-GraphCirc_006044702140918013SoilXLSSGSVDEKLQREMIATAAQRVKPKNPVPPERVFDFSFAHKVADSLK
FG3_074296402189573005Grass SoilDAALQFYLQTGIVDEKVRREMIAVAAHRVKPKEVPPPERVFDFSFAQKVSDSFK
ICChiseqgaiiDRAFT_038480523300000033SoilMTXAXXFFLXSGSVDEKLQREMIATAAQRVKPKNPVPPERVFDFSFAHKVADSLK*
ICChiseqgaiiDRAFT_044910613300000033SoilVDEKLQREMIITAAQRTKLAQPPLPERVFDFSFAQKVGETLK*
F24TB_1104296523300000550SoilKLQREMIAVAAQRVKPKELPPPERVFDFSFAQKVADSMK*
KanNP_Total_noBrdU_T14TCDRAFT_103864913300000596SoilALQYYLQSGIVDEKLQREMISVAAQRVKPXQPVPAERVFDFSLAQKVSESFR*
F14TB_10018947733300001431SoilQSGIVDEKLQREMISVAAQRVKPAQPVPAERVFDFSLAQKVSESFR*
C687J26631_1001395443300002124SoilIRRVFLETGIVDEQLQREMIADASQRIKPLQPVPPERVFDFSFAQKGSRFPR*
C687J26845_1013444823300002223SoilLQREMIADASQRIKPLQPVPPERVFDFSFAQKGSRFPR*
JGI25407J50210_1018086513300003373Tabebuia Heterophylla RhizosphereREMIAIASQRVKPAQPVPPERVFDFTFTQKLSYLSKQGL*
Ga0055485_1021419013300004067Natural And Restored WetlandsTSGTVDEKLQREMIATAAQRTKLAQPPAPERVFDFSFAQKVAESLK*
Ga0062593_10080846923300004114SoilFLPSGSVDEKLQREMIATAAQRVKPKNPVPPERVFDFSFAHKVADSLK*
Ga0066680_1094525523300005174SoilEKLQREMIAVAAQRVKPTPSVTPERVFDFSFARKARETLR*
Ga0065707_1012151213300005295Switchgrass RhizosphereFTERAYDAAVGGYVLTGLVDEKLQREMIASAAQRVKATPPTPERVFDFSFARKVSASLQ*
Ga0065707_1087491013300005295Switchgrass RhizosphereGVVDEKVQREMIATAAERIKPKEAVPPERVFDFSFIQKVRDSVR*
Ga0070673_10036544223300005364Switchgrass RhizosphereYLTSGMVDEKVQREMIATAAERIKPKESVPPERVFDFSFIQKVRGSVR*
Ga0070694_10174245323300005444Corn, Switchgrass And Miscanthus RhizosphereSGAVDEKLQREMIAVAAQRIKPKEMAPPERVFDFSFALKVAETLR*
Ga0073909_1001424013300005526Surface SoilMIAVAAQRVKPKELPPPERVFDFSFAQKVSDSFK*
Ga0070686_10058432823300005544Switchgrass RhizosphereATVQSYLVTGTLDEKLQRDMIAMAAERIKPKAPVAPDRVFDFSFARKAAEALR*
Ga0066661_1003420043300005554SoilGYLLSGVVDEKLQREMIAVAAQRVKPAQPVPPERVFDFSFARKAGEATR*
Ga0066692_1083608213300005555SoilLSGLVDEKLQREMIASAAQRVKATPPTPERVFDFSFARKVSASLQ*
Ga0066703_1075383913300005568SoilYLPSGAVDERLQREMISVAAQRIKPKELAPHERVFDFSFASRVADSLK*
Ga0068859_10033873633300005617Switchgrass RhizosphereATVDEKLQREMIAIAAQRIKPKDPVPPERVFDFSFAQKVAESFK*
Ga0066905_10055463313300005713Tropical Forest SoilEAAAQGYVLSGVVDEKLQREMITSAAQRVKATPPALERVFDFSFARKASVTLP*
Ga0066905_10076406213300005713Tropical Forest SoilALQLYLATPTVDEKLQREMIATAAQRIKPKEVPPPERVFDFSFVQKVGESLK*
Ga0066905_10086741423300005713Tropical Forest SoilTGAVDEKLQREMISVAAQRIKPKELPPPERVFEFSFALKVAESFK*
Ga0066905_10183792113300005713Tropical Forest SoilAALQYYLPSGSVDETLQREMIAVAAQRVKTAQPPPPERVFDFSFAQKVSETLR*
Ga0075285_104812513300005890Rice Paddy SoilEMIATAAQRLKPKDPVPPERVFDFSFAQKVAEASK*
Ga0081455_1100365413300005937Tabebuia Heterophylla RhizosphereAAVQGYLLSGIVDEKLQREMIAVAAQRVKLAQPVTPERVFDFSFARKASETLR*
