Basic Information | |
---|---|
Family ID | F019531 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 229 |
Average Sequence Length | 49 residues |
Representative Sequence | MPLEITPEPDEAEREAILAALAAEQAEQPAASEWAAALLPARNDEEPEP |
Number of Associated Samples | 168 |
Number of Associated Scaffolds | 229 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 17.03 % |
% of genes near scaffold ends (potentially truncated) | 24.89 % |
% of genes from short scaffolds (< 2000 bps) | 80.35 % |
Associated GOLD sequencing projects | 155 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.44 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (88.646 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere (9.170 % of family members) |
Environment Ontology (ENVO) | Unclassified (25.328 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (53.275 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 20.78% β-sheet: 0.00% Coil/Unstructured: 79.22% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 229 Family Scaffolds |
---|---|---|
PF01066 | CDP-OH_P_transf | 14.85 |
PF00877 | NLPC_P60 | 10.92 |
PF00395 | SLH | 6.99 |
PF00289 | Biotin_carb_N | 4.80 |
PF02786 | CPSase_L_D2 | 4.80 |
PF01966 | HD | 1.31 |
PF00990 | GGDEF | 1.31 |
PF01039 | Carboxyl_trans | 0.87 |
PF00550 | PP-binding | 0.44 |
PF00106 | adh_short | 0.44 |
PF13531 | SBP_bac_11 | 0.44 |
PF04203 | Sortase | 0.44 |
PF00392 | GntR | 0.44 |
PF08442 | ATP-grasp_2 | 0.44 |
PF02899 | Phage_int_SAM_1 | 0.44 |
PF03640 | Lipoprotein_15 | 0.44 |
PF00903 | Glyoxalase | 0.44 |
PF04211 | MtrC | 0.44 |
COG ID | Name | Functional Category | % Frequency in 229 Family Scaffolds |
---|---|---|---|
COG0558 | Phosphatidylglycerophosphate synthase | Lipid transport and metabolism [I] | 14.85 |
COG1183 | Phosphatidylserine synthase | Lipid transport and metabolism [I] | 14.85 |
COG5050 | sn-1,2-diacylglycerol ethanolamine- and cholinephosphotranferases | Lipid transport and metabolism [I] | 14.85 |
COG0791 | Cell wall-associated hydrolase, NlpC_P60 family | Cell wall/membrane/envelope biogenesis [M] | 10.92 |
COG0458 | Carbamoylphosphate synthase large subunit | Amino acid transport and metabolism [E] | 0.87 |
COG0777 | Acetyl-CoA carboxylase beta subunit | Lipid transport and metabolism [I] | 0.87 |
COG0825 | Acetyl-CoA carboxylase alpha subunit | Lipid transport and metabolism [I] | 0.87 |
COG4799 | Acetyl-CoA carboxylase, carboxyltransferase component | Lipid transport and metabolism [I] | 0.87 |
COG0026 | Phosphoribosylaminoimidazole carboxylase (NCAIR synthetase) | Nucleotide transport and metabolism [F] | 0.44 |
COG0045 | Succinyl-CoA synthetase, beta subunit | Energy production and conversion [C] | 0.44 |
COG0151 | Phosphoribosylamine-glycine ligase | Nucleotide transport and metabolism [F] | 0.44 |
COG1042 | Acyl-CoA synthetase (NDP forming) | Energy production and conversion [C] | 0.44 |
COG3764 | Sortase (surface protein transpeptidase) | Cell wall/membrane/envelope biogenesis [M] | 0.44 |
COG4061 | Tetrahydromethanopterin S-methyltransferase, subunit C | Coenzyme transport and metabolism [H] | 0.44 |
COG4315 | Predicted lipoprotein with conserved Yx(FWY)xxD motif (function unknown) | Function unknown [S] | 0.44 |
COG4973 | Site-specific recombinase XerC | Replication, recombination and repair [L] | 0.44 |
COG4974 | Site-specific recombinase XerD | Replication, recombination and repair [L] | 0.44 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 88.65 % |
Unclassified | root | N/A | 11.35 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2166559006|FI_contig10179 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1012 | Open in IMG/M |
2170459013|GO6OHWN02JB3W1 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 522 | Open in IMG/M |
2170459019|G14TP7Y01DLK02 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 710 | Open in IMG/M |
2170459019|G14TP7Y02H2JIO | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 517 | Open in IMG/M |
3300000956|JGI10216J12902_104300498 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 708 | Open in IMG/M |
3300001535|A3PFW1_10038381 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2830 | Open in IMG/M |
3300001536|A1565W1_10051731 | All Organisms → cellular organisms → Bacteria | 5305 | Open in IMG/M |
3300001686|C688J18823_10018740 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4638 | Open in IMG/M |
3300001686|C688J18823_10025540 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4010 | Open in IMG/M |
3300002568|C688J35102_120966963 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3507 | Open in IMG/M |
3300003324|soilH2_10042566 | All Organisms → cellular organisms → Bacteria | 2578 | Open in IMG/M |
3300003324|soilH2_10073839 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1172 | Open in IMG/M |
3300004114|Ga0062593_102539904 | Not Available | 581 | Open in IMG/M |
3300004153|Ga0063455_100086456 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1237 | Open in IMG/M |
3300004156|Ga0062589_102580701 | Not Available | 527 | Open in IMG/M |
3300004157|Ga0062590_101984695 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 603 | Open in IMG/M |
3300004479|Ga0062595_100044855 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1968 | Open in IMG/M |
3300004479|Ga0062595_100111916 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1485 | Open in IMG/M |
3300005093|Ga0062594_101711030 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 658 | Open in IMG/M |
3300005178|Ga0066688_10280291 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1072 | Open in IMG/M |
3300005179|Ga0066684_10050437 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2382 | Open in IMG/M |
3300005179|Ga0066684_10199028 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1295 | Open in IMG/M |
3300005181|Ga0066678_10190990 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1304 | Open in IMG/M |
3300005186|Ga0066676_10016600 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3759 | Open in IMG/M |
3300005187|Ga0066675_10127154 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1722 | Open in IMG/M |
3300005329|Ga0070683_100470884 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1199 | Open in IMG/M |
3300005332|Ga0066388_100228513 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2492 | Open in IMG/M |
3300005336|Ga0070680_100013841 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 6293 | Open in IMG/M |
3300005336|Ga0070680_100697045 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 874 | Open in IMG/M |
3300005337|Ga0070682_100427017 | All Organisms → cellular organisms → Bacteria | 1009 | Open in IMG/M |
3300005344|Ga0070661_101169557 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 642 | Open in IMG/M |
3300005435|Ga0070714_100010942 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 7186 | Open in IMG/M |
3300005435|Ga0070714_100027979 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4672 | Open in IMG/M |
