NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F019839

Metagenome / Metatranscriptome Family F019839

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F019839
Family Type Metagenome / Metatranscriptome
Number of Sequences 227
Average Sequence Length 43 residues
Representative Sequence AVALLPELDVPEPTVLPLERFHEGLELYRSGEALKVVFTP
Number of Associated Samples 186
Number of Associated Scaffolds 227

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.77 %
% of genes near scaffold ends (potentially truncated) 95.15 %
% of genes from short scaffolds (< 2000 bps) 92.95 %
Associated GOLD sequencing projects 180
AlphaFold2 3D model prediction Yes
3D model pTM-score0.63

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (96.916 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(13.656 % of family members)
Environment Ontology (ENVO) Unclassified
(33.921 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(39.648 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 23.53%    β-sheet: 11.76%    Coil/Unstructured: 64.71%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.63
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 227 Family Scaffolds
PF08240ADH_N 56.39
PF13823ADH_N_assoc 8.37
PF00107ADH_zinc_N 4.85
PF06224HTH_42 3.08
PF13030DUF3891 1.32
PF00266Aminotran_5 1.32
PF04012PspA_IM30 1.32
PF01939NucS 0.88
PF05193Peptidase_M16_C 0.44
PF14691Fer4_20 0.44
PF01596Methyltransf_3 0.44
PF08450SGL 0.44
PF01850PIN 0.44
PF05954Phage_GPD 0.44
PF01408GFO_IDH_MocA 0.44
PF135632_5_RNA_ligase2 0.44
PF00905Transpeptidase 0.44
PF13442Cytochrome_CBB3 0.44
PF00941FAD_binding_5 0.44

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 227 Family Scaffolds
COG3214DNA glycosylase YcaQ, repair of DNA interstrand crosslinksReplication, recombination and repair [L] 3.08
COG1842Phage shock protein ATranscription [K] 2.64
COG1637Endonuclease NucS, RecB familyReplication, recombination and repair [L] 0.88
COG2518Protein-L-isoaspartate O-methyltransferasePosttranslational modification, protein turnover, chaperones [O] 0.44
COG3386Sugar lactone lactonase YvrECarbohydrate transport and metabolism [G] 0.44
COG3391DNA-binding beta-propeller fold protein YncEGeneral function prediction only [R] 0.44
COG3500Phage protein DMobilome: prophages, transposons [X] 0.44
COG4122tRNA 5-hydroxyU34 O-methylase TrmR/YrrMTranslation, ribosomal structure and biogenesis [J] 0.44
COG4123tRNA1(Val) A37 N6-methylase TrmN6Translation, ribosomal structure and biogenesis [J] 0.44

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms96.92 %
UnclassifiedrootN/A3.08 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2040502001|FACENC_GAMC6GA01CGMN3All Organisms → cellular organisms → Bacteria500Open in IMG/M
2140918007|ConsensusfromContig82268All Organisms → cellular organisms → Bacteria754Open in IMG/M
2170459006|GBPF9FW01EBX1VAll Organisms → cellular organisms → Bacteria519Open in IMG/M
3300001526|A105W1_1523729All Organisms → cellular organisms → Bacteria654Open in IMG/M
3300001538|A10PFW1_11451821All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi767Open in IMG/M
3300003313|P32013IDBA_1102848All Organisms → cellular organisms → Bacteria594Open in IMG/M
3300004024|Ga0055436_10203673All Organisms → cellular organisms → Bacteria620Open in IMG/M
3300004114|Ga0062593_101174874All Organisms → cellular organisms → Bacteria803Open in IMG/M
3300004156|Ga0062589_102230513All Organisms → cellular organisms → Bacteria561Open in IMG/M
3300004157|Ga0062590_100558994All Organisms → cellular organisms → Bacteria993Open in IMG/M
3300004157|Ga0062590_100680824All Organisms → cellular organisms → Bacteria922Open in IMG/M
3300004463|Ga0063356_105581502All Organisms → cellular organisms → Bacteria540Open in IMG/M
3300004479|Ga0062595_102039990All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium555Open in IMG/M
3300004643|Ga0062591_101403308All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi693Open in IMG/M
3300005093|Ga0062594_100373920All Organisms → cellular organisms → Bacteria1134Open in IMG/M
3300005093|Ga0062594_101065332All Organisms → cellular organisms → Bacteria786Open in IMG/M
3300005093|Ga0062594_102113240All Organisms → cellular organisms → Bacteria606Open in IMG/M
3300005332|Ga0066388_105659508All Organisms → cellular organisms → Bacteria632Open in IMG/M
3300005340|Ga0070689_100173375All Organisms → cellular organisms → Bacteria1749Open in IMG/M
3300005355|Ga0070671_101890041All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300005356|Ga0070674_101252597All Organisms → cellular organisms → Bacteria660Open in IMG/M
3300005434|Ga0070709_11417395All Organisms → cellular organisms → Bacteria563Open in IMG/M
3300005435|Ga0070714_100119284All Organisms → cellular organisms → Bacteria2344Open in IMG/M
3300005444|Ga0070694_100762225All Organisms → cellular organisms → Bacteria791Open in IMG/M
3300005457|Ga0070662_100188660All Organisms → cellular organisms → Bacteria1629Open in IMG/M
3300005466|Ga0070685_10669115All Organisms → cellular organisms → Bacteria754Open in IMG/M
3300005466|Ga0070685_11263473All Organisms → cellular organisms → Bacteria563Open in IMG/M
3300005467|Ga0070706_101719516All Organisms → cellular organisms → Bacteria571Open in IMG/M
3300005526|Ga0073909_10578560All Organisms → cellular organisms → Bacteria552Open in IMG/M
3300005539|Ga0068853_100657847All Organisms → cellular organisms → Bacteria997Open in IMG/M
3300005543|Ga0070672_100765750All Organisms → cellular organisms → Bacteria848Open in IMG/M
3300005544|Ga0070686_100146557All Organisms → cellular organisms → Bacteria1649Open in IMG/M
3300005569|Ga0066705_10930848All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300005578|Ga0068854_101764848All Organisms → cellular organisms → Bacteria567Open in IMG/M
3300005578|Ga0068854_101922308All Organisms → cellular organisms → Bacteria544Open in IMG/M
3300005614|Ga0068856_102085961All Organisms → cellular organisms → Bacteria577Open in IMG/M
3300005719|Ga0068861_100161790All Organisms → cellular organisms → Bacteria1847Open in IMG/M
3300005719|Ga0068861_100744971All Organisms → cellular organisms → Bacteria915Open in IMG/M
3300005719|Ga0068861_102711113All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermoflexia → Thermoflexales → Thermoflexaceae → Thermoflexus → Thermoflexus hugenholtzii500Open in IMG/M
3300005764|Ga0066903_101403868All Organisms → cellular organisms → Bacteria1312Open in IMG/M
3300005844|Ga0068862_100581319All Organisms → cellular organisms → Bacteria1073Open in IMG/M
3300005844|Ga0068862_101565262All Organisms → cellular organisms → Bacteria666Open in IMG/M
3300005937|Ga0081455_10434948All Organisms → cellular organisms → Bacteria901Open in IMG/M
3300005985|Ga0081539_10216960All Organisms → cellular organisms → Bacteria873Open in IMG/M
3300006358|Ga0068871_101984419All Organisms → cellular organisms → Bacteria554Open in IMG/M
3300006852|Ga0075433_10363056All Organisms → cellular organisms → Bacteria1279Open in IMG/M
3300006871|Ga0075434_100003231All Organisms → cellular organisms → Bacteria14548Open in IMG/M