Ga0081538_1020464513300005981Tabebuia Heterophylla RhizosphereEKLQREMISAAAQRVKVAPPPLGRVFDFSFARKVSDSLR*
Ga0066652_10052184313300006046SoilREMIAIAAQRIKPKDPVSPERVFDFSFVQKVGESMK*
Ga0075417_1010721923300006049Populus RhizosphereYVLSGLVDEKLQREMIASAAQRVKAASPAPERVFDFSFARKVSASLQ*
Ga0075417_1062619413300006049Populus RhizosphereYLQTGTVDEKVQREMIAVAAQRIKPKELPPPERVFDFSFAQKVSDSLK*
Ga0075417_1066961423300006049Populus RhizosphereDEKLQREMIASAAQRVKAAPPAPERVFDFSFARKVSASFQ*
Ga0075417_1068863823300006049Populus RhizosphereDEKLQREMIASAAQRVKAAPPAPERVFDFSFARKVSASFR*
Ga0075432_1038368513300006058Populus RhizosphereGIVDEKLQREMIAVAAQRVKLAQPVTPERVFDFSFARKAGEALR*
Ga0075432_1051973013300006058Populus RhizosphereVDEKVQREMIATAAERIKPKEPVPPERVFDFSFIQKVRGSVR*
Ga0070716_10016560813300006173Corn, Switchgrass And Miscanthus RhizosphereGAVDEKLQREMIAVAAQRVKPTPSVTPERVFDFSFARKAGETLR*
Ga0097621_10081139023300006237Miscanthus RhizosphereGTVDEKVQREMIEVAAQRVKPKAPVTPDRVFDFSFAQKVTESFK*
Ga0068871_10159740013300006358Miscanthus RhizosphereVQSYLVTGTLDEKLQRDMIAMAAERIKPKAPVAPDRVFDFSFARKAAEALR*
Ga0066658_1034325723300006794SoilYYLMSGSVDEKLQREMIAVAAQRVKPKELAPPERVFDFSFVQKVSELFR*
Ga0066658_1073287613300006794SoilREMIATAAQRIKPKEPVPTERVFDLSFVQKVAESLK*
Ga0066659_1081434613300006797SoilYLQSATVDEKLQREMIAIASQRIRPKEPVPPERVFDFSIVQKVGESLK*
Ga0075421_10141037223300006845Populus RhizosphereDEPLQREMIAIAAQRVKPAHPVPPERVFDFSFVQKATQPLR*
Ga0075421_10159256723300006845Populus RhizosphereQREMIAVAAQRIKPKETAPPERVFDFSFALKVAESLR*
Ga0075430_10019158313300006846Populus RhizosphereLQFYLQSGVVDEKLQRDMIATAAQRVKPKDPIPPERVFDFSFAQKVADSMK*
Ga0075431_10129833333300006847Populus RhizosphereSGSVDEKLQREMIATAAQRVKPKDPVPPERVFDFSFAQRVAETLK*
Ga0075431_10204058413300006847Populus RhizosphereAERVYDAAVQGYLLTGSVDEKLQREMIADAARRIKPTQPVTPDRVFDFSFVQKVVETLR*
Ga0075433_1039480013300006852Populus RhizosphereVVDEKVQREMIATAAERIKLKEAVPPERVFDFSFIQKVRDSVR*
Ga0075433_1055497013300006852Populus RhizosphereQTPTVDEKLQREMIATAAQRIKPKEPVPTERVFDFSFVQKVAESLK*
Ga0075433_1128722813300006852Populus RhizosphereLYLASGVVDEKVQREMIATAAERIKPKEPVPPERVFDFSFIQKVRDVK*
Ga0075425_10143824513300006854Populus RhizosphereVYDAAVQGYLLTGSVDEKLQREMIADAARRIKPTQPVTPDRVFDFSFVQKVVETLR*
Ga0075426_1001875223300006903Populus RhizosphereVIRFSPAVHGYVLSGLIEEKLQREMIASAAQRVKATPPTPERVFDFSFARKVSASLQ*
Ga0075426_1029167023300006903Populus RhizosphereERAYDAAVQGYLLSGVVDEKLQREMIAVAAQRVKLAQPVTPERVFDFSFARKAGEALR*
Ga0075424_10089907923300006904Populus RhizosphereVDEKLQREMIAVAAQRIKLAQPVTPERVFDFSFAREAGEALR*
Ga0075436_10039301713300006914Populus RhizosphereVQLYLQTPTVDEKLQREMIAIAAQRIKPKEPVPTERVFDFSFVQKVAESFK*