3300005435|Ga0070714_100111054 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2427 | Open in IMG/M |
3300005436|Ga0070713_100225515 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1701 | Open in IMG/M |
3300005437|Ga0070710_11486369 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 509 | Open in IMG/M |
3300005439|Ga0070711_100012826 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5248 | Open in IMG/M |
3300005445|Ga0070708_101003065 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 783 | Open in IMG/M |
3300005454|Ga0066687_10212465 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1062 | Open in IMG/M |
3300005456|Ga0070678_101551403 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
3300005518|Ga0070699_101002523 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 766 | Open in IMG/M |
3300005524|Ga0070737_10010883 | All Organisms → cellular organisms → Bacteria | 7343 | Open in IMG/M |
3300005530|Ga0070679_100150924 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2300 | Open in IMG/M |
3300005532|Ga0070739_10000589 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 67067 | Open in IMG/M |
3300005532|Ga0070739_10006515 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 12839 | Open in IMG/M |
3300005533|Ga0070734_10047811 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2612 | Open in IMG/M |
3300005535|Ga0070684_100181599 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1913 | Open in IMG/M |
3300005535|Ga0070684_100741555 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 917 | Open in IMG/M |
3300005542|Ga0070732_10354661 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 883 | Open in IMG/M |
3300005544|Ga0070686_101524764 | Not Available | 564 | Open in IMG/M |
3300005546|Ga0070696_100393313 | All Organisms → cellular organisms → Bacteria | 1083 | Open in IMG/M |
3300005547|Ga0070693_100661669 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 761 | Open in IMG/M |
3300005553|Ga0066695_10602007 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 659 | Open in IMG/M |
3300005559|Ga0066700_10113244 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1795 | Open in IMG/M |
3300005560|Ga0066670_10063171 | All Organisms → cellular organisms → Bacteria | 1965 | Open in IMG/M |
3300005561|Ga0066699_10217911 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1336 | Open in IMG/M |
3300005614|Ga0068856_100071330 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3439 | Open in IMG/M |
3300005614|Ga0068856_100587032 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1135 | Open in IMG/M |
3300005615|Ga0070702_100465192 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 920 | Open in IMG/M |
3300005764|Ga0066903_100024721 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 6568 | Open in IMG/M |
3300005764|Ga0066903_100823696 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1665 | Open in IMG/M |
3300005764|Ga0066903_101524054 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1263 | Open in IMG/M |
3300005764|Ga0066903_104233999 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 767 | Open in IMG/M |
3300005764|Ga0066903_105229334 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 686 | Open in IMG/M |
3300005764|Ga0066903_107117308 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 579 | Open in IMG/M |
3300006028|Ga0070717_10519847 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1077 | Open in IMG/M |
3300006028|Ga0070717_11190562 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 693 | Open in IMG/M |
3300006028|Ga0070717_11541518 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 603 | Open in IMG/M |
3300006028|Ga0070717_11971036 | Not Available | 526 | Open in IMG/M |
3300006046|Ga0066652_100367390 | All Organisms → cellular organisms → Bacteria | 1300 | Open in IMG/M |
3300006173|Ga0070716_100880303 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 700 | Open in IMG/M |
3300006175|Ga0070712_100020730 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4304 | Open in IMG/M |
3300006175|Ga0070712_101030619 | Not Available | 713 | Open in IMG/M |
3300006237|Ga0097621_101019815 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 775 | Open in IMG/M |
3300006577|Ga0074050_11098793 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 813 | Open in IMG/M |
3300006604|Ga0074060_12043720 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1834 | Open in IMG/M |
3300006755|Ga0079222_11105961 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 697 | Open in IMG/M |
3300006755|Ga0079222_12377741 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 530 | Open in IMG/M |
3300006806|Ga0079220_10352943 | All Organisms → cellular organisms → Bacteria | 936 | Open in IMG/M |
3300006806|Ga0079220_10840660 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 702 | Open in IMG/M |
3300006854|Ga0075425_100392104 | All Organisms → cellular organisms → Bacteria | 1600 | Open in IMG/M |
3300006871|Ga0075434_100001162 | All Organisms → cellular organisms → Bacteria | 21783 | Open in IMG/M |
3300009012|Ga0066710_100725745 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1517 | Open in IMG/M |
3300009094|Ga0111539_11001702 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 971 | Open in IMG/M |
3300009137|Ga0066709_100143621 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3035 | Open in IMG/M |
3300009143|Ga0099792_10226375 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1077 | Open in IMG/M |
3300009174|Ga0105241_11498073 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 649 | Open in IMG/M |
3300009174|Ga0105241_11964240 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 575 | Open in IMG/M |
3300009551|Ga0105238_10042991 | All Organisms → cellular organisms → Bacteria | 4573 | Open in IMG/M |
3300009792|Ga0126374_10069134 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1881 | Open in IMG/M |
3300010043|Ga0126380_10599145 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 867 | Open in IMG/M |
3300010043|Ga0126380_11372306 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 619 | Open in IMG/M |
3300010047|Ga0126382_11306755 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 656 | Open in IMG/M |
3300010048|Ga0126373_11303829 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 792 | Open in IMG/M |
3300010152|Ga0126318_10390710 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 947 | Open in IMG/M |
3300010301|Ga0134070_10200478 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 732 | Open in IMG/M |
3300010303|Ga0134082_10311810 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 661 | Open in IMG/M |
3300010321|Ga0134067_10219593 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 705 | Open in IMG/M |
3300010323|Ga0134086_10443822 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 528 | Open in IMG/M |
3300010335|Ga0134063_10321436 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 748 | Open in IMG/M |