3300006918|Ga0079216_11303531All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermoflexia → Thermoflexales → Thermoflexaceae → Thermoflexus → Thermoflexus hugenholtzii593Open in IMG/M
3300006969|Ga0075419_10640819All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi749Open in IMG/M
3300006969|Ga0075419_11496969All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300007265|Ga0099794_10394222All Organisms → cellular organisms → Bacteria723Open in IMG/M
3300009012|Ga0066710_103081599All Organisms → cellular organisms → Bacteria645Open in IMG/M
3300009098|Ga0105245_11150955All Organisms → cellular organisms → Bacteria823Open in IMG/M
3300009098|Ga0105245_13131191All Organisms → cellular organisms → Bacteria513Open in IMG/M
3300009137|Ga0066709_100509298All Organisms → cellular organisms → Bacteria1697Open in IMG/M
3300009148|Ga0105243_11037610All Organisms → cellular organisms → Bacteria825Open in IMG/M
3300009148|Ga0105243_12157726All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium593Open in IMG/M
3300009156|Ga0111538_10402298All Organisms → cellular organisms → Bacteria1734Open in IMG/M
3300009156|Ga0111538_12441194All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium656Open in IMG/M
3300009176|Ga0105242_12683734All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300009553|Ga0105249_11745988All Organisms → cellular organisms → Bacteria695Open in IMG/M
3300009789|Ga0126307_11226177All Organisms → cellular organisms → Bacteria607Open in IMG/M
3300009840|Ga0126313_10001106All Organisms → cellular organisms → Bacteria13909Open in IMG/M
3300009868|Ga0130016_10622402All Organisms → cellular organisms → Bacteria669Open in IMG/M
3300009873|Ga0131077_10010021All Organisms → cellular organisms → Bacteria19065Open in IMG/M
3300010037|Ga0126304_10931427All Organisms → cellular organisms → Bacteria591Open in IMG/M
3300010362|Ga0126377_12001934All Organisms → cellular organisms → Bacteria655Open in IMG/M
3300010364|Ga0134066_10363564All Organisms → cellular organisms → Bacteria540Open in IMG/M
3300010366|Ga0126379_12976003All Organisms → cellular organisms → Bacteria567Open in IMG/M
3300010371|Ga0134125_10153848All Organisms → cellular organisms → Bacteria2562Open in IMG/M
3300010371|Ga0134125_11422689All Organisms → cellular organisms → Bacteria755Open in IMG/M
3300010371|Ga0134125_12160638All Organisms → cellular organisms → Bacteria605Open in IMG/M
3300010371|Ga0134125_13084006All Organisms → cellular organisms → Bacteria505Open in IMG/M
3300010379|Ga0136449_102869663All Organisms → cellular organisms → Bacteria678Open in IMG/M
3300010396|Ga0134126_10118338All Organisms → cellular organisms → Bacteria3240Open in IMG/M
3300010397|Ga0134124_12906275All Organisms → cellular organisms → Bacteria523Open in IMG/M
3300010399|Ga0134127_13330716All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300010401|Ga0134121_11008026All Organisms → cellular organisms → Bacteria818Open in IMG/M
3300011119|Ga0105246_12175102All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300011270|Ga0137391_10526147All Organisms → cellular organisms → Bacteria999Open in IMG/M
3300012045|Ga0136623_10058478All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1683Open in IMG/M
3300012184|Ga0136610_1106254All Organisms → cellular organisms → Bacteria987Open in IMG/M
3300012185|Ga0136619_10305244All Organisms → cellular organisms → Bacteria604Open in IMG/M
3300012198|Ga0137364_10588983Not Available838Open in IMG/M
3300012203|Ga0137399_11370585All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria593Open in IMG/M
3300012211|Ga0137377_10499305All Organisms → cellular organisms → Bacteria1155Open in IMG/M
3300012356|Ga0137371_10656787All Organisms → cellular organisms → Bacteria803Open in IMG/M
3300012515|Ga0157338_1055081All Organisms → cellular organisms → Bacteria582Open in IMG/M
3300012529|Ga0136630_1134120All Organisms → cellular organisms → Bacteria903Open in IMG/M
3300012684|Ga0136614_11110387All Organisms → cellular organisms → Bacteria540Open in IMG/M
3300012883|Ga0157281_1114102All Organisms → cellular organisms → Bacteria507Open in IMG/M
3300012897|Ga0157285_10018334All Organisms → cellular organisms → Bacteria1462Open in IMG/M
3300012902|Ga0157291_10068239All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium890Open in IMG/M
3300012903|Ga0157289_10031448All Organisms → cellular organisms → Bacteria1242Open in IMG/M
3300012906|Ga0157295_10083517All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium841Open in IMG/M
3300012910|Ga0157308_10394773All Organisms → cellular organisms → Bacteria535Open in IMG/M
3300012911|Ga0157301_10315956All Organisms → cellular organisms → Bacteria576Open in IMG/M
3300012955|Ga0164298_10204011All Organisms → cellular organisms → Bacteria1158Open in IMG/M
3300012958|Ga0164299_11281402All Organisms → cellular organisms → Bacteria559Open in IMG/M
3300012985|Ga0164308_10956183Not Available758Open in IMG/M
3300012985|Ga0164308_11280021All Organisms → cellular organisms → Bacteria665Open in IMG/M
3300012989|Ga0164305_11717058All Organisms → cellular organisms → Bacteria564Open in IMG/M
3300013102|Ga0157371_11356031All Organisms → cellular organisms → Bacteria551Open in IMG/M
3300013105|Ga0157369_10339553All Organisms → cellular organisms → Bacteria1560Open in IMG/M
3300013307|Ga0157372_10997579All Organisms → cellular organisms → Bacteria970Open in IMG/M
3300013308|Ga0157375_13280706All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300014265|Ga0075314_1112128All Organisms → cellular organisms → Bacteria600Open in IMG/M
3300014272|Ga0075327_1126011All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium787Open in IMG/M
3300014325|Ga0163163_11158036All Organisms → cellular organisms → Bacteria836Open in IMG/M
3300014325|Ga0163163_11850269All Organisms → cellular organisms → Bacteria664Open in IMG/M
3300014326|Ga0157380_12741615All Organisms → cellular organisms → Bacteria559Open in IMG/M
3300014745|Ga0157377_10243626All Organisms → cellular organisms → Bacteria1162Open in IMG/M
3300014969|Ga0157376_11952196All Organisms → cellular organisms → Bacteria624Open in IMG/M
3300014969|Ga0157376_12452455All Organisms → cellular organisms → Bacteria561Open in IMG/M
3300014969|Ga0157376_12476001All Organisms → cellular organisms → Bacteria559Open in IMG/M
3300015197|Ga0167638_1091467All Organisms → cellular organisms → Bacteria → Terrabacteria group → Candidatus Eremiobacterota → Candidatus Eremiobacteriia → Candidatus Eremiobacterales → Candidatus Eremiobacteraceae → Candidatus Eremiobacter → unclassified Candidatus Eremiobacter → Candidatus Eremiobacter sp. RRmetagenome_bin22594Open in IMG/M
3300015201|Ga0173478_10537769All Organisms → cellular organisms → Bacteria593Open in IMG/M
3300015264|Ga0137403_11134373All Organisms → cellular organisms → Bacteria628Open in IMG/M
3300015357|Ga0134072_10173270All Organisms → cellular organisms → Bacteria727Open in IMG/M
3300015371|Ga0132258_11068790All Organisms → cellular organisms → Bacteria2040Open in IMG/M
3300015372|Ga0132256_102234884All Organisms → cellular organisms → Bacteria651Open in IMG/M
3300015372|Ga0132256_102932867All Organisms → cellular organisms → Bacteria573Open in IMG/M