Ga0075419_1064743623300006969Populus RhizosphereSGVVDEKLQREMIAVAAQRVKLAQPVTPERVFDFSFARKAGEALR*
Ga0079218_1008284113300007004Agricultural SoilQRDMIATAAQRVKPKDPVPPERVFDFSFAQKVADSMK*
Ga0075435_10007837413300007076Populus RhizosphereLYLASGVVDEKVQREMIATAAERIKPKEPVPPERVFDFSFIQKVRDAAR*
Ga0099828_1034189023300009089Vadose Zone SoilDRFAERAYDAAVQGYLLSGVVDEKLQREMITVASQRIKPAQPVLPDRVFDFSFARKAGVTLR*
Ga0111539_1011119643300009094Populus RhizosphereQLYLTSGMVDEKVQREMIATAAERIKPKEPVPPERVFDFSFIQKVRGSVR*
Ga0111539_1343094713300009094Populus RhizosphereKVQREMIATAAERIKPKEPVAPERVFDFSFIQKVRDSVR*
Ga0115026_1081939513300009111WetlandEAAVGYLSTSGIVDEKLQREMIVTAAQRTKLAQPPPPERVFDFSFAQKVGETLK*
Ga0114129_1338710413300009147Populus RhizosphereREMISVAAQRIKKPQPVPPERVFDFSFAQKVSESLR*
Ga0111538_1317496513300009156Populus RhizosphereQTGTVDEKVQREMIAVAAQRVKPKELPPPERVFDFSFAQKVSDSFK*
Ga0105092_1030756913300009157Freshwater SedimentDMIATAAQRVKPKDPVPPERVFDFSFAQKVADSMK*
Ga0075423_1125252633300009162Populus RhizosphereAYDAAVRGYVLSGLVDEKLQREMITAAAQRVKAAPPTSERVFDFSFARKVSASVQ*
Ga0113563_1141792723300009167Freshwater WetlandsSGLVDEKLQREMIAAAAQRIKPPEPVMPERVFDFSFARKVSESMR*
Ga0105104_1089111113300009168Freshwater SedimentTERAYEAAVQGYPLSGIVDEKLQREMIAVAAQRVKLAQPVTPERVFDFSFARKAGESLR*
Ga0105249_1197568323300009553Switchgrass RhizosphereSGAVDEKLQREMIAVAAQRIKPKEIAPPERVFDFSFALKVAETLR*
Ga0105164_1002711043300009777WastewaterVYDAAVQGYLLSGVVDEKLQREMITVAAQRVKPQQPVTPERIFDFSFAHRVSEALR*
Ga0126374_1000380573300009792Tropical Forest SoilETLQHEMIAVASQRAKPAHPVPPERVFDFSFAQKVGESLR*
Ga0105076_111072813300009816Groundwater SandVDDKLQREMITSAAQRVKAAPPTPERVFDFSFARKVSASLQ*
Ga0105062_107080113300009817Groundwater SandLQSGTVDEKLQREMIAVAAQRIKPAQPVPPERVFDFSFAQKATESLR*
Ga0105072_108526513300009818Groundwater SandDATMELYLSSHTVDEALQREMIAIAAQRVKPAQPVPPERVFDFSFTQKVSESLR*
Ga0126380_1047196423300010043Tropical Forest SoilIVDEKLQREMIAVAAQRVKLPQPVAPERVFDFSFARKASETLR*
Ga0126380_1185955523300010043Tropical Forest SoilSGTVDETLQHEMIAVASQRAKPAHPVPPERVFDFSFAQKVGESLR*
Ga0126384_1095478423300010046Tropical Forest SoilAYEAAVQGYLLSGIVDEKLQREMIAVAAQRVKPAQPVAPERVFDFSFARKASETLR*
Ga0126384_1178374723300010046Tropical Forest SoilLQYYLPSGSVDEKLQREMIAVAAQRIKTAQAPPPERVFDFSFAQKVSETLR*
Ga0134088_1060464623300010304Grasslands SoilDEKLQREMIAVAAQRVKPKELPPPERVFDFSFAQKVADTMK*
Ga0126370_1216933913300010358Tropical Forest SoilCLPSGTVDEKLQREMIVVAAQRIKPPQPVPPERVFDFSFAQKVSETLR*
Ga0126372_1060704613300010360Tropical Forest SoilQYYLPSGSVDEKLQREMIAVAAQRVKTAQPPPPERVFDFSFAQKVSETLR*
Ga0126377_1123515123300010362Tropical Forest SoilMITVAAQRIKPKELAPPERVFDFSFALKVAESFK*
Ga0126377_1145440323300010362Tropical Forest SoilLYLSSHAVDETLQREMIAIAAQRVKPAQLVPPERVFDFSFTQKVILPR*