3300010337|Ga0134062_10436567 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 647 | Open in IMG/M |
3300010358|Ga0126370_10672283 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 905 | Open in IMG/M |
3300010359|Ga0126376_10739957 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 952 | Open in IMG/M |
3300010359|Ga0126376_12526410 | Not Available | 562 | Open in IMG/M |
3300010361|Ga0126378_10809751 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1046 | Open in IMG/M |
3300010361|Ga0126378_11915238 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 675 | Open in IMG/M |
3300010364|Ga0134066_10339311 | Not Available | 553 | Open in IMG/M |
3300010366|Ga0126379_11367303 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 814 | Open in IMG/M |
3300010366|Ga0126379_13264307 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 543 | Open in IMG/M |
3300010371|Ga0134125_10226948 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2077 | Open in IMG/M |
3300010373|Ga0134128_10044099 | All Organisms → cellular organisms → Bacteria | 5189 | Open in IMG/M |
3300010373|Ga0134128_10818269 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1032 | Open in IMG/M |
3300010373|Ga0134128_12327041 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 590 | Open in IMG/M |
3300010375|Ga0105239_10210367 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2180 | Open in IMG/M |
3300010375|Ga0105239_10538679 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1329 | Open in IMG/M |
3300010376|Ga0126381_102255469 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 782 | Open in IMG/M |
3300010376|Ga0126381_104922577 | Not Available | 513 | Open in IMG/M |
3300010396|Ga0134126_10057110 | All Organisms → cellular organisms → Bacteria | 4872 | Open in IMG/M |
3300010396|Ga0134126_12972083 | Not Available | 512 | Open in IMG/M |
3300010399|Ga0134127_10267283 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1630 | Open in IMG/M |
3300011106|Ga0151489_1009395 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 669 | Open in IMG/M |
3300011106|Ga0151489_1361769 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1074 | Open in IMG/M |
3300012198|Ga0137364_10009323 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5516 | Open in IMG/M |
3300012198|Ga0137364_10013746 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4743 | Open in IMG/M |
3300012200|Ga0137382_10045503 | All Organisms → cellular organisms → Bacteria | 2716 | Open in IMG/M |
3300012208|Ga0137376_11560707 | Not Available | 551 | Open in IMG/M |
3300012211|Ga0137377_10500675 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1153 | Open in IMG/M |
3300012211|Ga0137377_11184823 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 694 | Open in IMG/M |
3300012212|Ga0150985_116859382 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1455 | Open in IMG/M |
3300012349|Ga0137387_10845098 | Not Available | 662 | Open in IMG/M |
3300012355|Ga0137369_10640704 | Not Available | 735 | Open in IMG/M |
3300012896|Ga0157303_10133022 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 646 | Open in IMG/M |
3300012915|Ga0157302_10158525 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 777 | Open in IMG/M |
3300012923|Ga0137359_10604962 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 961 | Open in IMG/M |
3300012924|Ga0137413_10145596 | All Organisms → cellular organisms → Bacteria | 1541 | Open in IMG/M |
3300012951|Ga0164300_10019926 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2305 | Open in IMG/M |
3300012951|Ga0164300_10700172 | Not Available | 613 | Open in IMG/M |
3300012958|Ga0164299_10242569 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1071 | Open in IMG/M |
3300012960|Ga0164301_10118611 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1558 | Open in IMG/M |
3300012960|Ga0164301_10288327 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1098 | Open in IMG/M |
3300012971|Ga0126369_11757722 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 709 | Open in IMG/M |
3300012975|Ga0134110_10542237 | Not Available | 534 | Open in IMG/M |
3300012977|Ga0134087_10097470 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1227 | Open in IMG/M |
3300012984|Ga0164309_11029186 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 680 | Open in IMG/M |
3300012984|Ga0164309_11029193 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 680 | Open in IMG/M |
3300012985|Ga0164308_10229919 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1433 | Open in IMG/M |
3300012985|Ga0164308_11439853 | Not Available | 630 | Open in IMG/M |
3300012986|Ga0164304_10806884 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 725 | Open in IMG/M |
3300012987|Ga0164307_10527057 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 898 | Open in IMG/M |
3300013100|Ga0157373_11191706 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 574 | Open in IMG/M |
3300013296|Ga0157374_12111731 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 590 | Open in IMG/M |
3300013306|Ga0163162_10345587 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1620 | Open in IMG/M |
3300013307|Ga0157372_10675008 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1203 | Open in IMG/M |
3300013307|Ga0157372_12748451 | Not Available | 565 | Open in IMG/M |
3300014157|Ga0134078_10071988 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1242 | Open in IMG/M |
3300014157|Ga0134078_10242983 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 752 | Open in IMG/M |
3300014497|Ga0182008_10810574 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 544 | Open in IMG/M |
3300015077|Ga0173483_10050912 | All Organisms → cellular organisms → Bacteria | 1583 | Open in IMG/M |
3300015371|Ga0132258_10955395 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2165 | Open in IMG/M |
3300015373|Ga0132257_100284271 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1984 | Open in IMG/M |
3300016445|Ga0182038_10942165 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 762 | Open in IMG/M |
3300017959|Ga0187779_10153456 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1421 | Open in IMG/M |
3300017974|Ga0187777_10902315 | Not Available | 635 | Open in IMG/M |
3300017974|Ga0187777_11112345 | Not Available | 575 | Open in IMG/M |
3300018482|Ga0066669_10180916 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1590 | Open in IMG/M |
3300018482|Ga0066669_12270479 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 517 | Open in IMG/M |
3300020070|Ga0206356_10455969 | Not Available | 617 | Open in IMG/M |
3300020070|Ga0206356_11743735 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 679 | Open in IMG/M |
3300020081|Ga0206354_11094613 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1828 | Open in IMG/M |
3300021560|Ga0126371_10482487 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1387 | Open in IMG/M |
3300021560|Ga0126371_10751234 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1122 | Open in IMG/M |