3300017787|Ga0183260_10385460All Organisms → cellular organisms → Bacteria934Open in IMG/M
3300017789|Ga0136617_10083211All Organisms → cellular organisms → Bacteria2788Open in IMG/M
3300017792|Ga0163161_11340571All Organisms → cellular organisms → Bacteria623Open in IMG/M
3300017965|Ga0190266_10125235All Organisms → cellular organisms → Bacteria1107Open in IMG/M
3300018053|Ga0184626_10444026All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300018072|Ga0184635_10145922All Organisms → cellular organisms → Bacteria944Open in IMG/M
3300018429|Ga0190272_12981376All Organisms → cellular organisms → Bacteria524Open in IMG/M
3300018432|Ga0190275_13024633All Organisms → cellular organisms → Bacteria544Open in IMG/M
3300018433|Ga0066667_11103003All Organisms → cellular organisms → Bacteria687Open in IMG/M
3300018465|Ga0190269_11177889All Organisms → cellular organisms → Bacteria599Open in IMG/M
3300018946|Ga0193599_1270070All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300019356|Ga0173481_10642641All Organisms → cellular organisms → Bacteria564Open in IMG/M
3300019867|Ga0193704_1091915All Organisms → cellular organisms → Bacteria541Open in IMG/M
3300020070|Ga0206356_10638129All Organisms → cellular organisms → Bacteria871Open in IMG/M
3300020150|Ga0187768_1074587All Organisms → cellular organisms → Bacteria764Open in IMG/M
3300021082|Ga0210380_10154609All Organisms → cellular organisms → Bacteria1030Open in IMG/M
3300021363|Ga0193699_10275792All Organisms → cellular organisms → Bacteria701Open in IMG/M
3300022883|Ga0247786_1046141All Organisms → cellular organisms → Bacteria876Open in IMG/M
3300022910|Ga0247768_1150501All Organisms → cellular organisms → Bacteria708Open in IMG/M
3300023064|Ga0247801_1055405All Organisms → cellular organisms → Bacteria613Open in IMG/M
3300023066|Ga0247793_1102900All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300025313|Ga0209431_10641070All Organisms → cellular organisms → Bacteria792Open in IMG/M
3300025314|Ga0209323_10046165All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2992Open in IMG/M
3300025474|Ga0208479_1042531All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria916Open in IMG/M
3300025796|Ga0210113_1071607All Organisms → cellular organisms → Bacteria692Open in IMG/M
3300025899|Ga0207642_10604986All Organisms → cellular organisms → Bacteria683Open in IMG/M
3300025904|Ga0207647_10166568All Organisms → cellular organisms → Bacteria1284Open in IMG/M
3300025908|Ga0207643_10084741All Organisms → cellular organisms → Bacteria1840Open in IMG/M
3300025912|Ga0207707_10157467Not Available1986Open in IMG/M
3300025919|Ga0207657_10901586All Organisms → cellular organisms → Bacteria681Open in IMG/M
3300025926|Ga0207659_10214005All Organisms → cellular organisms → Bacteria1546Open in IMG/M
3300025926|Ga0207659_11116498All Organisms → cellular organisms → Bacteria678Open in IMG/M
3300025932|Ga0207690_10817680All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Roseiarcaceae → Roseiarcus → Roseiarcus fermentans770Open in IMG/M
3300025932|Ga0207690_11348171All Organisms → cellular organisms → Bacteria596Open in IMG/M
3300025933|Ga0207706_10229280All Organisms → cellular organisms → Bacteria1625Open in IMG/M
3300025933|Ga0207706_11014414All Organisms → cellular organisms → Bacteria697Open in IMG/M
3300025935|Ga0207709_10812052All Organisms → cellular organisms → Bacteria755Open in IMG/M
3300025981|Ga0207640_10764372All Organisms → cellular organisms → Bacteria834Open in IMG/M
3300025981|Ga0207640_11990912All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300026075|Ga0207708_10206129All Organisms → cellular organisms → Bacteria1570Open in IMG/M
3300026075|Ga0207708_10931210All Organisms → cellular organisms → Bacteria753Open in IMG/M
3300026075|Ga0207708_11800920All Organisms → cellular organisms → Bacteria537Open in IMG/M
3300026078|Ga0207702_11079692All Organisms → cellular organisms → Bacteria796Open in IMG/M
3300026118|Ga0207675_100216054All Organisms → cellular organisms → Bacteria1846Open in IMG/M
3300026142|Ga0207698_11656974All Organisms → cellular organisms → Bacteria655Open in IMG/M
3300026295|Ga0209234_1234949Not Available602Open in IMG/M
3300026514|Ga0257168_1090197All Organisms → cellular organisms → Bacteria681Open in IMG/M
3300027384|Ga0209854_1053674Not Available696Open in IMG/M
3300027650|Ga0256866_1055021All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1056Open in IMG/M
3300027862|Ga0209701_10719899All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300027952|Ga0209889_1118663All Organisms → cellular organisms → Bacteria522Open in IMG/M
3300028563|Ga0265319_1030372All Organisms → cellular organisms → Bacteria1890Open in IMG/M
3300028578|Ga0272482_10131754All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria730Open in IMG/M
3300028587|Ga0247828_10978150All Organisms → cellular organisms → Bacteria551Open in IMG/M
3300028592|Ga0247822_10614926All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium871Open in IMG/M
3300028592|Ga0247822_10741799All Organisms → cellular organisms → Bacteria796Open in IMG/M
3300028596|Ga0247821_10424702All Organisms → cellular organisms → Bacteria834Open in IMG/M
3300028597|Ga0247820_11411778All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300028666|Ga0265336_10089897All Organisms → cellular organisms → Bacteria915Open in IMG/M
3300028717|Ga0307298_10127909All Organisms → cellular organisms → Bacteria731Open in IMG/M
3300028721|Ga0307315_10000654Not Available7923Open in IMG/M
3300028721|Ga0307315_10087988All Organisms → cellular organisms → Bacteria903Open in IMG/M
3300028778|Ga0307288_10160360All Organisms → cellular organisms → Bacteria851Open in IMG/M
3300028800|Ga0265338_10375885All Organisms → cellular organisms → Bacteria1017Open in IMG/M
3300028812|Ga0247825_10482991All Organisms → cellular organisms → Bacteria881Open in IMG/M
3300028812|Ga0247825_10832065All Organisms → cellular organisms → Bacteria667Open in IMG/M
3300028812|Ga0247825_11445483All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium504Open in IMG/M
3300028814|Ga0307302_10476857All Organisms → cellular organisms → Bacteria619Open in IMG/M
3300028881|Ga0307277_10069393All Organisms → cellular organisms → Bacteria1460Open in IMG/M
3300028889|Ga0247827_10250148All Organisms → cellular organisms → Bacteria1009Open in IMG/M
3300028889|Ga0247827_10277951All Organisms → cellular organisms → Bacteria966Open in IMG/M
3300030336|Ga0247826_10080699All Organisms → cellular organisms → Bacteria1951Open in IMG/M
3300030336|Ga0247826_10693763All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium789Open in IMG/M
3300030619|Ga0268386_10036772All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3870Open in IMG/M
3300031226|Ga0307497_10281823All Organisms → cellular organisms → Bacteria755Open in IMG/M
3300031228|Ga0299914_10275859All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1484Open in IMG/M
3300031228|Ga0299914_11053941All Organisms → cellular organisms → Bacteria660Open in IMG/M
3300031239|Ga0265328_10256626All Organisms → cellular organisms → Bacteria670Open in IMG/M