Ga0136847_1158131913300010391Freshwater SedimentQREMIEVAAQRVKPKTPVPPERVFDFSFAQKVADSLR*
Ga0134126_1306121013300010396Terrestrial SoilREMISVAAQRVKPKGLPAPERVFDFSFAQKVSDSFK*
Ga0134124_1162325023300010397Terrestrial SoilDEKVQREMIATAAERIKPKEPVPPERVFDFSFIQKVRDSVR*
Ga0134124_1223396923300010397Terrestrial SoilPSGIVDEKLQREMIAVAAQRVKPSQPVGPERVFDFSFAQKVFESSR*
Ga0134127_1033588313300010399Terrestrial SoilIQLYLPSATVDEKLQREMIATAAQRIKAKEPVPPERVFDFTFVQKVGESLK*
Ga0134122_1094821323300010400Terrestrial SoilKVQREMIAVAAQRVKPKELPPPERVFDFSFAQKVSDSLK*
Ga0137716_1011481833300010938Hot Spring Fe-Si SedimentMVDEEVQRQMIADAAQRIKPAQPVTPERVFDFSFARQLSETLR*
Ga0137464_121025813300011434SoilAATQGYLASGAVDEKLQRGMINLAAQRLKPPPQVAPERVFDFSFARKAAEGLR*
Ga0137458_126735613300011436SoilTGTVDDKLQREMIATAAQRTKLAQPPPPERVFDFSFAQKIAETLR*
Ga0137451_123877923300011438SoilQREMIASAAQRIKPPQPVTPERVFDFSFARAASDVLR*
Ga0137433_130530323300011440SoilQRDMIAIASQCVKPAQPVPPERVFDFSFTQKVSESLR*
Ga0137463_101777543300011444SoilEKVRREMIAVAAQRVKPKELPPPERVFDFSFAQKVSDSLK*
Ga0120191_1002318023300012022TerrestrialVDEKLQREMIAVAAQRIKPKELAPPERVFDFSFAQKVADAFK*
Ga0137453_101348413300012034SoilQSGAVDEKVQREMIAAAAQRIKPKELAPPERVFDFSFARKVAETLK*
Ga0137445_107537323300012035SoilDAAVQYYLQSGAVDEKVQREMIAVAAQRIKPKELAPPERVFDFSFARKVAETLK*
Ga0137319_109377723300012167SoilVQTGAVDEKLQREMIATAAQRVKPKELAPPERVFDFSFALKVSDSLK*
Ga0137342_102983213300012171SoilEAAVSGYLASGVVEVKLQREMIAVAAQRLKPPPAVTPERVFDFSFARKAGDNLR*
Ga0137382_1109101523300012200Vadose Zone SoilAYDAAVRGYVLSGLVDEKLQREMIASAAQRVKATPPTPERVFDFSFARKVSASVQ*
Ga0137382_1111755523300012200Vadose Zone SoilRGYVLSGLVDEKLQREMIASAAQRVKATAPTLERVFDFTFARKVSASLQ*
Ga0137365_1117814623300012201Vadose Zone SoilEMIAIAAQRVKPAHPVPPEQVFDFSFTQKVSESLR*
Ga0137374_1002682373300012204Vadose Zone SoilVDEKLQREMIAIASQRIKPKEPVPPERVFDFSIVQKVGESLK*
Ga0137379_1058012523300012209Vadose Zone SoilQREMIAVAAQRVKAAQPVPPERVFDFSFAQKVSESLR*
Ga0137366_1085378813300012354Vadose Zone SoilLPSGTVDEKLQREMIAVAAQRVKAAQPVPPERVFDFSFAQKVSESLR*
Ga0137368_1001672613300012358Vadose Zone SoilQSATVDEKLQREMIAIASQRTKPKEPVRPERVFDFSIVQKIGESLK*
Ga0137360_1035824823300012361Vadose Zone SoilAAVQGYLLSGIVDEKLQREMIAVAAQRVKPTPSVTPERVFDLSFARKAGETLR*
Ga0157340_101646913300012473Arabidopsis RhizosphereRGYVLSGLVDEKLQREMITAAAQRVRAAPPTPERVFDFSFARKVSASVP*
Ga0157334_100285233300012509SoilFTERAYDAAVGGYVLSGLVDEKLQREMIASAAQRVKATPPTPERVFDFSFARKVSASVQ*
Ga0157338_102548523300012515Arabidopsis RhizosphereAVGGYVLSGLVDEKLQREMIASAAQRVKATPPTPERVFDFSFARKVSASLP*
Ga0157352_110844323300012519Unplanted SoilVDEKLQREMIASAAQRVKATPPTPERVFDFSFARKVSASVQ*
Ga0137373_1094414023300012532Vadose Zone SoilAYDASVRGYVLTGIVDEKLQREMITAAAQRVKAAPPTLERVFDFSFARKVSASLQ*
