Basic Information | |
---|---|
Family ID | F019875 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 227 |
Average Sequence Length | 43 residues |
Representative Sequence | RGSGCDPTMAASLSSGWTGLMKAGFGLRLEVFFLVFGMEAD |
Number of Associated Samples | 175 |
Number of Associated Scaffolds | 227 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 97.80 % |
% of genes from short scaffolds (< 2000 bps) | 87.67 % |
Associated GOLD sequencing projects | 164 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.31 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (98.238 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (16.740 % of family members) |
Environment Ontology (ENVO) | Unclassified (29.956 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.220 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 49.28% β-sheet: 0.00% Coil/Unstructured: 50.72% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.31 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 227 Family Scaffolds |
---|---|---|
PF07228 | SpoIIE | 82.82 |
PF00275 | EPSP_synthase | 3.52 |
PF07521 | RMMBL | 1.32 |
PF02201 | SWIB | 0.44 |
PF13419 | HAD_2 | 0.44 |
PF02224 | Cytidylate_kin | 0.44 |
PF01906 | YbjQ_1 | 0.44 |
PF04679 | DNA_ligase_A_C | 0.44 |
PF01553 | Acyltransferase | 0.44 |
COG ID | Name | Functional Category | % Frequency in 227 Family Scaffolds |
---|---|---|---|
COG0283 | Cytidylate kinase | Nucleotide transport and metabolism [F] | 0.44 |
COG0393 | Uncharacterized pentameric protein YbjQ, UPF0145 family | Function unknown [S] | 0.44 |
COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 0.44 |
COG5531 | DNA-binding SWIB/MDM2 domain | Chromatin structure and dynamics [B] | 0.44 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 98.24 % |
Unclassified | root | N/A | 1.76 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2088090014|GPIPI_17164934 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1908 | Open in IMG/M |
2170459006|GBPF9FW01DHK68 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 539 | Open in IMG/M |
2170459006|GBPF9FW02JC97L | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 516 | Open in IMG/M |
2170459009|GA8DASG01EG7F5 | Not Available | 506 | Open in IMG/M |
2170459011|GI3SL7401CUJN8 | Not Available | 521 | Open in IMG/M |
2170459019|G14TP7Y02ILISD | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
2189573000|GPBTN7E01D86RN | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 509 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_100681862 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus | 3053 | Open in IMG/M |
3300000893|AP72_2010_repI_A001DRAFT_1045897 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 682 | Open in IMG/M |
3300004463|Ga0063356_106220874 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 512 | Open in IMG/M |
3300005146|Ga0066817_1008139 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 792 | Open in IMG/M |
3300005167|Ga0066672_10843562 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 572 | Open in IMG/M |
3300005175|Ga0066673_10219235 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1093 | Open in IMG/M |
3300005175|Ga0066673_10855037 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 518 | Open in IMG/M |
3300005176|Ga0066679_11034856 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 510 | Open in IMG/M |
3300005177|Ga0066690_10531567 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 789 | Open in IMG/M |
3300005184|Ga0066671_10003216 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 5637 | Open in IMG/M |
3300005187|Ga0066675_11303125 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 536 | Open in IMG/M |
3300005290|Ga0065712_10131646 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium | 1543 | Open in IMG/M |
3300005290|Ga0065712_10513501 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 641 | Open in IMG/M |
3300005294|Ga0065705_10605828 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 696 | Open in IMG/M |
3300005294|Ga0065705_11149745 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 512 | Open in IMG/M |
3300005328|Ga0070676_11309525 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 553 | Open in IMG/M |
3300005333|Ga0070677_10069482 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium | 1477 | Open in IMG/M |
3300005344|Ga0070661_101619722 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 547 | Open in IMG/M |
3300005364|Ga0070673_100821206 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 859 | Open in IMG/M |
3300005435|Ga0070714_100518369 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1138 | Open in IMG/M |
3300005450|Ga0066682_10152922 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium | 1469 | Open in IMG/M |
3300005454|Ga0066687_10136834 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium | 1281 | Open in IMG/M |
3300005467|Ga0070706_100042395 | All Organisms → cellular organisms → Bacteria | 4204 | Open in IMG/M |