3300031548|Ga0307408_100779010All Organisms → cellular organisms → Bacteria866Open in IMG/M
3300031548|Ga0307408_101702442All Organisms → cellular organisms → Bacteria601Open in IMG/M
3300031562|Ga0310886_10487626All Organisms → cellular organisms → Bacteria742Open in IMG/M
3300031731|Ga0307405_10881036All Organisms → cellular organisms → Bacteria756Open in IMG/M
3300031908|Ga0310900_10162070All Organisms → cellular organisms → Bacteria1528Open in IMG/M
3300031908|Ga0310900_11331905All Organisms → cellular organisms → Bacteria601Open in IMG/M
3300031938|Ga0308175_100973637All Organisms → cellular organisms → Bacteria937Open in IMG/M
3300031965|Ga0326597_11253791All Organisms → cellular organisms → Bacteria728Open in IMG/M
3300031965|Ga0326597_11527035All Organisms → cellular organisms → Bacteria640Open in IMG/M
3300031995|Ga0307409_100056059All Organisms → cellular organisms → Bacteria3046Open in IMG/M
3300031995|Ga0307409_101446183All Organisms → cellular organisms → Bacteria714Open in IMG/M
3300031996|Ga0308176_10018920All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5112Open in IMG/M
3300032002|Ga0307416_100984250All Organisms → cellular organisms → Bacteria946Open in IMG/M
3300032002|Ga0307416_101896554All Organisms → cellular organisms → Bacteria699Open in IMG/M
3300032013|Ga0310906_11039643All Organisms → cellular organisms → Bacteria590Open in IMG/M
3300032143|Ga0315292_10204211All Organisms → cellular organisms → Bacteria1617Open in IMG/M
3300032177|Ga0315276_12637734All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300032205|Ga0307472_101802898All Organisms → cellular organisms → Bacteria608Open in IMG/M
3300032783|Ga0335079_10652293All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1105Open in IMG/M
3300032828|Ga0335080_10164013All Organisms → cellular organisms → Bacteria2456Open in IMG/M
3300032829|Ga0335070_10663120All Organisms → cellular organisms → Bacteria977Open in IMG/M
3300033550|Ga0247829_10601271All Organisms → cellular organisms → Bacteria914Open in IMG/M
3300033550|Ga0247829_11306123All Organisms → cellular organisms → Bacteria600Open in IMG/M
3300033550|Ga0247829_11531821All Organisms → cellular organisms → Bacteria550Open in IMG/M
3300033550|Ga0247829_11564739All Organisms → cellular organisms → Bacteria544Open in IMG/M
3300033551|Ga0247830_10057290All Organisms → cellular organisms → Bacteria2589Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil13.66%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil10.13%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil3.96%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere3.96%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil3.52%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil3.52%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand3.08%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere3.08%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere3.08%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.64%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.64%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.64%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere2.64%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.20%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.76%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.76%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.76%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere1.76%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.76%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil1.32%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.32%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil1.32%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.32%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.88%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.88%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.88%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.88%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.88%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.88%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.88%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.88%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand0.88%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.88%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.88%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.88%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.88%
WastewaterEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater0.88%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.44%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.44%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.44%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil0.44%
Ore Pile And Mine Drainage Contaminated SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Ore Pile And Mine Drainage Contaminated Soil0.44%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.44%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.44%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.44%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Soil0.44%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.44%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.44%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.44%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.44%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.44%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.44%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.44%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil0.44%
SoilEnvironmental → Terrestrial → Soil → Sand → Desert → Soil0.44%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.44%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.44%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.44%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.44%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.44%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.44%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.44%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.44%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.44%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2040502001Soil microbial communities from sample at FACE Site 2 North Carolina CO2+EnvironmentalOpen in IMG/M
2140918007Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active_allEnvironmentalOpen in IMG/M
2170459006Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect in plug lysis (for fosmid construction) 0-10cmEnvironmentalOpen in IMG/M
3300001526Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-5cm-1A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300001538Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-PF 4A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300003313Ore pile and mine drainage contaminated soil microbial communities from Mina do Sossego, Brazil - P3 sampleEnvironmentalOpen in IMG/M