Ga0137396_1032125923300012918Vadose Zone SoilMIATAAQRIKPKEPVPTERVFDFSFVQKVAESLK*
Ga0137404_1093011913300012929Vadose Zone SoilERAYNAAVRGYVLSGLVDEKLQREMIASAAQRVKATPPTPERVFDFSFARKVSASLQ*
Ga0137407_1045012423300012930Vadose Zone SoilVQLYLSTHTVDEPLQREMIAIAAQRVKPAHPVPPERVFDFSFVQKMTQPLR*
Ga0137407_1059276913300012930Vadose Zone SoilDEKLQREMIAVAAQRVKAAQPVPPERVFDFSFTQKVSESLR*
Ga0153915_1005547513300012931Freshwater WetlandsRAYDAAVQGYLLSGSVDEKLQREMIAVAAQRIKPAQPVPPERVFNFSFAQRVSESLR*
Ga0153915_1034968613300012931Freshwater WetlandsRAYDAAVQGYLLSGSVDEKLQREMIAVAAQRIKPAQPVPPVRVFNFSFAQRVSESLR*
Ga0137410_1191949623300012944Vadose Zone SoilAYDAAVQGYLLSGVVDEKLQREMIAVAAQRVKPTQPVTPERVFDFSFARKASEAFR*
Ga0126375_1065603613300012948Tropical Forest SoilQGYLLSGIVDEKLQREMIAVAAQRVKLAQSVTPERVFDFSFARKAGETLR*
Ga0126369_1075263413300012971Tropical Forest SoilKLQREMIAVAAQRVKPAQPVAPERVFDFSFARKASETIR*
Ga0126369_1168263613300012971Tropical Forest SoilCLPSGTVDEKLQREMIAVAAQRIKPPQPVPPERVFDFSFAQKVSESLR*
Ga0126369_1183232013300012971Tropical Forest SoilYLASGVVDEKVQREMITTAAERIKPKEPVPPERVFDFSFIQKVRDSVR*
Ga0164304_1049053623300012986SoilYEAAVQYYLQRGTVDQKVQREMIAVAAQRVKPKELPPPERVFDFSFAQKVSDSFK*
Ga0157307_112022113300013096SoilALAFYLQSGVVDEKLQRDMIATAAQRVKPKDPVPPERVFDFSFAHKVADSMK*
Ga0134075_1020552313300014154Grasslands SoilTAAVQGYLLSGVVDEKVQREMITVAAQRVKPQQPVTPERVFDFSFARKISEAVR*
Ga0180061_100928413300014861SoilVDEKLQREMIATAAQRTKLAQPPPPERVFDFSFAQKVGETHT*
Ga0180065_116037613300014878SoilLQREMIAVAAQRIKPKELAAPERVFDFTFAQKVADSLK*
Ga0180104_104461213300014884SoilVVEEKLQREMIAVAAQRLKPPPAVTPERVFDFSFARKAGDTLR*
Ga0137403_1076095523300015264Vadose Zone SoilMIAVAVQRVKAAQPVPPERVFDFSFAQKVSESLR*
Ga0134072_1011919323300015357Grasslands SoilEMIAVAAQRVKPAQPVPPERVFDFSFARKAGEATR*
Ga0132256_10358170023300015372Arabidopsis RhizosphereLQTGTVDEKVQREMIAVAAQRVKPKELPPPERVFDFSFAQKVAESMK*
Ga0132255_10037360543300015374Arabidopsis RhizosphereYLISGMVDEKVQREMIATAAERIKPKEPVPPERVFDFSFIQKVRGSVR*
Ga0184634_1035846323300018031Groundwater SedimentMVDEKLQREMIASAAQRIKPTQPVTPERVFDFSFARKAGDALR
Ga0184626_1008659513300018053Groundwater SedimentLQSGAVDEKLQREMIAVAAQRIKPKELAPPDRVFDFSFAQKVADMPR
Ga0184626_1013110433300018053Groundwater SedimentREMIASAAQRVKAAPPAPERVFDFSFARKASATLQ
Ga0184621_1022576233300018054Groundwater SedimentVLSGLVDEKLQREMITAAAQRVKSASPTPERVFDFSFARKVSASVQ
Ga0184615_1012619223300018059Groundwater SedimentMVDKKLQREMIASAAQRIKPPQPLTPERVFDFTFARAASEALR
Ga0187773_1073627413300018064Tropical PeatlandAVDEKLQREMIAVAAQRIKPARPVPPERVFDFSFAQKVSATLK
Ga0184632_1007753433300018075Groundwater SedimentERVYDATMELYLSSHTVDETLQREMIAIAAQRVKPAHPVPPERVFDFSFTQKVSESLR