3300021560|Ga0126371_11846912 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 725 | Open in IMG/M |
3300024182|Ga0247669_1029883 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 921 | Open in IMG/M |
3300024182|Ga0247669_1060034 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 633 | Open in IMG/M |
3300024232|Ga0247664_1045794 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1014 | Open in IMG/M |
3300024246|Ga0247680_1017048 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1055 | Open in IMG/M |
3300025913|Ga0207695_11075775 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 684 | Open in IMG/M |
3300025915|Ga0207693_10064499 | All Organisms → cellular organisms → Bacteria | 2869 | Open in IMG/M |
3300025916|Ga0207663_10024202 | All Organisms → cellular organisms → Bacteria | 3495 | Open in IMG/M |
3300025917|Ga0207660_10205383 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1540 | Open in IMG/M |
3300025917|Ga0207660_11484316 | Not Available | 548 | Open in IMG/M |
3300025918|Ga0207662_11229163 | Not Available | 532 | Open in IMG/M |
3300025919|Ga0207657_10009590 | All Organisms → cellular organisms → Bacteria | 9717 | Open in IMG/M |
3300025924|Ga0207694_10736617 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 832 | Open in IMG/M |
3300025927|Ga0207687_10209959 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1527 | Open in IMG/M |
3300025927|Ga0207687_10273195 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1352 | Open in IMG/M |
3300025928|Ga0207700_10010748 | All Organisms → cellular organisms → Bacteria | 5798 | Open in IMG/M |
3300025928|Ga0207700_11717917 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 553 | Open in IMG/M |
3300025929|Ga0207664_10229733 | All Organisms → cellular organisms → Bacteria | 1612 | Open in IMG/M |
3300025929|Ga0207664_10466295 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1128 | Open in IMG/M |
3300025929|Ga0207664_10539275 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1046 | Open in IMG/M |
3300025929|Ga0207664_11879330 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 521 | Open in IMG/M |
3300025933|Ga0207706_11047002 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
3300025933|Ga0207706_11092831 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 667 | Open in IMG/M |
3300025939|Ga0207665_10605367 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 856 | Open in IMG/M |
3300025939|Ga0207665_10793095 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 748 | Open in IMG/M |
3300025949|Ga0207667_10644477 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1065 | Open in IMG/M |
3300025949|Ga0207667_11381508 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 678 | Open in IMG/M |
3300026067|Ga0207678_11114100 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 699 | Open in IMG/M |
3300026523|Ga0209808_1094905 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1267 | Open in IMG/M |
3300026542|Ga0209805_1108006 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1323 | Open in IMG/M |
3300026550|Ga0209474_10000658 | All Organisms → cellular organisms → Bacteria | 36833 | Open in IMG/M |
3300026550|Ga0209474_10398343 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 721 | Open in IMG/M |
3300027773|Ga0209810_1000562 | All Organisms → cellular organisms → Bacteria | 78150 | Open in IMG/M |
3300027842|Ga0209580_10334362 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 754 | Open in IMG/M |
3300027903|Ga0209488_10259616 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1302 | Open in IMG/M |
3300027968|Ga0209061_1005298 | All Organisms → cellular organisms → Bacteria | 11419 | Open in IMG/M |
3300028802|Ga0307503_10075706 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1368 | Open in IMG/M |
3300031170|Ga0307498_10007451 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2049 | Open in IMG/M |
3300031199|Ga0307495_10156146 | Not Available | 594 | Open in IMG/M |
3300031200|Ga0307496_10088309 | Not Available | 586 | Open in IMG/M |
3300031226|Ga0307497_10038512 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1609 | Open in IMG/M |
3300031226|Ga0307497_10061612 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1353 | Open in IMG/M |
3300031720|Ga0307469_11118201 | Not Available | 741 | Open in IMG/M |
3300031938|Ga0308175_100038861 | All Organisms → cellular organisms → Bacteria | 4015 | Open in IMG/M |
3300031938|Ga0308175_100101449 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2652 | Open in IMG/M |
3300031938|Ga0308175_100396716 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1440 | Open in IMG/M |
3300031938|Ga0308175_102173051 | Not Available | 622 | Open in IMG/M |
3300031939|Ga0308174_11630761 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 554 | Open in IMG/M |
3300031996|Ga0308176_12101866 | Not Available | 603 | Open in IMG/M |
3300032074|Ga0308173_10090158 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2358 | Open in IMG/M |
3300032180|Ga0307471_101335549 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 879 | Open in IMG/M |
3300032770|Ga0335085_11182264 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 814 | Open in IMG/M |
3300032782|Ga0335082_10780210 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 817 | Open in IMG/M |
3300032783|Ga0335079_10577047 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1189 | Open in IMG/M |
3300032828|Ga0335080_10915421 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 898 | Open in IMG/M |
3300032829|Ga0335070_10344086 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1436 | Open in IMG/M |
3300032892|Ga0335081_11194209 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 868 | Open in IMG/M |
3300032893|Ga0335069_12567306 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 526 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 9.17% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.73% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.86% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.42% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.24% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 4.80% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 3.93% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.49% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.06% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.06% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.06% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.06% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 3.06% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 3.06% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.62% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.18% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.75% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.75% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.75% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.75% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.75% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.75% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.31% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.31% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.31% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.31% |
Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.87% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.87% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.87% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.87% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.87% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.87% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.87% |
Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.87% |
Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.44% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.44% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.44% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.44% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.44% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.44% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.44% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.44% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2166559006 | Grass soil microbial communities from Rothamsted Park, UK - FI (heavy metals 2g/kg) assembled | Environmental | Open in IMG/M |
2170459013 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis soil at the rocks surface 0-21cm | Environmental | Open in IMG/M |
2170459019 | Litter degradation MG4 | Engineered | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300001535 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A3-PF-15A)- 1 week illumina | Environmental | Open in IMG/M |
3300001536 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A15-65cm-8A)- 1 week illumina | Environmental | Open in IMG/M |
3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005524 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen10_05102014_R1 | Environmental | Open in IMG/M |
3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
3300005532 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 | Environmental | Open in IMG/M |
3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006577 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006604 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010152 | Soil microbial communities from Oklahoma, USA to study soil gas exchange rates - GP-OK-ARM metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300011106 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMC (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
3300012896 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2 | Environmental | Open in IMG/M |
3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300024182 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK10 | Environmental | Open in IMG/M |
3300024232 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK05 | Environmental | Open in IMG/M |
3300024246 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK21 | Environmental | Open in IMG/M |
3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
3300027773 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300027968 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen10_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
3300031199 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_S | Environmental | Open in IMG/M |
3300031200 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 9_S | Environmental | Open in IMG/M |
3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
FI_00148990 | 2166559006 | Grass Soil | FTLFQVAPVQITPEPDEAERKAILAALAAEEAEQSDASEWAAALLPARDDDPEP |
N57_00287640 | 2170459013 | Grass Soil | VAPVQITPEPDEAERKAILAALAADEAEQSGASEWAAALLPPRDDDPEP |
4MG_03309430 | 2170459019 | Switchgrass, Maize And Mischanthus Litter | VASFEITPEPGEAERKAILAALGAENAERQTGSDWADAQLPERPGEEDEP |
4MG_00250340 | 2170459019 | Switchgrass, Maize And Mischanthus Litter | VAPLQITPEPDEGERKAILAALAAEEAEQPCVSRRVAALLPARDDDPEP |
JGI10216J12902_1043004982 | 3300000956 | Soil | MPLEITPEPDEAEREAILAALATEQAEQPVASEWAAALLPARNDEEPEP* |
A3PFW1_100383811 | 3300001535 | Permafrost | VEPSHITPEPDEAERAAILRALAAEERERPPAFDWAQALLPVRGGDEAEP |
A1565W1_100517314 | 3300001536 | Permafrost | VEPSHITPEPDEAERAAILRALAAEERERPPAFDWAQALLPVRGGDEAEP* |
C688J18823_100187407 | 3300001686 | Soil | MPVQITPEPNETERRAILAALAEEADQPGTSDWAATLLPVRDDEARDP* |
C688J18823_100255402 | 3300001686 | Soil | MLLEITPEPDEAERKAILAALAAEETEQPVASEWAAALLPARNNEESEP* |
C688J35102_1209669633 | 3300002568 | Soil | MSVRITPEPNGAERKAILEALAAEEAEQQVTSEWAATLLPARDREEPDP* |
soilH2_100425664 | 3300003324 | Sugarcane Root And Bulk Soil | MPLEITPEPDERERKAILAALAADDDEQPAVSEWAAALLPARNDEETEP* |
soilH2_100738392 | 3300003324 | Sugarcane Root And Bulk Soil | VVHVQITPEPDDEERQAILAALAAEDAEPPPVSEWAAAALPARDPAEVEP* |
Ga0062593_1025399041 | 3300004114 | Soil | MPLEITPEPDEAEREAILAALAAEQAEQPAASEWAAALLPARNDEEPEP* |
Ga0063455_1000864562 | 3300004153 | Soil | MPLEITPEPDEAERKAILAALAAEETEQPVASEWAAALLPARNNEESEP* |
Ga0062589_1025807011 | 3300004156 | Soil | MEVEIRPEPDERERKAILAALAAEEEEERATSEWAAALLPVRDSEAPEP* |
Ga0062590_1019846952 | 3300004157 | Soil | MEVEIRPEPDERERKAILAALAAEEEEERATSGWSAALLPVRDSEAPEP* |
Ga0062595_1000448551 | 3300004479 | Soil | VVLPQITPEPGEYERKAILAALAAEEAEQPALSGWNAALLPDRSDQGEP* |
Ga0062595_1001119161 | 3300004479 | Soil | MEVEIRPEPDERERKAILAALAAEEEEERATSEWAAALLPVRDS |
Ga0062594_1017110302 | 3300005093 | Soil | MPLEITPEPDEAERAAILAALAAERGEQPVASEWAAALLPVRNDEESEP* |
Ga0066688_102802913 | 3300005178 | Soil | VTPLQITPEPDEAEREAILAALAAEEMERPTASCWAEALLPARGGKEDEP* |
Ga0066684_100504372 | 3300005179 | Soil | VTPLQITPEPDEAEREAILAALAAEEMERPTASCWADALLPARGGKEDEP* |
Ga0066684_101990282 | 3300005179 | Soil | VESTHIAPEPGEAERKAILAALAAEEPEEHTLSEWAAALLPAREETEHEP* |
Ga0066678_101909904 | 3300005181 | Soil | ITLFSVTPLQITPEPDEAEREAILAALAAEEMERPTASCWAEALLPARGGKEDEP* |
Ga0066676_100166003 | 3300005186 | Soil | VETTHITPEPDEAERRAILAALATEEAEQPGASEWAAALLPAREDEPEP* |
Ga0066675_101271541 | 3300005187 | Soil | VAPVQITPEPDEAERKAILAALAAEEAEQPGVSEWAATLLPAREDEPEP* |
Ga0070683_1004708841 | 3300005329 | Corn Rhizosphere | LQITPEPDEGERKAILAALAAEQAEQHRVSRRVAALLPARDDDPEP* |
Ga0066388_1002285131 | 3300005332 | Tropical Forest Soil | MSVWITPEPGEAERKAILAALAAEAADQPADSEWVAALLPSHDEDEP* |
Ga0070680_1000138415 | 3300005336 | Corn Rhizosphere | MRVQITPEPDETERKAILAALAAEEEQRGTSEWAAALLPVRDDEEREP* |
Ga0070680_1006970453 | 3300005336 | Corn Rhizosphere | MEVEIRPEPDERERTAILAALAAEEEEERATSEWAAALLPVRDSEAPEP* |
Ga0070682_1004270173 | 3300005337 | Corn Rhizosphere | MMSLEITPEPDEAEREAILAALAAEQAEQPAASEWAAALLPARNDEEPEP* |
Ga0070661_1011695572 | 3300005344 | Corn Rhizosphere | MEVEIRPEPDERERKAILAALAAEEEEERTTSEWAAALLPVCDSEEPEP* |
Ga0070714_1000109426 | 3300005435 | Agricultural Soil | MPLQITPEPDEAERKAILAVLAGEDADRPAVSEWAAAALPARDEDEREA* |