3300005467|Ga0070706_100595563 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1027 | Open in IMG/M |
3300005553|Ga0066695_10124961 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium | 1590 | Open in IMG/M |
3300005554|Ga0066661_10312116 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 967 | Open in IMG/M |
3300005556|Ga0066707_10769156 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 597 | Open in IMG/M |
3300005557|Ga0066704_10948329 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 531 | Open in IMG/M |
3300005558|Ga0066698_10185432 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium | 1419 | Open in IMG/M |
3300005558|Ga0066698_10877310 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
3300005561|Ga0066699_10148224 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium | 1598 | Open in IMG/M |
3300005561|Ga0066699_10240077 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium | 1275 | Open in IMG/M |
3300005561|Ga0066699_10737243 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 699 | Open in IMG/M |
3300005568|Ga0066703_10079250 | All Organisms → cellular organisms → Bacteria | 1897 | Open in IMG/M |
3300005576|Ga0066708_10245205 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1137 | Open in IMG/M |
3300005586|Ga0066691_10000730 | All Organisms → cellular organisms → Bacteria | 11664 | Open in IMG/M |
3300005598|Ga0066706_10436973 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1042 | Open in IMG/M |
3300005764|Ga0066903_100263500 | All Organisms → cellular organisms → Bacteria | 2678 | Open in IMG/M |
3300005764|Ga0066903_101044475 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1499 | Open in IMG/M |
3300006046|Ga0066652_101308329 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 683 | Open in IMG/M |
3300006046|Ga0066652_101510308 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 622 | Open in IMG/M |
3300006175|Ga0070712_100103580 | All Organisms → cellular organisms → Bacteria | 2110 | Open in IMG/M |
3300006175|Ga0070712_100213758 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1522 | Open in IMG/M |
3300006176|Ga0070765_102081406 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 530 | Open in IMG/M |
3300006794|Ga0066658_10653828 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 576 | Open in IMG/M |
3300006800|Ga0066660_10002855 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae | 8056 | Open in IMG/M |
3300006903|Ga0075426_10453792 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 949 | Open in IMG/M |
3300009012|Ga0066710_100688243 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1558 | Open in IMG/M |
3300009012|Ga0066710_101483393 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1047 | Open in IMG/M |
3300009012|Ga0066710_102522435 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 742 | Open in IMG/M |
3300009090|Ga0099827_10644931 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium | 914 | Open in IMG/M |
3300009098|Ga0105245_11106238 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 839 | Open in IMG/M |
3300009137|Ga0066709_100203543 | All Organisms → cellular organisms → Bacteria | 2603 | Open in IMG/M |
3300009137|Ga0066709_100463840 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1775 | Open in IMG/M |
3300009137|Ga0066709_101262295 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1085 | Open in IMG/M |
3300009137|Ga0066709_102109194 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 779 | Open in IMG/M |
3300009137|Ga0066709_103736342 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 552 | Open in IMG/M |
3300009143|Ga0099792_10224829 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1080 | Open in IMG/M |
3300009156|Ga0111538_11102688 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1004 | Open in IMG/M |
3300009162|Ga0075423_10590642 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1170 | Open in IMG/M |
3300009162|Ga0075423_11859709 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 650 | Open in IMG/M |
3300009174|Ga0105241_11505066 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 648 | Open in IMG/M |
3300009662|Ga0105856_1270137 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium | 559 | Open in IMG/M |
3300010047|Ga0126382_10046260 | All Organisms → cellular organisms → Bacteria | 2516 | Open in IMG/M |
3300010047|Ga0126382_11043194 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 720 | Open in IMG/M |
3300010047|Ga0126382_11158397 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 689 | Open in IMG/M |
3300010048|Ga0126373_10308886 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1580 | Open in IMG/M |
3300010159|Ga0099796_10287826 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 693 | Open in IMG/M |
3300010304|Ga0134088_10318557 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 752 | Open in IMG/M |
3300010321|Ga0134067_10209791 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 719 | Open in IMG/M |
3300010326|Ga0134065_10003577 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 3872 | Open in IMG/M |