Ga0184632_1013955723300018075Groundwater SedimentGAVDEKLQREMISVAAQRIKPKELAPPERVFDFSFALRVADSFR
Ga0184632_1042773623300018075Groundwater SedimentDETLQREMIAIAAQRVKPAHPVPPERVFDFSFTQKLSESLR
Ga0184609_1002725113300018076Groundwater SedimentAVDEKLQREMISVAAQRIKPKDLAPPERVFDFSFALRVADSFK
Ga0184609_1049242013300018076Groundwater SedimentYYVQTGTVDEKLQREMIAVAAQRIKPKELAPPERVFDFSFAQKVADTLK
Ga0184612_1020991713300018078Groundwater SedimentREMIAIAAQRVKPAHPVPPERVFDFSFTQKLSGSLR
Ga0184612_1037553233300018078Groundwater SedimentTERSYDAAVQGYVLSGLVDEKLQREMIASAAQRVKAAPPAPERVFDFSFARKASATLQ
Ga0184629_1049552013300018084Groundwater SedimentERAYEVATQGYSLTGVVDEKLQREMIAVAAQRVKSQPQLAPERIFDFSFARRASEGLR
Ga0187774_1001332333300018089Tropical PeatlandGVVEDKLQRDMITLAAQRVKTSPPVPPERVFDFSFARKVGEALR
Ga0190265_1233431123300018422SoilYDAAVRGYVLSGLVDEKLQREMIASAAQRVKAAAPAPERVFDFSFARKVSASSQ
Ga0190265_1346096523300018422SoilREMIATAAQRVKPKDPVPPERVFDFTFAQKVADSIK
Ga0066655_1092837523300018431Grasslands SoilDEKLQKEMIAVAAQRVKPAQPVPPERVFDFSFARKAGEATR
Ga0190270_1033884023300018469SoilRFAERAYEAATHGYLANGMVDERLQREMIGLAAQRLKPPPQVAPERVFDFSSARKAAEEL
Ga0066669_1151522323300018482Grasslands SoilIYDAAVQLYLPSATVGEKLQREMIAIAAQRIKPKDPVSPERVFDFSFVQKVGESMK
Ga0193723_113306423300019879SoilAVRGYVLSGLVDEKLQREMIASAAQRVKAAPPAPERVFDFSFARKVSASVQ
Ga0193713_114788613300019882SoilREMIAVAAQRVKPKELPPHERVFDFSFASRVADSFK
Ga0193713_117537713300019882SoilYVLTGLVDEKLQREMIASAAQRVKAAPPAPERVFDFSFARKVSASVQ
Ga0193747_112747323300019885SoilVQREMIAVAAQRVKPKELPPHERVFDFTFASRVADSFK
Ga0193733_103730123300020022SoilQRELIATAAQRIKPKEPVPTERVFDFSFVQKVAESLK
Ga0193716_108060623300020061SoilREMIAIAAQRIKPKDPVPPERVFDFSFAQKVAESFK
Ga0163153_1001728853300020186Freshwater Microbial MatGYLASAAVDEKLQREMIGLAAQRLKPPPQVAPERVFDFSFARKAAEGIR
Ga0210378_1014928623300021073Groundwater SedimentEMIATASQRIKPKEPVPVERVFDFSFVQRVGESLK
Ga0210378_1018996113300021073Groundwater SedimentQYYLQSGAVDEKLQREMIAVAAQRVKPKELAPPERVFDFNFAQKVADTLK
Ga0210379_1036144223300021081Groundwater SedimentLQREMIAIAAQRVKPAHPVSPERVFDFSFTQKVSESLR
Ga0210379_1042955523300021081Groundwater SedimentREMIAVAAQRIKPKELAPPERVFDFSFAQKITDSLR
Ga0193719_1011315023300021344SoilEKVQREMIAVAAQRVKPKELPPHERVFDFSFASRVADSFK
Ga0126371_1095079723300021560Tropical Forest SoilEMIAVAAQRVKLPQPVAAERVFDFSFARKASETLR
Ga0224495_1020181713300022208SedimentVQYYLTTGTVDDRLQREMIATAAQRTKLAQPPPPERVFDFSFAQKVGETLK
Ga0224452_120044113300022534Groundwater SedimentSSHTVDETLQREMIAIAAQRVKPAHTVPPERVFEFSFAQKVSESLR
Ga0224452_128702023300022534Groundwater SedimentIYDAALQYYLPSGAVDEKLQREMIAVAAQRVKAAQPVTPERVFDFSFAQKVSESLR
Ga0222622_1083730113300022756Groundwater SedimentEKLQREMIAVAAQRIKGAQPVPPERVFDFSFAQKVSESLR