Ga0070714_1000279791 | 3300005435 | Agricultural Soil | VAPVQITPEPDEAERKAILAALAAEEAEQSRVSRFAAAFLPARDDDPEP* |
Ga0070714_1001110542 | 3300005435 | Agricultural Soil | MPVEITPEPDEAERKAILAALAAEAAEQSGTSEWAAALLPTRDDDPEP* |
Ga0070713_1002255152 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | VAPLQITPEPDEGERKAILAALAAEQAEQHRVSRRVAALLPARDDDPEP* |
Ga0070710_114863691 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | PEPDEAELKAILEALAAEAAEQSGTSEWAAALLPARDGDPEP* |
Ga0070711_1000128263 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | LAPVQITPEPDEAERKAILAALAAEEAEQSRVSRFAATFLPARDDDPEP* |
Ga0070708_1010030652 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | VATTHITPEPNESERKAILAALAADEVQEQVVSEWAAALLPVREETESDP* |
Ga0066687_102124653 | 3300005454 | Soil | VATTHITPEPDETERKAILAALAAEEAEQPSVSEWAGALQPARDDESEP* |
Ga0070678_1015514032 | 3300005456 | Miscanthus Rhizosphere | MPLEITPEPDEAEREAILAALAAEQAEHPAASEWAAALLPARNDEEPEP* |
Ga0070699_1010025233 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MPLEITPEPNEAEREAILAALAAEQAEHPAASEWAAALLPARNDEEPEP* |
Ga0070737_100108838 | 3300005524 | Surface Soil | VEVEIRPEPDEAERAAILAALAEEEEARGSSAWAQAELPAREGAECGA* |
Ga0070679_1001509244 | 3300005530 | Corn Rhizosphere | LFLVMEVEIRPEPDERERKAILAALAAEEEEERTTSEWAAALLPVCDSEEPEP* |
Ga0070739_1000058951 | 3300005532 | Surface Soil | MSLDITPEPDEAERQAIVEALAAEQAEHATASAWADALLPSREEGEP* |
Ga0070739_100065157 | 3300005532 | Surface Soil | VEVEIRPEPDEAERAAILAALAEEEEARGSSAWAQTELPAREGAECGA* |
Ga0070734_100478114 | 3300005533 | Surface Soil | VNLQVRPEPSDDERRAILAALAADEAEPEDSPWAAAALPGRDDEP* |
Ga0070684_1001815993 | 3300005535 | Corn Rhizosphere | MEVEIRPEPDERERKAILAALAAEEEEERTTSEWAAALLPVRDSEEPEP* |
Ga0070684_1007415552 | 3300005535 | Corn Rhizosphere | VAPLQITPEPDEGERKAILAALAAEEAEQPRVSRRVAALLPARDDDPEP* |
Ga0070732_103546613 | 3300005542 | Surface Soil | VETTRITPEPGPSERLAILAALAAEADEQAVSEWVAALLPARDDEVEP* |
Ga0070686_1015247642 | 3300005544 | Switchgrass Rhizosphere | MPLEITPEPDEAERAAILAALAAERGEQPVASEWAAAALLPVRNAEESEP* |
Ga0070696_1003933134 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | LIMPLEITPEPDEAEREAILAALAAEQAEHPAASEWAAALLPARNDEEPEP* |
Ga0070693_1006616692 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MPLEITPEPDEAERAAILAALAAERGEQPVASEWAAALLP |
Ga0066695_106020071 | 3300005553 | Soil | THITPEPDEAERRAILAALATEEAEQPGASEWAAALLPAREDEPEP* |
Ga0066700_101132441 | 3300005559 | Soil | KAILAALAAEEAEQLCVSEWAAALLPAREDEPEP* |
Ga0066670_100631714 | 3300005560 | Soil | MPVQITPEPNETERRAILAALAEEADQPTTSDWAATLLPVRDDEARDP* |
Ga0066699_102179112 | 3300005561 | Soil | VTPLQITPEPDEAERKAILAALAAEEMEWPTASCWAEALLPARGGKEDEP* |
Ga0068856_1000713303 | 3300005614 | Corn Rhizosphere | MMSLEITPEPDEAEREAILAALAAEQAEHPAASEWAAALLPARNDEEPEP* |
Ga0068856_1005870321 | 3300005614 | Corn Rhizosphere | MEVEIRPEPDERERKAILAALAAEEEEEPTTSEWAAALLPVRDSEEPEP* |
Ga0070702_1004651921 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | ITPEPDEAERAAILAALAAERGEQPVASEWAAALLPVRNAEESEP* |
Ga0066903_1000247214 | 3300005764 | Tropical Forest Soil | VQTTHITPEPNEVERKAILAALAAEEHAVSEWAAALLPVRDETEHEP* |
Ga0066903_1008236962 | 3300005764 | Tropical Forest Soil | MQAFTLFYAMAVQITPEPDETERQAILAALAAEAAEQFGASEWAAALLPARDGDPEP* |
Ga0066903_1015240542 | 3300005764 | Tropical Forest Soil | VVSFQITPEPSEAERQAILEALAAEDAERTAASKWPPALLPGRESEEGEP* |
Ga0066903_1042339992 | 3300005764 | Tropical Forest Soil | MSLQITPEPNEAERTAIVAALAAEEAEQDAVSEWAAALLPTRGETEPDP* |
Ga0066903_1052293342 | 3300005764 | Tropical Forest Soil | MSVQITPEPNEVEREAILAALAGEEAEQHAVSEWAAAVLPSREETEHEP* |
Ga0066903_1071173083 | 3300005764 | Tropical Forest Soil | PDEFERKAILEALAAEEAEDAVVSEWAAALLPAREATEPEP* |
Ga0070717_105198471 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | PDEAERKAILAALAAEETEQPAISQWAAVLLPARDDDQRDP* |
Ga0070717_111905621 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MPVEITPEPSEAERKAILAALAAVDAERSGTSEWAAALLPTRDDDPQP* |
Ga0070717_115415182 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MPVEITPEPSEAERNAILEALAAEAAEQPGTLEWAVALLPARDDDPEP* |
Ga0070717_119710362 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | LAPVQITPEPDEAERKAILAALAAEEAEQSRVSRFAAAFLPAHDDDPEP* |
Ga0066652_1003673902 | 3300006046 | Soil | MPLEITPEPDEAERKAILAGLAADEGEQPAASEWAAALLPARNDEEPEP* |
Ga0070716_1008803033 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | EPDEAERKAILAALAAEEAEQSRVSRFAAAFLPARDDDPEP* |
Ga0070712_1000207304 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | VAPVQITPEPDEAERKAILAALAAEEAEQSRVSRFAATFLPARDDDPEP* |
Ga0070712_1010306191 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MAVEITPEPHESERQAILAALAAEEAEHSGTSEWASALLPTRDDDPEP* |
Ga0097621_1010198151 | 3300006237 | Miscanthus Rhizosphere | MPLEITPEPDEAEREAILAALAAEQAEQPAASEWAAALLP |
Ga0074050_110987932 | 3300006577 | Soil | MPVEITPEPDEAERKAILAALAAEEAEHSGTSEWAAALLPTRDDDPEP* |
Ga0074060_120437203 | 3300006604 | Soil | VVSFRITPEPDEAERRAIVEALAAEEAEQHAVSEWAAALLPSREDSEIEP* |
Ga0079222_111059612 | 3300006755 | Agricultural Soil | MSLQITPEPNEAERSAILAALAAEEAEQDSFSEWAAALLPTREETEHDP* |
Ga0079222_123777411 | 3300006755 | Agricultural Soil | MKVEITPEPDDAERRAILAALASEQGERRGTSEWAGALLPVRDEEEREP* |
Ga0079220_103529433 | 3300006806 | Agricultural Soil | ITPEPNEAERSAILAALAAEEAEQDSFSEWAAALLPTREETEHDP* |
Ga0079220_108406602 | 3300006806 | Agricultural Soil | MEVEITPEPDERERKAILAALAAEEEEERATSEWAAALLPVRDSGEPEP* |
Ga0075425_1003921044 | 3300006854 | Populus Rhizosphere | MPLEITPEPDEAEREAILAALAAERADQPAASEWAAALLPLRNDEEPEP* |
Ga0075434_10000116227 | 3300006871 | Populus Rhizosphere | MPLEITPEPDEAEREAILAALAAERAEQPAASEWAAALLPLRNDEEPEP* |
Ga0066710_1007257453 | 3300009012 | Grasslands Soil | VETTHITPEPDEAERRAILAALATEEAEQPGASEWAAALLPAREDEPEP |
Ga0111539_110017021 | 3300009094 | Populus Rhizosphere | MPLEITPEPDEAEREAILAALAAERAAQPAASEWAAALLPLRNDEEPEP* |
Ga0066709_1001436212 | 3300009137 | Grasslands Soil | VETTHITPEPDEAERRAILAVLATEEAEQPGASEWAAALLPAREDEPEP* |
Ga0099792_102263752 | 3300009143 | Vadose Zone Soil | VEPTQITPEPDEAERKAILAALAAVEAEQPVASEWAAALLPAREDEPEP* |
Ga0105241_114980732 | 3300009174 | Corn Rhizosphere | LVMEVEIRPEPDERERKAILAALAAEEEEERATSEWAAALLPVRDPEAPEP* |
Ga0105241_119642402 | 3300009174 | Corn Rhizosphere | MPLEITPEPDEAEREAILAALAAEQAEQPAASEWAAALLPLRNDEESEP* |
Ga0105238_100429914 | 3300009551 | Corn Rhizosphere | MEVEIRPEPDERERTAILAALAAEEEEERATSGWSAALLPVRDSEAPEP* |
Ga0126374_100691342 | 3300009792 | Tropical Forest Soil | VETTEITPEPDESERKAILAALGAEDTEEDAVSEWAAALLPAREETEHDP* |
Ga0126380_105991452 | 3300010043 | Tropical Forest Soil | MSVEITPEPHEQEREAILAALAAEAAERTAPSEWAAALLPERVENDP* |
Ga0126380_113723062 | 3300010043 | Tropical Forest Soil | MSVRITPEPDEAEREAILAALAAEDVDRTAATAWPGALLPADDEERP* |
Ga0126382_113067551 | 3300010047 | Tropical Forest Soil | PLRVETAHITPEPDESERKVILAALAVEEVEENAASEWAAALRPPREETEHDP* |
Ga0126373_113038291 | 3300010048 | Tropical Forest Soil | VRTTRITPEPDEAERQAILAALAAEDAEQPTVSEWVAALLPERDEDEREP* |
Ga0126318_103907101 | 3300010152 | Soil | EPDEIELKAILAALAAEDAERPSISGWNAALLPDRDDGEP* |