3300010333|Ga0134080_10020474 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 2450 | Open in IMG/M |
3300010337|Ga0134062_10577426 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 576 | Open in IMG/M |
3300010358|Ga0126370_11124943 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 725 | Open in IMG/M |
3300010359|Ga0126376_10453033 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1173 | Open in IMG/M |
3300010360|Ga0126372_10838097 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 915 | Open in IMG/M |
3300010361|Ga0126378_10438693 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1420 | Open in IMG/M |
3300010361|Ga0126378_12060528 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 650 | Open in IMG/M |
3300010362|Ga0126377_12665043 | Not Available | 575 | Open in IMG/M |
3300010362|Ga0126377_13061970 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 540 | Open in IMG/M |
3300010364|Ga0134066_10118967 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 792 | Open in IMG/M |
3300010366|Ga0126379_11106024 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 898 | Open in IMG/M |
3300010366|Ga0126379_11971500 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 687 | Open in IMG/M |
3300010376|Ga0126381_101886929 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 862 | Open in IMG/M |
3300010397|Ga0134124_10223518 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1720 | Open in IMG/M |
3300010398|Ga0126383_11634419 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 733 | Open in IMG/M |
3300010399|Ga0134127_11217237 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 820 | Open in IMG/M |
3300012189|Ga0137388_11852223 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 534 | Open in IMG/M |
3300012198|Ga0137364_10745434 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → unclassified Beijerinckiaceae → Beijerinckiaceae bacterium | 740 | Open in IMG/M |
3300012201|Ga0137365_10128637 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter | 1904 | Open in IMG/M |
3300012201|Ga0137365_10889507 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 650 | Open in IMG/M |
3300012202|Ga0137363_10515763 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1005 | Open in IMG/M |
3300012202|Ga0137363_10533843 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 987 | Open in IMG/M |
3300012202|Ga0137363_10654622 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 888 | Open in IMG/M |
3300012202|Ga0137363_11806779 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 504 | Open in IMG/M |
3300012204|Ga0137374_10130684 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 2286 | Open in IMG/M |
3300012206|Ga0137380_10314314 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium | 1401 | Open in IMG/M |
3300012207|Ga0137381_10948319 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 743 | Open in IMG/M |
3300012207|Ga0137381_11293663 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 622 | Open in IMG/M |
3300012207|Ga0137381_11631141 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 536 | Open in IMG/M |
3300012208|Ga0137376_10038934 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 3829 | Open in IMG/M |
3300012208|Ga0137376_11126921 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 671 | Open in IMG/M |
3300012210|Ga0137378_11317351 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 638 | Open in IMG/M |
3300012212|Ga0150985_102293806 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1105 | Open in IMG/M |
3300012285|Ga0137370_10056248 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 2124 | Open in IMG/M |
3300012285|Ga0137370_10330341 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 915 | Open in IMG/M |
3300012351|Ga0137386_10111713 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter | 1939 | Open in IMG/M |
3300012351|Ga0137386_10178564 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1523 | Open in IMG/M |
3300012355|Ga0137369_10465452 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 899 | Open in IMG/M |
3300012356|Ga0137371_10429806 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1023 | Open in IMG/M |
3300012359|Ga0137385_10838568 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium | 762 | Open in IMG/M |
3300012361|Ga0137360_11118613 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 680 | Open in IMG/M |
3300012678|Ga0136615_10387052 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 607 | Open in IMG/M |
3300012918|Ga0137396_10844245 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 673 | Open in IMG/M |
3300012924|Ga0137413_10887468 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 691 | Open in IMG/M |
3300012929|Ga0137404_10371117 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1256 | Open in IMG/M |
3300012929|Ga0137404_11191467 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 700 | Open in IMG/M |