(restricted) Ga0233424_1024294023300023208FreshwaterQGYLLSGVVEEKLQREMIAVAAQRVKPAPPQIAPERVFEFTLARKAGESLR
Ga0209619_1013614413300025159SoilEQLQREMIADASQRIKPLQPVPPERVFDFSFAHKGSQFPR
Ga0209108_1013483023300025165SoilEMIATAAQRVKITNLPPLERVFDFNFAQKVADTLR
Ga0209642_1027883723300025167SoilEMIADASQRIKPLQPVPPERVFDFSFAHKGSQFPR
Ga0209324_1002829543300025174SoilREMITTAAQRVKITNLPPPERVFDFSFAQKVADTFK
Ga0209641_1029762923300025322SoilTGIVDEQLQREMIADASQRIKPLQPVPPERVFDFSFAQKGSRFPR
Ga0209342_1021367023300025326SoilRVYDAAVHYYLASGAVDEKLQREMIATAAQRVKITNLPPPERVFDFSFAQRVADSLR
Ga0207699_1087164623300025906Corn, Switchgrass And Miscanthus RhizosphereYLASGVVDEKVQREMIATAAERIKPKEPVPPERVFDFSFIQKVRDSVR
Ga0207707_1001684013300025912Corn RhizosphereEKVQREMIATAAERIKPKEPVPPERVFDFSFIQKVRGSVR
Ga0207681_1005339613300025923Switchgrass RhizosphereQREMIATAAERIKPKESVPPERVFDFSFIQKVRGSVR
Ga0207701_1104356423300025930Corn, Switchgrass And Miscanthus RhizosphereLQYYLQSGAVDEKLQREMIAVAAQRIKPKEIAPPERVFDFSFALKVAETLR
Ga0207644_1099066313300025931Switchgrass RhizosphereGKERDHFVERAYAATVQSYLVTGTLDEKLQRDMIAMAAERIKPKAPVAPDRVFDFSFARKAAEALR
Ga0207706_1045890323300025933Corn RhizosphereQTGTVDEKVQREMIAVVAQRVKPKELPPPERVFDFSFAQKVSDSFK
Ga0207691_1031448333300025940Miscanthus RhizosphereVQAYLSSGIVDEKLQREMIAAASQRLKPAVSIAPERVFDFSSARMAGVGGK
Ga0210116_100431813300025959Natural And Restored WetlandsEKLQREMIATAAQRTKLAQPPAPERVFDFSFAQKVAESLK
Ga0207676_1075207923300026095Switchgrass RhizosphereYLTSGMVDEKVQREMIATAAERIKPKESVPPERVFDFSFIQKVRGSVR
Ga0207675_10058972933300026118Switchgrass RhizosphereGYLSVSGTVDEKLQREMIATAAQRTKLAQPPAPERVFDFSFAQRAGENLK
Ga0209235_110460313300026296Grasslands SoilAVQGYLLSGVVDEKLQREMIAEAAQRIKPAQPVTPERVFDFSFARKAGEALR
Ga0209761_120256523300026313Grasslands SoilQKEMIAVAAQRVKPAQPVPPERVFDFSFARKAGEATR
Ga0209131_110896613300026320Grasslands SoilYDAAAEGYLPSGLVDEKLQREMIAAAVRRVKTAQVFAPDRVFDFGLARRAGEGLR
Ga0209473_122865613300026330SoilLQKEMIAVAAQRVKPAQPVPPERVFDFSFARKAGEATR
Ga0209806_103256843300026529SoilSGVVDEKLQKEMIAVAAQRVKPAQPVPPERVFDFSFARKAGEATR
Ga0256867_1003411833300026535SoilAVGYFLDSGTVDERLQREMIATAAQRLKIAQPAAPERVFDFSFAQKVADSFK
Ga0209156_1003157813300026547SoilRIYDAAIQYYLMSGSVDDKLQREMIAVAAQRVKPKELAPPERVFDFSFAQKVSEPLR
Ga0209577_1026603113300026552SoilTERAYDAATQGYLLSGVVDEKLQREMIAVAAQRVKPAQPVPPERVFDFSFARKAGEATR
Ga0207567_10125033300026714SoilVQREMIATAAERIKPKEPVPPERVFDFSFIQKVRGSVR
Ga0209819_1032314023300027722Freshwater SedimentEKLQREMIAVAAQRVKLAQPVTPERVFDFSFARKAGESLR
Ga0209726_1043440523300027815GroundwaterREMIAVAAQRIKPKELAPPERVFDFSFAQKVAESLR
Ga0209814_1053172913300027873Populus RhizosphereYVLSGLVDEKLQREMIASAAQRVKAASPAPERVFDFSFARKVSASLQ
Ga0207428_1046243823300027907Populus RhizosphereQYYLPSGTVDEKLQREMIAVAAQRVKAPQPVPPERVFDFSFAQKVSESLR