3300004024Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D2EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005466Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaGEnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005539Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2Host-AssociatedOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300005937Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300005985Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2Host-AssociatedOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006918Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100EnvironmentalOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300007265Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009789Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28EnvironmentalOpen in IMG/M
3300009840Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105AEnvironmentalOpen in IMG/M
3300009868Activated sludge microbial diversity in wastewater treatment plant from Tai Wan - Bali plant Bali plantEngineeredOpen in IMG/M
3300009873Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Wenshan plantEngineeredOpen in IMG/M
3300010037Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010364Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300012045Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ449 (21.06)EnvironmentalOpen in IMG/M
3300012184Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ134 (22.06)EnvironmentalOpen in IMG/M
3300012185Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ353 (21.06)EnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012515Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610Host-AssociatedOpen in IMG/M
3300012529Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ568 (21.06)EnvironmentalOpen in IMG/M
3300012684Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ279 (21.06)EnvironmentalOpen in IMG/M
3300012883Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1EnvironmentalOpen in IMG/M
3300012897Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1EnvironmentalOpen in IMG/M
3300012902Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S169-409C-1EnvironmentalOpen in IMG/M
3300012903Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1EnvironmentalOpen in IMG/M
3300012906Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1EnvironmentalOpen in IMG/M
3300012910Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2EnvironmentalOpen in IMG/M
3300012911Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2EnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014265Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D2EnvironmentalOpen in IMG/M
3300014272Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailB_D1EnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015197Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G6B, Proglacial plain, adjacent to northern proglacial tributary)EnvironmentalOpen in IMG/M
3300015201Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2)EnvironmentalOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015357Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300017787Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ497 (22.06) (version 2)EnvironmentalOpen in IMG/M
3300017789Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ322 (21.06)EnvironmentalOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300017965Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 TEnvironmentalOpen in IMG/M
3300018053Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1EnvironmentalOpen in IMG/M
3300018072Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2EnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300018432Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 TEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018465Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 ISEnvironmentalOpen in IMG/M
3300018946Soil crust microbial communities from Colorado Plateau, Utah, USA - mid-late stage, 0 min after wetting v1EnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300019867Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m1EnvironmentalOpen in IMG/M
3300020070Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020150Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_20_MGEnvironmentalOpen in IMG/M
3300021082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redoEnvironmentalOpen in IMG/M
3300021363Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2EnvironmentalOpen in IMG/M
3300022883Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S066-202C-4EnvironmentalOpen in IMG/M
3300022910Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L016-104C-6EnvironmentalOpen in IMG/M
3300023064Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S001-104B-6EnvironmentalOpen in IMG/M
3300023066Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S223-509R-6EnvironmentalOpen in IMG/M
3300025313Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3 (SPAdes)EnvironmentalOpen in IMG/M
3300025314Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 2EnvironmentalOpen in IMG/M
3300025474Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-3 deep-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025796Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025904Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025908Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025919Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026295Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026514Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-BEnvironmentalOpen in IMG/M
3300027384Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_30_40 (SPAdes)EnvironmentalOpen in IMG/M
3300027650Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 HiSeqEnvironmentalOpen in IMG/M
3300027862Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027952Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10 (SPAdes)EnvironmentalOpen in IMG/M
3300028563Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaGHost-AssociatedOpen in IMG/M
3300028578Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT160D0EnvironmentalOpen in IMG/M
3300028587Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3EnvironmentalOpen in IMG/M
3300028592Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30EnvironmentalOpen in IMG/M
3300028596Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glycerol_Day14EnvironmentalOpen in IMG/M
3300028597Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day14EnvironmentalOpen in IMG/M
3300028666Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaGHost-AssociatedOpen in IMG/M
3300028717Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158EnvironmentalOpen in IMG/M
3300028721Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355EnvironmentalOpen in IMG/M
3300028778Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142EnvironmentalOpen in IMG/M
3300028800Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaGHost-AssociatedOpen in IMG/M
3300028812Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48EnvironmentalOpen in IMG/M
3300028814Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183EnvironmentalOpen in IMG/M
3300028881Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116EnvironmentalOpen in IMG/M