3300012944|Ga0137410_11070753 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 689 | Open in IMG/M |
3300012948|Ga0126375_11973857 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 515 | Open in IMG/M |
3300012975|Ga0134110_10529673 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 539 | Open in IMG/M |
3300012976|Ga0134076_10254421 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 750 | Open in IMG/M |
3300012976|Ga0134076_10347127 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 652 | Open in IMG/M |
3300012987|Ga0164307_11333983 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 601 | Open in IMG/M |
3300012987|Ga0164307_11423905 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 584 | Open in IMG/M |
3300012988|Ga0164306_10978714 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 695 | Open in IMG/M |
3300012988|Ga0164306_11420989 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 591 | Open in IMG/M |
3300013296|Ga0157374_10933971 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 886 | Open in IMG/M |
3300013297|Ga0157378_10549261 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1160 | Open in IMG/M |
3300013297|Ga0157378_12418425 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 577 | Open in IMG/M |
3300013307|Ga0157372_10401924 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1596 | Open in IMG/M |
3300014156|Ga0181518_10055418 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 2357 | Open in IMG/M |
3300014157|Ga0134078_10052745 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium | 1413 | Open in IMG/M |
3300014157|Ga0134078_10120320 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1004 | Open in IMG/M |
3300014166|Ga0134079_10441449 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 615 | Open in IMG/M |
3300014325|Ga0163163_10401772 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1428 | Open in IMG/M |
3300014487|Ga0182000_10000620 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 6237 | Open in IMG/M |
3300014488|Ga0182001_10128206 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium | 833 | Open in IMG/M |
3300014968|Ga0157379_10504209 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1122 | Open in IMG/M |
3300014969|Ga0157376_11721323 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 662 | Open in IMG/M |
3300015199|Ga0167647_1114509 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 647 | Open in IMG/M |
3300015242|Ga0137412_10145053 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 1915 | Open in IMG/M |
3300015356|Ga0134073_10095467 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 871 | Open in IMG/M |
3300015372|Ga0132256_100249386 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 1843 | Open in IMG/M |
3300015372|Ga0132256_101071176 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium | 921 | Open in IMG/M |
3300015374|Ga0132255_100420828 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 1949 | Open in IMG/M |
3300015374|Ga0132255_106172715 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 507 | Open in IMG/M |
3300016294|Ga0182041_11485560 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 624 | Open in IMG/M |
3300016371|Ga0182034_10062370 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 2518 | Open in IMG/M |
3300016404|Ga0182037_10022918 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 3859 | Open in IMG/M |
3300016422|Ga0182039_10236625 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1479 | Open in IMG/M |
3300018027|Ga0184605_10272814 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 768 | Open in IMG/M |
3300018054|Ga0184621_10043445 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1480 | Open in IMG/M |
3300018072|Ga0184635_10063669 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium | 1434 | Open in IMG/M |
3300018072|Ga0184635_10190332 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 819 | Open in IMG/M |
3300018431|Ga0066655_10020056 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 3097 | Open in IMG/M |
3300018433|Ga0066667_11078687 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 694 | Open in IMG/M |
3300018468|Ga0066662_10792586 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 918 | Open in IMG/M |
3300018482|Ga0066669_11368965 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 641 | Open in IMG/M |
3300019789|Ga0137408_1116880 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1057 | Open in IMG/M |
3300019878|Ga0193715_1085639 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 650 | Open in IMG/M |
3300019879|Ga0193723_1003350 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 5722 | Open in IMG/M |
3300019996|Ga0193693_1063088 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 560 | Open in IMG/M |
3300020059|Ga0193745_1024759 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1316 | Open in IMG/M |
3300020062|Ga0193724_1005866 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 2643 | Open in IMG/M |