Ga0207428_1080599313300027907Populus RhizosphereAPAVYDAAVQGYLLTGSVDEKLQREMIADAARRIKPTQPVTPDRVFDFSFVQKVVETLR
Ga0207428_1086748213300027907Populus RhizosphereAYDAAVQGYLLSGVVDEKLQREMIAVAAQRVKLAQPVTPERVFDFSFARKAGEALR
Ga0207428_1099948013300027907Populus RhizosphereSAAVQLYLASGVVDEKVQREMIATAAERIKPKEPVPPERVFDFSFIQKVRDAAR
Ga0209382_1013527313300027909Populus RhizosphereYDAALQYYVQTGAVDEKLQREMIATAAQRVKPKELAPPERVFDFSFALKVSDSLK
Ga0209857_104831523300027957Groundwater SandVYDAALQYYLQSGTVDEKLQREMIAVAAQRIKPAQPVPPERVFDFSFAQKATESLR
Ga0307503_1029258113300028802SoilALGYYLQSGTVDEKLQREMIAVAAQRIKPKEMAPPERVFDFSFAQKVAETFK
Ga0170824_10793155413300031231Forest SoilRIYEAAVQYYLQTGTVDEKVQREMIAVAAQRVKPKELPPPERVFDFSFAQKVSDSLK
Ga0307408_10144125713300031548RhizosphereLSTSGTVDEKLQREMITTAAQRTKLAQPPPPERVFDFSFAQRAGENLK
Ga0307469_1008034013300031720Hardwood Forest SoilQREMIAVAAQRIKLVQPVTPERVFDFSFARKAGEALR
Ga0307469_1044075313300031720Hardwood Forest SoilYEAAVKGYVLTGLVDEKLQREMITSAAQRVKAAAPAPERVFDFSFARKVSASLQ
Ga0307468_10026297313300031740Hardwood Forest SoilPLQREMIAIAAQRVKPAHPVPPERVFDFSFVQKVTQPLR
Ga0307468_10090604033300031740Hardwood Forest SoilAYDAAVRGYVLSGLVDEKLQREMIASAAQRVKATPPTPERVFDFSFARKVSASVP
Ga0307468_10203849513300031740Hardwood Forest SoilAVQSYLLTGIVDEKLQREMIALSAQRLKPSQPITPERVFDFSAARKAGEGLR
Ga0307475_1016302833300031754Hardwood Forest SoilSGSVDETLQREMIAVAVERTKPPHPVPPERVFDFSLAQKVSETLR
Ga0307413_1056221723300031824RhizosphereKLQRDMIATAAQRVKPKDPVAPERVFDFSFAQKVADSMK
Ga0310904_1108334323300031854SoilGTVDQKVQREMIAVAAQRVKPKELPPPERVFDFSFAQKVSDSLK
Ga0310885_1051368823300031943SoilSGVVDEKLQRDMIATAAQRVKPKDPVPPERVFDFSFAHKVADSMK
Ga0307479_1057578323300031962Hardwood Forest SoilVDDRLQREMIAVAVQRIQPVPPVVPPERVFDFSFARRAGETLR
Ga0307411_1150563413300032005RhizosphereQREMITTAAQRTKLAQPPPPERVFDFSFAQRAGENLK
Ga0310902_1122240023300032012SoilEMIAVAAQRIKPKELPPPERVFDFSFAQKVPESMK
Ga0307471_10123256413300032180Hardwood Forest SoilVDEKVQREMIAVAAQRVKPKELPPHERVFDFTFASRVADSFK
Ga0307472_10005783243300032205Hardwood Forest SoilERTYDATAQAYLTSGVVDERLQREMIAVAAQRLKPQQPVAPERVFDFSFARKASEALL
Ga0307472_10275725423300032205Hardwood Forest SoilYNAALQLFLLSGSVDETLQREMIAVAVERTKPPHPVPPERVFDFSLAQKVSETLR
Ga0310812_1044481413300032421SoilKVQREMIATAAERIKPKEPVPPERVFDFSFIQKVRDSVR
Ga0214471_1043526413300033417SoilVEEKLQREMIAVAAQRLKPPPAVTPERVFDFSFARKAGDTLR
Ga0326726_1170867523300033433Peat SoilPSGVVDGKIQREMIATAAQRVKPKEPVPPERVFDFTFAQKVADSLR
Ga0364935_0176170_564_6833300034151SedimentTLQREMIAIASQRVKPAHPVPPERVFDFSFTQKVSESLR
Ga0364931_0297585_362_5353300034176SedimentRIYDAALQYYVQTGAVDEKLQREMIATAAQRVKPKEVAPPERVFDFSFALKVSDSLK


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.