3300028889Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2EnvironmentalOpen in IMG/M
3300030336Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1EnvironmentalOpen in IMG/M
3300030619Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq)EnvironmentalOpen in IMG/M
3300031226Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_SEnvironmentalOpen in IMG/M
3300031228Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57EnvironmentalOpen in IMG/M
3300031239Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaGHost-AssociatedOpen in IMG/M
3300031548Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3Host-AssociatedOpen in IMG/M
3300031562Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3EnvironmentalOpen in IMG/M
3300031731Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1Host-AssociatedOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031965Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185EnvironmentalOpen in IMG/M
3300031995Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2Host-AssociatedOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032002Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3Host-AssociatedOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300032143Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0EnvironmentalOpen in IMG/M
3300032177Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300033550Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4EnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
FACENCE_3818602040502001SoilLAELELPEPLVLPLARFAEGLELFRRREALKVVLVP
A_all_C_006608502140918007SoilPELDLPEPLVLPLARFAEGLDLFRRHEALKVVFVP
L01_003231002170459006Grass SoilLPELELPEPTVLPLERFAEGLELFRARDAAKVVFVP
A105W1_152372913300001526PermafrostAASLLPELDLPEPLVLPLDRFPEGLDLFLRRETLKVVFVP*
A10PFW1_1145182113300001538PermafrostLLPELGLPEPVVLPLDRFAEGLDLFLRREALKVVFVP*
P32013IDBA_110284823300003313Ore Pile And Mine Drainage Contaminated SoilTPRHMEEATALLPDLDLPRPVVLPLERFAEGLELYRSGRALKVVFTP*
Ga0055436_1020367323300004024Natural And Restored WetlandsRHMHDAIALLPTLDLPTPTLMPLERFHDGLDLYRAGEALKVVFTP*
Ga0062593_10117487423300004114SoilAYMREALALLHDLDVPEPAVLPLERFAEGLELFLRRDALKVVFTP*
Ga0062589_10223051323300004156SoilLEEAVALLPELDLPAPTTFPLDRFAEGLAAYRSREALKVVFRP*
Ga0062590_10055899423300004157SoilATRRHMEEAVALLPELDLPEALVLPLERFDEGLAAYRRREALKVVFRP*
Ga0062590_10068082423300004157SoilATPRHMQEALELLPTLDLPEPQVLPLERFEEGLGLYRSGRAIKVVFTP*
Ga0063356_10558150223300004463Arabidopsis Thaliana RhizosphereMRAALELLPQLELPEPTVLPLERFDDGLALYRSGDALKVVFRP*
Ga0062595_10203999013300004479SoilQLMPEAVDLLGVLPLPEPTLLPLDRFAEGLELFRRRDVLKVVFTP*
Ga0062591_10140330813300004643SoilIHMEEAAALLPELDVPDPTVLPLERFAEGLDLYRRGEALKVVFTP*
Ga0062594_10037392013300005093SoilATPAYMDTAARLLPELELPEPAVLPLARFAEGLELYRRREQLKVVFVP*
Ga0062594_10106533223300005093SoilQDAVALLPQLDLPDPLVLPLERFDEGVAAYRDRQALKVVFRP*
Ga0062594_10211324023300005093SoilRRHMEEAVALLPELDLPEALVLPLERFDEGLAAYRRREALKVVFRP*
Ga0066388_10565950823300005332Tropical Forest SoilEAVALLHDLDVPEPVVLPLERFADGLELYRRHDATKIVFTT*
Ga0070689_10017337513300005340Switchgrass RhizosphereYMREALALLHDLDVPEPVVLPLERFAEGLESFLRRDALKVVFTP*
Ga0070671_10189004113300005355Switchgrass RhizosphereAVALLPELDVPEPTVLPLERFHEGLELYRSGEALKVVFTP*
Ga0070674_10125259713300005356Miscanthus RhizosphereHMQDAVALLPQLDLPDPLVLPLERFDEGVAAYRDRQALKVVFRP*
Ga0070709_1141739523300005434Corn, Switchgrass And Miscanthus RhizosphereTPSAMRAAAELLPRLDLPDPLVLPLERFDEGLALYRRGEALKVVFTP*
Ga0070714_10011928443300005435Agricultural SoilAAAELLPRLDLPDPLVLPLERFDEGLALYRRGEALKVVFTP*
Ga0070694_10076222523300005444Corn, Switchgrass And Miscanthus RhizosphereATPAYMRESLALLHDLEVPEPVVLPLERFAEGLELFLRRDALKVVFTP*
Ga0070662_10018866013300005457Corn RhizosphereVALLHDLDLPEPTVLPLERFAEGLELYRRRDATKVVFTT*
Ga0070685_1066911523300005466Switchgrass RhizosphereRSATPRHMREAAALLPELDVPEPTVLRLERFHEGLDLYRSGEALKVVFTP*
Ga0070685_1126347313300005466Switchgrass RhizosphereAAALLPELELPEPTVLPLDRFDEGLELYRAGKALKVVFTP*
Ga0070706_10171951613300005467Corn, Switchgrass And Miscanthus RhizospherePRHMEQAATLLPDLDLPRPIVLPLARFAEGLDLYRSGRALKVVFTP*
Ga0073909_1057856023300005526Surface SoilLHDLDVPEPVVLPLERFAERLELFLRRDALKVVFTP*
Ga0068853_10065784713300005539Corn RhizosphereEALALLHDLDVPEPVVLPLERFAEGLELFLRRDALKVVFTP*
Ga0070672_10076575013300005543Miscanthus RhizosphereTGSRSATRAHMEEAVALLPELDLPDPLVLPLERFDEGLAAYRNREALKVVFRP*
Ga0070686_10014655713300005544Switchgrass RhizosphereAYMREALALLHDLDVPEPVVLPLDRFREGLELFRSRDALKVVFTP*
Ga0066705_1093084813300005569SoilSATPAAMAEAARLLPELDVPEPVVLPLERFHEGLELYRSGEALKVVFTP*
Ga0068854_10176484813300005578Corn RhizosphereAMERAVALLPDLDVPEPEVLPLARFDEGLERYRRREALKVVFVP*
Ga0068854_10192230823300005578Corn RhizosphereAALDVLPTLDLPEPTVLALDRFDDGLALYRSGAVLKVVFRP*
Ga0068856_10208596113300005614Corn RhizosphereRHMREALALLSELDLPEPTILPLDRFDEGLELYRSSEALKVVFTP*
Ga0068861_10016179043300005719Switchgrass RhizospherePYMPEAVALLHDLDVPEPTVLLLERFAEGLELHRRRDALKVVFTL*
Ga0068861_10074497123300005719Switchgrass RhizosphereDLDVPEPVVLPLDRFREGLELFRSRDALKVVFTP*
Ga0068861_10271111323300005719Switchgrass RhizosphereALAEAVALLPELDLPAPTVLPLERFADGLELYRSGQALKVVFVP*
Ga0066903_10140386813300005764Tropical Forest SoilATPRHMEEAAALLPELEVPEPTVLPLERFAEGLELYRRGVALKVVFTP*
Ga0068862_10058131923300005844Switchgrass RhizosphereSAAPGYMPQAVSLLHELDVPEPVVLPLDRFAEGLELYRRRDALKVVFAP*
Ga0068862_10156526223300005844Switchgrass RhizosphereEAVALLHDLEVPEPTVLPLERFAEGLGLHRRRDATKVVFVP*
Ga0081455_1043494813300005937Tabebuia Heterophylla RhizosphereGLDPIPAVTLPLERFAEGLELYRAHEALKVVFTP*
Ga0081539_1021696013300005985Tabebuia Heterophylla RhizosphereRIDLPEPTVLPLDRFAHGLELYTSGRALKVVFTP*
Ga0068871_10198441923300006358Miscanthus RhizosphereELDVPEPTVLPLERFHEGLELYRSGEALKVVFTP*
Ga0075433_1036305633300006852Populus RhizosphereAARLLPELDVPAPTVLPLERFHKGLDLYRTGQALKVVFVP*
Ga0075434_10000323113300006871Populus RhizospherePAHLRQAVELLPALDPIETEVLPLERFAEGLERYRSGRALKVVFTP*
Ga0079216_1130353123300006918Agricultural SoilMAAAAALLPDLDLPEPTALPLVRFAEGLELYRSGRALKVVFVP*
Ga0075419_1064081923300006969Populus RhizosphereAEAVALLPGLDLPEPTVLPLERFAEGLELYRSGEALKVVFVP*
Ga0075419_1149696923300006969Populus RhizosphereLGARSATPAYMREALALLHDLEVPEPVVLPLERFAEGLELFLRRDTLKVVFTP*
Ga0099794_1039422223300007265Vadose Zone SoilLLPGLELPEPLVLPLERFADGLELFLHRKALKVVFVP*
Ga0066710_10308159933300009012Grasslands SoilSRSATKRHMEEAARLLPELDLPKPLVLPLDRFAEGLRRYRDGEVLKVVFTP
Ga0105245_1115095513300009098Miscanthus RhizosphereELELPEPAVLPLERFDEGLELYRSGEALKVVFTP*
Ga0105245_1313119113300009098Miscanthus RhizospherePAYMREALALLHDLDVPEPVVLPLERFAEGLESFLRRDALKVVFTP*
Ga0066709_10050929833300009137Grasslands SoilLLPELDLPEPVVLPLERFVEGLNLYRNGGAFKVVFTP*
Ga0105243_1103761023300009148Miscanthus RhizosphereALLPDLDLPEPLVLPLDRFEEGLAAYRNREALKVVFRP*
Ga0105243_1215772613300009148Miscanthus RhizosphereTPAHMPEAVALLHELPVPEPTVLPLERFAEGLALFRSRGAVKVVFTP*
Ga0111538_1040229833300009156Populus RhizosphereMTEAAALLDDLDVPEPVVLPLARFADGLDLFRRRDALKIVFTP*
Ga0111538_1244119423300009156Populus RhizosphereLHGLPVPEPTVLPLERFAEGLALFRSRGAVKVVFTP*
Ga0105242_1268373413300009176Miscanthus RhizosphereLLPELDLPEPLVLPLDRFDEGLAAYQNREALKVVFRP*
Ga0105249_1174598823300009553Switchgrass RhizosphereLPELDLPAPTVLPLERFADGLELYRSGQALKVVFVP*