Ga0134070_102004783 | 3300010301 | Grasslands Soil | ETTHITPEPDEAERQAILAALAAEEAEQPGASEWAAALLPAREDEPEP* |
Ga0134082_103118101 | 3300010303 | Grasslands Soil | TPEPDEAEREAILAALAAEEMERPTASCWAEALLPARGGKEDEP* |
Ga0134067_102195931 | 3300010321 | Grasslands Soil | VETTHITPEPDEAERRAILAALATEEAEQPGASEWAGALLPAREDEP |
Ga0134086_104438222 | 3300010323 | Grasslands Soil | MQLQITPEPEEAERKAILAALAAEKTEQPAVSEWAAVLLPARDEDEREP* |
Ga0134063_103214363 | 3300010335 | Grasslands Soil | VETTHITPEPDEAERRAILAALAAEEAEQPGVSEWAAALLPAREDEPEP* |
Ga0134062_104365672 | 3300010337 | Grasslands Soil | MPVQITPEPNESERRAILAALAEEADQPTTSDWAATLLPVRDDEARDP* |
Ga0126370_106722832 | 3300010358 | Tropical Forest Soil | LLVSALITPEPDETERKAILAALAAEEAELAAASEWADALLPQSGAESNEP* |
Ga0126376_107399572 | 3300010359 | Tropical Forest Soil | MSIEITPEPGEQEREAILAALAAEAAERTAPSEWVAALLPERDEKEP* |
Ga0126376_125264102 | 3300010359 | Tropical Forest Soil | MSVRITPEPDEAERKAILAALAAEAAEQPADSEWAVALFPSHDEDEP* |
Ga0126378_108097513 | 3300010361 | Tropical Forest Soil | VQTTHITPEPDEAERKAILVALAADEAEQPAVSAWAAALLPAREDEEREP* |
Ga0126378_119152382 | 3300010361 | Tropical Forest Soil | VRTTRITPEPDEAERQAILAALAAEDAEQPTVSEWVAALLPARDEDEREP* |
Ga0134066_103393111 | 3300010364 | Grasslands Soil | MPLEITPEPDEAARKAILAGLAAEEGEQPAASEWAAALLPARNDEEPEP* |
Ga0126379_113673032 | 3300010366 | Tropical Forest Soil | VETARITPEPNESEREAILAALAAEEGEKQVSEWAAALLPTREETEPDP* |
Ga0126379_132643073 | 3300010366 | Tropical Forest Soil | MSVQITPEPNDVEREAILSALAEQAEPRAVSEWAAALLPTREETEHEP* |
Ga0134125_102269484 | 3300010371 | Terrestrial Soil | MPLEITPEPDEAERAAILAALAAERGEQPVASEWAAALLPVRNAEESEP* |
Ga0134128_100440995 | 3300010373 | Terrestrial Soil | MPVQIAPEPDETERRAILAALAAEEAEQRAVSGWAAAGLPARSSDDAEP* |
Ga0134128_108182693 | 3300010373 | Terrestrial Soil | MPLEITPEPDEAERAAILAALAAERGEQPAASEWAAALLPVRNAEESEP* |
Ga0134128_123270412 | 3300010373 | Terrestrial Soil | MSVRITPEPDEAERRAILAALAAEESEQATVSEWAAAGLPARDSEEGEP* |
Ga0105239_102103674 | 3300010375 | Corn Rhizosphere | MPLEITPEPDEAERAAILAALAAERGEQPVASEWAAALLPVRN |
Ga0105239_105386794 | 3300010375 | Corn Rhizosphere | PLPSLIMPLEITPEPDEAEREAILAALAAEQAEHPAASEWAAALLPARNDEEPEP* |
Ga0126381_1022554692 | 3300010376 | Tropical Forest Soil | VKTTHITPEPTSAERKAILAALAAEEVEENAVSEWAAALLPAREESEHDP* |
Ga0126381_1049225771 | 3300010376 | Tropical Forest Soil | MELTHVTPEPDEAERQAILAALAAEQATRARASRWAETALPARGGQEDEP* |
Ga0134126_100571101 | 3300010396 | Terrestrial Soil | MPLEITPEPDEAARAAILAALAAERGEQPVASEWAAALLPVRNAEESEP* |
Ga0134126_129720831 | 3300010396 | Terrestrial Soil | VAPVQITPEPDEAERKAILAALAAEEAEQSRVSRFAAAFLPARDDGPEP* |
Ga0134127_102672832 | 3300010399 | Terrestrial Soil | MRVQITPEPDETERKAILAALAAEEEEERATSGWSAALLPVRDSEAPEP* |
Ga0151489_10093952 | 3300011106 | Soil | VQTTRITPEPDEAERKAILAALAAEEAEPSGASEWAAALLPARDDDPEP* |
Ga0151489_13617692 | 3300011106 | Soil | LVVSFRITPEPDEAERRAILEALAAEEAEQHAVSEWAAALLPSRDDSENEP* |
Ga0137364_100093234 | 3300012198 | Vadose Zone Soil | MPLEITPEPDEAERKAILAGLAAEEGEQPAASEWAAALLPARNDEEPEP* |
Ga0137364_100137461 | 3300012198 | Vadose Zone Soil | VAIQITPEPNEAERRAILAALATEEAEQPGASEWAAALLPAREDEPEP* |
Ga0137382_100455032 | 3300012200 | Vadose Zone Soil | MPVEITPEPDEAARKAILAGLAADEGEQPAASEWAAALLPARNDEEPEP* |
Ga0137376_115607072 | 3300012208 | Vadose Zone Soil | MPVEITPEPDEAARKAILAGLAAEEGEQPAASEWAAALLPARNDEEPEP* |
Ga0137377_105006751 | 3300012211 | Vadose Zone Soil | EPNEAERRAILAALAAEEAEQPGASEWAAALLPAREDEPEP* |
Ga0137377_111848233 | 3300012211 | Vadose Zone Soil | LVVSSQITPEPDEAERRAILEALAAEDAEQPAVSEWAAALLPAREGSENEP* |
Ga0150985_1168593824 | 3300012212 | Avena Fatua Rhizosphere | PLWLMPLEITPEPDEAERKAILAALAAEETEQPVASEWAAALLPARNNEESEP* |
Ga0137387_108450981 | 3300012349 | Vadose Zone Soil | LVASSQITPEPDEAERRAILEALAAEDAEQAAVSEWAAALLPAREGSENEP* |
Ga0137369_106407042 | 3300012355 | Vadose Zone Soil | VETTHITPEPDEAERQAILAALSAEEAEQPGFSEWAAALLPALDDDPEP* |
Ga0157303_101330223 | 3300012896 | Soil | MPLEITPEPDEAEREAILAALAAERAEQPAASEWAAALLPVRNDEEPEP* |
Ga0157302_101585253 | 3300012915 | Soil | MRVQITPEPDETERKAILAALAAEEEEERATSEWAAALLPVRDSEAPEP* |
Ga0137359_106049623 | 3300012923 | Vadose Zone Soil | LVVSSQITPEPDEAERRAILEALAAEDAEQPAVSEWAAALLPAREDSENEP* |
Ga0137413_101455964 | 3300012924 | Vadose Zone Soil | VETTQITPEPDEGERKAILAALAAEVAEQPGASEWAAALLPARDDEPEP* |
Ga0164300_100199262 | 3300012951 | Soil | MPLEITPEPDEAEREAILAALAAEHAEQPAASEWAAALLPARNDEEPEP* |
Ga0164300_107001722 | 3300012951 | Soil | MPLEITPQPDEAEREAILAALAAEQAERLAASEWAAALLPVRNDEESEP* |
Ga0164299_102425691 | 3300012958 | Soil | MPLEITPEPDDAERKAFLAALAAEEVEQHAVSEWAGALLPARNDEEPEP* |
Ga0164301_101186112 | 3300012960 | Soil | MPLEITPQPDEAEREAILAALAAEQAERPAASEWAAALLPVRNDEESEP* |
Ga0164301_102883272 | 3300012960 | Soil | MPLEITPEPNEAEREAILAALAAEHAEQPAASEWAAALLPARNDEEPEP* |
Ga0126369_117577222 | 3300012971 | Tropical Forest Soil | MAVQITPEPGEAEREVILAALAAEEEDGRGASEWAAALLPARDDEERDP* |
Ga0134110_105422371 | 3300012975 | Grasslands Soil | VGATHITPEPDEAERKAILAALATEEAEQPGASEWAAALLPAREDEPEP* |
Ga0134087_100974703 | 3300012977 | Grasslands Soil | VETTHITPEPDEAERKAILAALAAEEPEEHTLSEWAAALLPAREETEHEP* |
Ga0164309_110291862 | 3300012984 | Soil | MSLQITPDPNEAEREAIRLALAAEEAEQHVVSEWATALLPARNDEEPEP* |
Ga0164309_110291931 | 3300012984 | Soil | VAPVQITPEPDEAERKAILAALAAEEAEQSRVSRFAAA |
Ga0164308_102299192 | 3300012985 | Soil | MQVEITPEPEEAEGKAILAAIAAEEAEQPAASEWAAALLPAR |
Ga0164308_114398532 | 3300012985 | Soil | MPLEITPQPDEAEREAILAALAAEQAERPAASEWAAALLPARNDEEPEP* |
Ga0164304_108068842 | 3300012986 | Soil | MPLEITPEPDEAEREAILAALAAEQAEQRAASEWAAALLPVRNDEESEP* |
Ga0164307_105270572 | 3300012987 | Soil | MPLEITPEPDEAERQAILEALAAEHAERSAVSEWAAALLPAREDDEREP* |
Ga0157373_111917062 | 3300013100 | Corn Rhizosphere | MEVEIRPEPDERERTAILAALAAEEEEERATSEWAAALLPVRDSEEPEP* |
Ga0157374_121117311 | 3300013296 | Miscanthus Rhizosphere | LIMPLEITPEPNEAEREAILAALAAEQAEQPAASEWAAALLPARNDEEPEP* |
Ga0163162_103455872 | 3300013306 | Switchgrass Rhizosphere | LIMPLEITPEPDEAEREAILAALAAEQAEQPAASEWAAALLPARNDEEPEP* |
Ga0157372_106750083 | 3300013307 | Corn Rhizosphere | MPLEITPQPDEAERAAILAALAAERGEQPVASEWAAALLPVRNAEESEP* |
Ga0157372_127484511 | 3300013307 | Corn Rhizosphere | MKVEITPEPDDAERRAILAALASEQGERRGTSEWAAALLPVRDEEE |
Ga0134078_100719882 | 3300014157 | Grasslands Soil | VETTHITPEPDEAERQAILAALAAEEAEQPGASEWAAALLPAREDEPEP* |
Ga0134078_102429833 | 3300014157 | Grasslands Soil | PKGKAILAALAAEEAEQPSAAEWARALPPAREDEPEP* |
Ga0182008_108105742 | 3300014497 | Rhizosphere | MQVEITPEPDEQERRAILAALAGEAADSPGGSAWARAALPGRGDEEDDEA* |
Ga0173483_100509124 | 3300015077 | Soil | MPLEITPEPDEAEREAILAALAAEQAEQPAASEWAAALLPVRNDEESEP* |
Ga0132258_109553954 | 3300015371 | Arabidopsis Rhizosphere | MSLQITPEPNEAERGAILVALAAEEAEQDAVSEWAAVLLPTRE |
Ga0132257_1002842712 | 3300015373 | Arabidopsis Rhizosphere | MMSLEITPEPDEAEREAILAALAAEQAEQPAASEWAAALLPLRNDEESEP* |
Ga0182038_109421651 | 3300016445 | Soil | TRITPEPDDAERQAILAALAAEDAEQPAVSEWVAALLPAREDDEREP |
Ga0187779_101534562 | 3300017959 | Tropical Peatland | VVSVQITPEPDDAERTAILAALAAEAAEQPVISEWAAALLPARDEDEL |