Ga0126307_1122617723300009789Serpentine SoilPELQLPSPAVYPLAEFERGLDAYTRGEALKVVFTP*
Ga0126313_10001106153300009840Serpentine SoilMERAVSLLPRLDPPGPLVLPLERFTEGLERYRAHKALKVVFTP*
Ga0130016_1062240213300009868WastewaterIGVRSAAPALMQDALELLPSLDLPPATVLPLEHFAEGLELFRRRDALKVVFTP*
Ga0131077_1001002113300009873WastewaterPEALGLLHDLDVPEPVVLPLARFAEGLELHRRREALKVVFTP*
Ga0126304_1093142723300010037Serpentine SoilALALLAELELPEPTLLPLDRFQEGLELYRSGDALKVVFTP*
Ga0126377_1200193413300010362Tropical Forest SoilTPAAMRDAAALLPELDLPTPRVLPLERFEEGLGLFLRRDELKIVFTP*
Ga0134066_1036356423300010364Grasslands SoilATPSGMREAATLLSTLDLPPPVVLPLERFAEGLELFTSRRALKVVFTP*
Ga0126379_1297600323300010366Tropical Forest SoilAAMLLSELDVPEPTVLPLERFAEGLELFLSRRALKVVFTP*
Ga0134125_1015384843300010371Terrestrial SoilRHMREAAALLPELDVPEPTVLRLERFHEGLDLYRSGEALKVVFTP*
Ga0134125_1142268923300010371Terrestrial SoilAYMEEAVALLPELDLPEPLVLPLERFDEGLAAYRNREALKVVFRP*
Ga0134125_1216063813300010371Terrestrial SoilMRAAAALLPDFDVPEPTVLPLARFEEGLELFVRRQVLKVVFVP*
Ga0134125_1308400613300010371Terrestrial SoilAYMCEALALLHDLDVAEPVVLPLDRFREGLELFRSRDALKVVFTP*
Ga0136449_10286966313300010379Peatlands SoilATPASMETAAGLLPELDLPDPLVLPLERFAEGLARYRSGDAPKVVFTP*
Ga0134126_1011833813300010396Terrestrial SoilAAALLPELDVPEPTVLRLERFHEGLDLYRSGEALKVVFTP*
Ga0134124_1290627513300010397Terrestrial SoilPPYMPEAVALLQDLDVPEPTVLPLERFAEGLELYRRRDAAKVVFVP*
Ga0134127_1333071613300010399Terrestrial SoilAVALLPQLDLPDPLVLPLERFDEGVAAYRDRQALKVVFRP*
Ga0134121_1100802623300010401Terrestrial SoilMREAAALLPELDVPEPTVLRLERFHEGLDLYRSGEALKVVFTP*
Ga0105246_1217510213300011119Miscanthus RhizospherePELDVPDPTVLPLARFDEGLELYRSGEALKVVFTP*
Ga0137391_1052614723300011270Vadose Zone SoilAALLQDLEVPEPTVLPLDRFDEGLDLFVRRAALKVVFVP*
Ga0136623_1005847813300012045Polar Desert SandHMAEAAALLPELGLPAPTVLPLERFAEGLELYRSGRALKVVFSP*
Ga0136610_110625423300012184Polar Desert SandALLDRLELPEPTVLPLDRFDQGLELYRSGRALKVVFRP*
Ga0136619_1030524423300012185Polar Desert SandLDRLELPEPTVLPLDRFDQGLELYRSGRALKVVFRP*
Ga0137364_1058898313300012198Vadose Zone SoilMRAAAALLPGLDVPEPTVLPLDRFDEGLDLFLRRAALKV
Ga0137399_1137058513300012203Vadose Zone SoilVRAALLPALDLPEPLVLPLERFVEGLERYRSGEALKVVFTP*
Ga0137377_1049930513300012211Vadose Zone SoilAALLPALSLPEPLVLPLERFAEGLERYRGGEALKVVFPP*
Ga0137371_1065678723300012356Vadose Zone SoilMRAAAALLPELDLPTPVVLPLERFADGLELFRRRDALKVVFTP*
Ga0157338_105508113300012515Arabidopsis RhizosphereRHMRTALELMPELKLPEPTVLPLDRFEDGLALYRSGGALKVVFTP*
Ga0136630_113412023300012529Polar Desert SandEQAIGLLPELDLPPLDVMPLERFAEGLELYRSGRALKVVFRP*
Ga0136614_1111038723300012684Polar Desert SandMREAAALLPELDLPEPTVLPLERFDEGLELYRSGRA
Ga0157281_111410213300012883SoilLLPGLDLPAPTVLPLDRFAEGLELQRTRGAAKVVFVP*
Ga0157285_1001833433300012897SoilHTEEAVALLRELDLPEPLVLPLERFDEGLAAYRSREALKVVFRP*
Ga0157291_1006823933300012902SoilSAAPPYMPEAVALLHDLDVPEPTVLLLERFAEGLELHRRRDALKVVFTL*
Ga0157289_1003144813300012903SoilYMREALALLHDLDVPEPVVLPLDRFREGLELFRSRDALKVVFTP*
Ga0157295_1008351723300012906SoilVALLHDVDVPEPTVLLLERFAEGLEFHRRRDAIKVVFTL*
Ga0157308_1039477313300012910SoilLPTLDLPEPTVLALDRFDHGLALYRSGAVLKVVFRP*
Ga0157301_1031595623300012911SoilLLPTLDLPEPTVLPLAAFADWLALYRSGDALKVVFTP*
Ga0164298_1020401123300012955SoilVALLHDLEIPEPRVLPLERFGEGLGLYRRREAAKVVFTP*
Ga0164299_1128140223300012958SoilGVRSAAPQLMQEAVDLLHVLEVPTPTVVPLEHFHEGLARFRRRDALKVVFTP*
Ga0164308_1095618323300012985SoilMEEAAALLPHPDLPEPNVLPLERFADGLELYRSGDALKVVF
Ga0164308_1128002113300012985SoilMREALALLHDLDVPEPVVLPLERFAEGLELFLRRDALKVVFTP*
Ga0164305_1171705813300012989SoilPELDLPEPTVLPLERFNEGLDLYRRGEALKVVFTP*
Ga0157371_1135603113300013102Corn RhizospherePPYMPEAVALLHDLEIPEPRVLPLERFGEGLGLYRRREAAKVVFTP*
Ga0157369_1033955333300013105Corn RhizosphereAAMHAAAALLPELEVPEPVVLPLDRFAEGLELFTSRRALKVVFTP*
Ga0157372_1099757913300013307Corn RhizosphereEAVALLHDLDLPEPTVLPLERFAEGLELYRRRDATKVVFTT*
Ga0157375_1328070623300013308Miscanthus RhizosphereLPDLDLPEPLVLPLDRFEEGLAAYRNREALKVVFRP*
Ga0075314_111212813300014265Natural And Restored WetlandsLLPELDLPEPLVLPLERFGDGLERYRRREALKVVFTP*
Ga0075327_112601113300014272Natural And Restored WetlandsLDDLDVPEPTVLPLERFADGLELFRRRDALKVVFRP*
Ga0163163_1115803623300014325Switchgrass RhizosphereEAAALLHDLDVPEPRVLPLERFAEGLELHRRRDATKVVFVP*
Ga0163163_1185026923300014325Switchgrass RhizosphereLLHDLDVPEPVVLPLDRFAEGLELYRRRDALKVVFAP*
Ga0157380_1274161513300014326Switchgrass RhizosphereAVSLLPELDLPDPLVLPLERFDEGLAAYRNREALKVVFRP*
Ga0157377_1024362613300014745Miscanthus RhizosphereLLHDLEIPEPRVLPLERFGEGLGLYRRREAAKVVFTP*
Ga0157376_1195219623300014969Miscanthus RhizosphereAAPAYMPEAVSLLHDLDVPEPVVLPLDRFAEGLELYRRRDALKVVFAP*
Ga0157376_1245245513300014969Miscanthus RhizosphereTPRHMREAVALLPELDVPEPTVLPLERFHEGLELYRSGEALKVVFTP*
Ga0157376_1247600113300014969Miscanthus RhizosphereMQAALELLPELDLPEPTVLPLERFDEGLELYRSGGALKVVFAP*
Ga0167638_109146713300015197Glacier Forefield SoilALLPDLDVPEPTVLPLDRFQEGLELFRRRAALKVVFVP*
Ga0173478_1053776923300015201SoilDLDVPEPVVLPLDRFAEGLELFRRRDALKVVFTP*
Ga0137403_1113437323300015264Vadose Zone SoilAMRAAAALLPELDVPEPVVLPLERFAEGLELFTSRRALKVVFTP*
Ga0134072_1017327023300015357Grasslands SoilVRLLPELDLPEPVVLPLERFVEGLNLYRNGGAFKVVFTP*
Ga0132258_1106879043300015371Arabidopsis RhizosphereEAVALLPALDLPAPTVLPLERFAEGLELYRSGEALKVVFTP*
Ga0132256_10223488423300015372Arabidopsis RhizosphereLHMRDAVAFLPELDLPAPTVLPLERFAEGLERYRSGEALKVVFTP*
Ga0132256_10293286713300015372Arabidopsis RhizosphereTPSSMREALALLHDLDVPEPVVLPLERFTDGLELFRRRDALKVVFTP*
Ga0183260_1038546013300017787Polar Desert SandALLPELDLPEPTVLPLERFSEGLELYRAGEVLKVVFTP
Ga0136617_1008321153300017789Polar Desert SandEAAVALLPTLDLPEPVVLPLERIAEGLALYRERRALKVVLTP
Ga0163161_1134057123300017792Switchgrass RhizosphereYMCEALALLHDLDVAEPVVPPLDRFREGLELFRSRDALKVVFTP
Ga0190266_1012523523300017965SoilLLDDLDVPEPVVLPLARFADGLDLFRRRDALKVVFTP
Ga0184626_1044402623300018053Groundwater SedimentHMDAAAALLPHLDLPRPIVLPLARFAEGLDLYRSGRALKVVFTP
Ga0184635_1014592223300018072Groundwater SedimentHEAAVLLAEIEVPAPTVLPLERFDEGLDLYRSGAALKVVFTP
Ga0190272_1298137623300018429SoilRHMAEAAAILPELELPEPTVLPLDRFAEGLDLYRSGQALKVVFTP
Ga0190275_1302463313300018432SoilAAALLPKLELPRPTVLPLERFAEGLELYREGRALKVVFTP
Ga0066667_1110300323300018433Grasslands SoilLLPRLELPEPTVLPLERFDEGLDLYRRGEALKVVFTP
Ga0190269_1117788923300018465SoilTPRHMEAAAALLPELDLPRPIVLPLARFAEGLDLYRSGRALKVVFTP
Ga0193599_127007023300018946SoilAVRLLPKLDLPEPVVLPLERFDQGLELYRERRALKVVFTP
Ga0173481_1064264123300019356SoilPIHMEEAAALLPELDVPDPTVLPLERFDEGLDLYRRGEALKVVFTP
Ga0193704_109191513300019867SoilGSRSATRRHMEEAVALLRELDLPEPLVLPLERFDEGLAAYRSREALKVVFRP
Ga0206356_1063812913300020070Corn, Switchgrass And Miscanthus RhizosphereATPASMAAAAALLPELHVPAPTVLPLARFAEGLDLFTKRRALKVVFTP
Ga0187768_107458723300020150Tropical PeatlandESMHEAAALLPELDLPEPVVLPLVRFADGLDLFLRREALKVVFVP
Ga0210380_1015460913300021082Groundwater SedimentLLAEIEVPAPTVLPLERFDEGLDLYRSGAALKVVFTP
Ga0193699_1027579223300021363SoilRSATPESMRAAAALLLELELPEPVVLPLERFAEGLDLFLRREALKVVFVP
Ga0247786_104614113300022883SoilPGLDVPAPTVLPLDRFAEGLELQRTRSAAKVVFVP
Ga0247768_115050123300022910Plant LitterMREALALLHDLDVPEPVVLPLDRFREGLELFRSRDALKVVFTP
Ga0247801_105540523300023064SoilLLHDLDVPEPRVLPLERFAEGLELHRRRDATKVVFVP
Ga0247793_110290023300023066SoilTPAYMREALALLHDLDVPEPVVLPLDRFREGLELFRSRDALKVVFTP
Ga0209431_1064107013300025313SoilPAIAPLPATVLPLARFQEGLDLYRSHRALKVVFTP
Ga0209323_1004616573300025314SoilVELLTELDLPEPVVLPLERFAEGLELFRRREALKVVFVP
Ga0208479_104253113300025474Arctic Peat SoilMRAAVSLLPALDLPEPLVLPLARFAEGLDLFRRRETLKVVFVP
Ga0210113_107160723300025796Natural And Restored WetlandsRSATPETLAEAVALLPELDLPEPTVLPLERFADGLELYRSGEALKVVFEP
Ga0207642_1060498623300025899Miscanthus RhizosphereMREAVALLPELDVPEPTVLPLERFHEGLELYRSGEALKVVFTP
Ga0207647_1016656813300025904Corn RhizosphereAGARSATPAYMREALALLHDLDVPEPVVLPLDRFREGLELFRSRDALKVVFTP
Ga0207643_1008474133300025908Miscanthus RhizosphereMRAALGVLPTLDLPEPTVLALDRFEDGLALYRSGAALKVVFTP
Ga0207707_1015746743300025912Corn RhizosphereMAAAAALLPELHVPAPTVLPLARFAEGLDLFTKRRALKVVFTP
Ga0207657_1090158613300025919Corn RhizosphereSATPAAMGAAAALLPELDVPKPVVLPLDRFAEGLELFTSRRAFKVVFTP
Ga0207659_1021400513300025926Miscanthus RhizospherePIFALLHDLDVPEPVVLPLDRFREGLELFRSRDALKVVFTP
Ga0207659_1111649813300025926Miscanthus RhizospherePRHMKAAAALLPGLELPEPTVLPLERFEEGLDLYRRGEALKVVFTP
Ga0207690_1081768023300025932Corn RhizosphereAHMEEAVALLPELDVPEPLVLPLERFDEWLAAYRNREALKVVLTP
Ga0207690_1134817113300025932Corn RhizosphereVALLSALDLPEPLVLPLERFDEGLAAYRNREALKVVFRP
Ga0207706_1022928033300025933Corn RhizosphereSATRRHMEEAVALLPDLDLPEPLVLPLDRFDEGLAAYRNREALKVVFRP
Ga0207706_1101441423300025933Corn RhizospherePAYMREALALLHDLDVPEPVVLPLERFAEGLELFLRRDALKVVFTP
Ga0207709_1081205223300025935Miscanthus RhizosphereATRRHMEEAVAILPDLDLPEPLVLPLDRFDEGLAAYRNREALKVVFRP
Ga0207640_1076437223300025981Corn RhizosphereSATPAYMREALALLHDLEVPEPVVLPLERFAEGLELFLRRDALKVVFTP
Ga0207640_1199091213300025981Corn RhizosphereVALLPELDVPEPTVLPLERFHEGLELYRSGEALKVVFTP
Ga0207708_1020612913300026075Corn, Switchgrass And Miscanthus RhizosphereATPAYMREALALLHDLDVPEPVVLPLERFAEGLELFLRRDTLKVVFTP
Ga0207708_1093121013300026075Corn, Switchgrass And Miscanthus RhizosphereCSTTSVPEPRVLPLERFEEGLELYRRREAAKVVFTP
Ga0207708_1180092023300026075Corn, Switchgrass And Miscanthus RhizosphereLPELDLPAPTVLPLERFADGLELYRSGQALKVVFVP
Ga0207702_1107969213300026078Corn RhizosphereSLLPELDLPEPTVLQLERFQEGLELYRRGDALKVVFTP
Ga0207675_10021605433300026118Switchgrass RhizosphereATPEALAEAVALLPELDLPAPTVLPLERFADGLELYRSGQALKVVFVP
Ga0207698_1165697413300026142Corn RhizosphereVALLHDLEVPEPRVLPLERFEEGLELYRRREAAKVVFTP
Ga0209234_123494923300026295Grasslands SoilLPRLPELPVLRLALDRFEEGLGLYRSGAALKVVFEP
Ga0257168_109019723300026514SoilPESMAAAAGLLPELELPEPLVLPLERFAEGLELFQRREALKVVFVP
Ga0209854_105367423300027384Groundwater SandLPELEPIPAVTLPLERFADGLELYRSHEAVKVVFTP
Ga0256866_105502113300027650SoilALLPELDLPEPLVLPLERFSEGLERYRRREALKVVFTP
Ga0209701_1071989913300027862Vadose Zone SoilPEAMHAAAALLPELDVPEPTVLPLDRFDQGLDLFVRRAALKVVFVP
Ga0209889_111866323300027952Groundwater SandLPELDPIPTVTLPLERFADGLQLYRSHEAVKVVFTP
Ga0265319_103037233300028563RhizosphereVRSATEESMREAVALLPQLDIPEPLVLPLERFAEGLDLFLRREAFKVVFVP
Ga0272482_1013175423300028578SoilRSATPRHLAQAVALLPELDLPDPLVLPLERFSDGLERYRRREALKVVFTP
Ga0247828_1097815013300028587SoilSAAPHTMRKAVALLHDLEVPEPTVLPLERFAEGLALHRHRDATKVVFVR
Ga0247822_1061492613300028592SoilAHMPEAVALLHELPVPEPTVLPLERFAEGIALFRSRGALKVVLTP
Ga0247822_1074179923300028592SoilYMPEAVSLLHELDVPEPVVLPLDRFAEGLELYRRRDALKVVFAP
Ga0247821_1042470213300028596SoilSTPPYMPEAVALLHDLDLPEPTVLPLERFAEGLELYRRRDATKVVFTT
Ga0247820_1141177813300028597SoilSRSATRRTMEEAAQLLPELELPAPTVLPLERFAAGLELHRRRDALKVVFVR
Ga0265336_1008989723300028666RhizosphereMAAAVRLLPELEVPEPVVLPLERFAEGLELYRSGAALKVVFTP
Ga0307298_1012790923300028717SoilAVALLRELDLPEPLVLPLDRFDKGLAAYRNREALKVVFRP
Ga0307315_10000654123300028721SoilRSATPRHLEDAVALLPELELPEALVLPLERFAEGLAAYRSREALKVVFRP
Ga0307315_1008798823300028721SoilPRHLEEAVALLSALELPAPTSFPLDRFAEGLAAYRSREALKVVIRP
Ga0307288_1016036013300028778SoilRSATHRHMEEAVGLLRELDLPHPLVLPLDRFDEGLAAYRKREALKVVFLP
Ga0265338_1037588513300028800RhizospherePQLDIPEPLVLPLERFAEGLDLFLRREAFKVVFVP
Ga0247825_1048299123300028812SoilPTLDLPEPTVLALDRFEEGLELYRSGGALKVVFTP
Ga0247825_1083206523300028812SoilYMREALALLHDLDVPEPVVLPLERFAEGLELSLRRDALKVVFTP
Ga0247825_1144548323300028812SoilSYMPEALALLHDIDVPEPTVLPLERFAAGLELFRRRDALKVVFTP
Ga0307302_1047685713300028814SoilSRSSTPRHMEEAVALLPNLEVPRPIVLPLARFAEGLDLYRSGRALKVVFTP
Ga0307277_1006939313300028881SoilSATRLHMEEAVALLRELDLPEPLVLPLDRFDEGLAAYRNREAAKVVFRP
Ga0247827_1025014823300028889SoilLQRQDGRLRRVELGQEPTVLPLERFDEGLDLYRRGEALKVVFTP
Ga0247827_1027795113300028889SoilPGTTAPPYMPEAVALLHDLDVPEPTVLPLERFAEGLELYRRRDAAKVVFVP
Ga0247826_1008069913300030336SoilREALALLHDLDVPEPVVLPLERFAEGLELFLRRDTLKVVFTP
Ga0247826_1069376313300030336SoilAAMREAITLLPGLDPIPTVTLPLERFADGLDLYRSHEALKVVYTP
Ga0268386_1003677273300030619SoilPAAMHDAVALLPELEPIPTVTLPLERFAEGLELYRSHEAVKVVFTP
Ga0307497_1028182313300031226SoilAAPAYMPEAVSLLHDLDVPEPVVLPLDRFAEGLELYRRRDALKVVFAP
Ga0299914_1027585923300031228SoilWHLAEAVGLLPELDLPEPLVLPLERFAEGLERYRRREALKVVFTP
Ga0299914_1105394113300031228SoilLPELEPIPTVTLPLERFAEGLDLYRSHEAVKVVFTP
Ga0265328_1025662613300031239RhizosphereAAVSLLPELDLPEPLVLPLARFAEGLDLFRRREALKVVFVP
Ga0307408_10077901013300031548RhizosphereMEAALALLPRLELPEPTVLPLERFEEGLDLYRSGQALKVVFTP
Ga0307408_10170244223300031548RhizosphereLLPQLDVPEPTVLPLERFEEGLGLYRSGRALKVVYTP
Ga0310886_1048762613300031562SoilALALLHDLDVPEPVVLPLERFAEGLESFLRRDALKVVFTP
Ga0307405_1088103613300031731RhizosphereVALLRELDLPEPLVLPLERFDEGLAAYRNREALKVVFRP
Ga0310900_1016207013300031908SoilEQAVALLRELDLPEPLVLPLERFDEGLAAYRSREALKVVFRP
Ga0310900_1133190523300031908SoilATPAYMREALALLHDLDVPEPVVLPLERFAEGLELFLRHDALKVVFTP
Ga0308175_10097363713300031938SoilEAVELLPRLRLPQPLVLPLDRFDEGLAAYKSGAALKVVFTP
Ga0326597_1125379123300031965SoilAAALLPELDLPRAIVLPLERFAEGLDLYRSGRALKVVFTP
Ga0326597_1152703523300031965SoilRSGTPRHLREAVALLPVLDLPEPEVLPLERFAEGLERYRRGAALKVVFVP
Ga0307409_10005605913300031995RhizosphereTRRHMEEAVALLLELDLPAPLVLPLERFDEGLAAYRNREALKVVFRP
Ga0307409_10144618323300031995RhizosphereSPRHMHAALALLPELDLPAPTVLPLERFEEGLELYRSGGALKVVFTP
Ga0308176_1001892083300031996SoilLLRELELPEPLLLPLDRFDEGLAAYRNREAAKVVFRP
Ga0307416_10098425013300032002RhizosphereEALADAVALLPELEPIPTVTLPLDRFAEGLDLYRHHEAVKVVFTP
Ga0307416_10189655423300032002RhizosphereQAVGLLAELELPEPTVLPLDRFDDGLGLYRRGDALKVVYTP
Ga0310906_1103964323300032013SoilALLHNLDVPEPVVLPLERFAEGLELFLRRDALKVVFTP
Ga0315292_1020421113300032143SedimentRSGSPSHMARAVALLPELDVPEPTVLPLDRFAEALALHRSAVAIKVVLTP
Ga0315276_1263773413300032177SedimentPSHMARAVALLPDLDVPEPTVLPLDRFAEALALHRSAGAIKVVVTP
Ga0307472_10180289823300032205Hardwood Forest SoilPAVMEEAARLLPSLDVPEPTVLPLAQIGEGLRLYREGAALKVVLVP
Ga0335082_1090763923300032782SoilELLPSFVLPEVTTFPLERFDEGIELYRSGEALKVVFTP
Ga0335079_1065229313300032783SoilMREAVSILPGLELPEPIVLPLARFAEGLELHRRRRAPKV
Ga0335080_1016401353300032828SoilAALLPELELPALTVLPLERFDEGLELFRRRDAAKVVFVP
Ga0335070_1066312013300032829SoilRLLPGLDLPEPTVLPLERFAEGLELYRRREALKVVFVP
Ga0247829_1060127123300033550SoilLLPELELPEPTVLSLERFAEGLELYASRQAAKVVFVP
Ga0247829_1130612313300033550SoilHMEEAVALLRELDLPEPLVLPLDRFDEGLAAYRNREALKVVFRP
Ga0247829_1153182113300033550SoilALLDDLDVPEPVVLPLARFADGLDLFRRRDALKVVFTP
Ga0247829_1156473913300033550SoilPELDVPEPTVLPLERFDEGLDLYRRGEALKVVFTP
Ga0247830_1005729043300033551SoilARSAAPHTMREAAALLHDLDVPEPRVLPLERFAEGLELHRRRDATKVVFVP

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.