Ga0187777_109023151 | 3300017974 | Tropical Peatland | MEATHITPEPDEAERKAILAALAAEEAEEHAVSAWAAAVLPAREDEEREHDE |
Ga0187777_111123452 | 3300017974 | Tropical Peatland | VVSYQITPEPGDAERRAILAALDAEAAERVPVSEWAAALLPERDDDDEPQPRHSG |
Ga0066669_101809164 | 3300018482 | Grasslands Soil | MPLEITPEPDEAERKAILAGLAADEGEQPAASEWAAALLPARNDEEPEP |
Ga0066669_122704791 | 3300018482 | Grasslands Soil | THCSPRPNEAGRRAFLAALATEEAEQPGASEWAAALLPAREDEPEP |
Ga0206356_104559692 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | MPLEITPEPNEAEREAILAALAAEQAEQPAASEWAAALLPARND |
Ga0206356_117437353 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | MEVEIRPEPDERERKAILAALAEEEEERATSEWAAALLPVRDSGAPEP |
Ga0206354_110946132 | 3300020081 | Corn, Switchgrass And Miscanthus Rhizosphere | MEVEIRPEPDERERTAILAALAAEEEEERATSEWAAALLPVRDSEAPEP |
Ga0126371_104824873 | 3300021560 | Tropical Forest Soil | MQAFTLFYAMAVQITPEPDETERQAILAALAAEAAEQSGASEWAAALLPARDSDPEP |
Ga0126371_107512343 | 3300021560 | Tropical Forest Soil | VRGTRITPEPDEAEREAILAALAAEEEDGRGASEWAAALLPARDDEERDP |
Ga0126371_118469122 | 3300021560 | Tropical Forest Soil | MPVDITPEPDETERQAILAALAAEEAEQSGASEWAAALMPARDGDPEP |
Ga0247669_10298833 | 3300024182 | Soil | AFNLFQVAPLQITPEPDEGERKAILAALAAEQAEQHRVSRRVAALLPARDDDPEP |
Ga0247669_10600341 | 3300024182 | Soil | MEVEIRPEPDERERKAILAALAAEEEEERATSEWAAALLPVRDSGEPEP |
Ga0247664_10457942 | 3300024232 | Soil | MEVEIRPEPDERERKAILAALAAEEEEERATSGWSAALLPVRDSGAPEP |
Ga0247680_10170483 | 3300024246 | Soil | MSVRITPEPDEAERRAILAALAAEESEQATVSEWAAAGLPARDSEEGEP |
Ga0207695_110757753 | 3300025913 | Corn Rhizosphere | MEVEIRPEPDERERKAILAALAAEEEEERATSGWSAALLPVRDSEAPEP |
Ga0207693_100644992 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MAVEITPEPHESERQAILAALAAEEAEHSGTSEWASALLPTRDDDPEP |
Ga0207663_100242024 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | LAPVQITPEPDEAERKAILAALAAEEAEQSRVSRFAAAFLPARDDDPEP |
Ga0207660_102053834 | 3300025917 | Corn Rhizosphere | EIRPEPDERERTAILAALAAEEEEERATSEWAAALLPVRDSGEPEP |
Ga0207660_114843161 | 3300025917 | Corn Rhizosphere | MEVEIRPEPDERERTAILAALAAEEEEERATSEWAAALLPVRDSEA |
Ga0207662_112291631 | 3300025918 | Switchgrass Rhizosphere | MPLEITPEPDEAEREAILAALAAEQAEHPAASEWAAALLPARNDEEPEP |
Ga0207657_100095907 | 3300025919 | Corn Rhizosphere | MEVEIRPEPDERERKAILAALAAEEEEERATSEWAAALLPVRDSEAPEP |
Ga0207694_107366172 | 3300025924 | Corn Rhizosphere | MPLEITPEPDEAEREAILAALAAEQAEQPAASEWAAALLPARNDEEPEP |
Ga0207687_102099591 | 3300025927 | Miscanthus Rhizosphere | MPLEITPEPDEAERAAILAALAAERGEQPVASEWAAALLPVRNAEESEP |
Ga0207687_102731952 | 3300025927 | Miscanthus Rhizosphere | LIMPLEITPEPDEAEREAILAALAAEQAEHPAASEWAAALLPARNDEEPEP |
Ga0207700_100107487 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | VAPVQITPEPDEAERKAILAALAAEEAEQSRVSRFAAAFLPAR |
Ga0207700_117179173 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | AFNLVHVAPVQITPEPDEAERKAILAALAAEEAEQSRVSRFAATFLPARDDDPEP |
Ga0207664_102297334 | 3300025929 | Agricultural Soil | MPVEITPEPDEAERKAILAALAAEAAEQSGTSEWAAALLPTRDDDPEP |
Ga0207664_104662951 | 3300025929 | Agricultural Soil | VVLLEITPEPEDAERQAILAALAAEEAEQPVASEWNAATPPSREE |
Ga0207664_105392752 | 3300025929 | Agricultural Soil | MPLQITPEPDEAERKAILAVLAGEDADRPAVSEWAAAALPARDEDEREA |
Ga0207664_118793301 | 3300025929 | Agricultural Soil | MPVEITPEPSEAERNAILEALAAEAAEQPGISEWAAALLPARDDDPEP |
Ga0207706_110470021 | 3300025933 | Corn Rhizosphere | MEVEIRPEPDERERTAILAALAAEEEEERATSEWAAALLPVRDSEAP |
Ga0207706_110928313 | 3300025933 | Corn Rhizosphere | LSPLPSLVMPLEITPEPDEAERAAILAALAAERGEQPVASEWAAALLPVRNAEESEP |
Ga0207665_106053673 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | AERKAILAALAAEEAEQSRVSRFAAAFLPARDDDPEP |
Ga0207665_107930952 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MSLEITPEPGEHERKAILAALAAEEAEQPGASEWAAALLPTRDDDPEP |
Ga0207667_106444772 | 3300025949 | Corn Rhizosphere | VAPLQITPEPDEGERKAILAALAAEEAEQSRVSRFAATFLPARDDDPEP |
Ga0207667_113815082 | 3300025949 | Corn Rhizosphere | MEVEIRPEPDERERKAILAALAAEEEEERATSGWSAALLPVR |
Ga0207678_111141001 | 3300026067 | Corn Rhizosphere | MMSLEITPEPDEAEREAILAALAAEQAEQPAASEWAAALLPLRNDEESEP |
Ga0209808_10949051 | 3300026523 | Soil | VTPLQITPEPDEAEREAILAALAAEEMERPTASCWAEALLPARGGKEDE |
Ga0209805_11080062 | 3300026542 | Soil | VTPLQITPEPDEAERKAILAALAAEEMEWPTASCWAEALLPARGGKEDEP |
Ga0209474_1000065814 | 3300026550 | Soil | VTPLQITPEPDEAEREAILAALAAEEMERPTASCWAEALLPARGGKEDEP |
Ga0209474_103983431 | 3300026550 | Soil | PEPGEAERKAILAALAAEEPEEHTLSEWAAALLPAREETEHEP |
Ga0209810_100056231 | 3300027773 | Surface Soil | MSLDITPEPDEAERQAIVEALAAEQAEHATASAWADALLPSREEGEP |
Ga0209580_103343623 | 3300027842 | Surface Soil | VETTRITPEPGPSERLAILAALAAEADEQAVSEWVAALLPARDDEVEP |
Ga0209488_102596162 | 3300027903 | Vadose Zone Soil | VETTQITPEPDEGERKAILAALAAEVAEQPGASEWAAALLPARDDEPEP |
Ga0209061_100529811 | 3300027968 | Surface Soil | VEVEIRPEPDEAERAAILAALAEEEEARGSSAWAQTELPAREGAECGA |
Ga0307503_100757062 | 3300028802 | Soil | VAPVQITPEPDEAERKAILAALAAEEAEQSGASEWAAALLPARDDDPEP |
Ga0307498_100074514 | 3300031170 | Soil | VAPVQITPEPDEAEREAILAALAAEEAEQSGASEWAAALLPARDQDPEP |
Ga0307495_101561462 | 3300031199 | Soil | MPLEITPEPDEAEREAILAALAAERAEQPAASEWAAALLSVRN |
Ga0307496_100883091 | 3300031200 | Soil | MPLEITPEPDEAEREAILAALAAERAEQPAASEWAAALLPVRND |
Ga0307497_100385122 | 3300031226 | Soil | VAPVQITPEPDEAERKAILAALAAEEAEQSGASEWAAALLPARDQDPEP |
Ga0307497_100616121 | 3300031226 | Soil | MPLEITPEPDEAEREAILAALAAERAEQPAASEWAAALLPARNDEEPEP |
Ga0307469_111182012 | 3300031720 | Hardwood Forest Soil | MSVWITPEPHEAERKAILAALAAEAAEQPAGSAWAGALLPAHDEDEP |
Ga0308175_1000388614 | 3300031938 | Soil | MPRAFNLFQVLPVQQITPEPDEAERKAILAALAAEEAEQRGASEWAAALRPAREDEPEP |
Ga0308175_1001014492 | 3300031938 | Soil | VVVSVRITPEPNGPERKAILEALAAEEAEQPMTSEWAATLLPARDPEERDP |
Ga0308175_1003967162 | 3300031938 | Soil | MRVQIIPEPEEAARKAILAALAAEEEERCGASEWAAALLPARDDEEREP |
Ga0308175_1021730512 | 3300031938 | Soil | MPVQITPEPGEAERKAILAALAAEEKGQRATSEWAAALLPVRDDEE |
Ga0308174_116307612 | 3300031939 | Soil | LVVSALITPEPDEVERKAILAALAAEEAERSAASEWADALLPAHGVEANEP |
Ga0308176_121018661 | 3300031996 | Soil | VVVSVRITPEPNGPERKAILEALAAEEAEQPMTSEWAATLLPARDPE |
Ga0308173_100901582 | 3300032074 | Soil | MPVQIAPEPDETERRAILAALAAEEAEQRAVSGWAAAGLPARSSDDAEP |
Ga0307471_1013355492 | 3300032180 | Hardwood Forest Soil | MPLEITPEPDEGERQAILAALAAEQAEQPAASEWAAALLPARNDEEPEP |
Ga0335085_111822643 | 3300032770 | Soil | MSVDITPEPGDAERKAILAALAAEEAEQPGASEWAAALLPARDDDPEP |
Ga0335082_107802103 | 3300032782 | Soil | MSVEITPEPDDTERKAILAALAAEEAEQPRASEWAAALLPARDDDPEP |
Ga0335079_105770474 | 3300032783 | Soil | RVETTRITPEPDPDERRAILAALAAEEDEQSTGSEWVAALLPARDEEPEQ |
Ga0335080_109154213 | 3300032828 | Soil | VETTRITPDPDPDERRAILAALAAEESEPPAVSEWVAALLPRRDEEPEQ |
Ga0335070_103440864 | 3300032829 | Soil | ITPEPGDAERKAILAALAAEEAEQPGASEWAAALLPARDDDPEP |
Ga0335081_111942093 | 3300032892 | Soil | PVESTRITPEPGEAERKAILAALAAEEAEQSAPSEWVAPHLPAREDSEREP |
Ga0335069_125673062 | 3300032893 | Soil | MEHEIRPEPDEAERKAILAALAAEEAGQPALSQWAAAVLPAREDWGRATPAERG |
⦗Top⦘ |