3300021080|Ga0210382_10147066 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1008 | Open in IMG/M |
3300021088|Ga0210404_10360112 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 809 | Open in IMG/M |
3300021413|Ga0193750_1039069 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1042 | Open in IMG/M |
3300024186|Ga0247688_1006629 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1621 | Open in IMG/M |
3300024279|Ga0247692_1009302 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1534 | Open in IMG/M |
3300025905|Ga0207685_10761886 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 531 | Open in IMG/M |
3300025907|Ga0207645_10172104 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1420 | Open in IMG/M |
3300025930|Ga0207701_10037214 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus | 4547 | Open in IMG/M |
3300025930|Ga0207701_10242703 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1574 | Open in IMG/M |
3300025931|Ga0207644_11617686 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 543 | Open in IMG/M |
3300025933|Ga0207706_10193619 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1784 | Open in IMG/M |
3300025938|Ga0207704_11385753 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 602 | Open in IMG/M |
3300026035|Ga0207703_12119121 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 538 | Open in IMG/M |
3300026217|Ga0209871_1059069 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 734 | Open in IMG/M |
3300026300|Ga0209027_1169604 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 723 | Open in IMG/M |
3300026300|Ga0209027_1229626 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 595 | Open in IMG/M |
3300026312|Ga0209153_1222372 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 630 | Open in IMG/M |
3300026317|Ga0209154_1141096 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1008 | Open in IMG/M |
3300026322|Ga0209687_1143000 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 770 | Open in IMG/M |
3300026322|Ga0209687_1224913 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 578 | Open in IMG/M |
3300026326|Ga0209801_1012041 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus | 4456 | Open in IMG/M |
3300026334|Ga0209377_1128105 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1006 | Open in IMG/M |
3300026342|Ga0209057_1194504 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
3300026527|Ga0209059_1048412 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1875 | Open in IMG/M |
3300026528|Ga0209378_1247893 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 565 | Open in IMG/M |
3300026530|Ga0209807_1131853 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 992 | Open in IMG/M |
3300026530|Ga0209807_1133891 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 979 | Open in IMG/M |
3300026536|Ga0209058_1085229 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium | 1644 | Open in IMG/M |
3300026920|Ga0208575_1005688 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1308 | Open in IMG/M |
3300027018|Ga0208475_1003649 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1499 | Open in IMG/M |
3300028536|Ga0137415_11059359 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 623 | Open in IMG/M |
3300028716|Ga0307311_10049888 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1111 | Open in IMG/M |
3300028807|Ga0307305_10126641 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1180 | Open in IMG/M |
3300030844|Ga0075377_10015687 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 673 | Open in IMG/M |
3300030844|Ga0075377_10024264 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 693 | Open in IMG/M |
3300030916|Ga0075386_12199840 | Not Available | 545 | Open in IMG/M |
3300030979|Ga0068589_11981035 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 839 | Open in IMG/M |
3300031057|Ga0170834_109528062 | All Organisms → cellular organisms → Bacteria | 1947 | Open in IMG/M |
3300031057|Ga0170834_109545783 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria | 21158 | Open in IMG/M |
3300031231|Ga0170824_101426685 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 506 | Open in IMG/M |
3300031231|Ga0170824_114982110 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2024 | Open in IMG/M |
3300031446|Ga0170820_17289982 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 649 | Open in IMG/M |
3300031446|Ga0170820_17792837 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 545 | Open in IMG/M |
3300031474|Ga0170818_104179059 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 552 | Open in IMG/M |
3300031716|Ga0310813_11885485 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 562 | Open in IMG/M |
3300031740|Ga0307468_101121410 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium | 703 | Open in IMG/M |
3300031820|Ga0307473_11117093 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 582 | Open in IMG/M |
3300031873|Ga0315297_10166453 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1801 | Open in IMG/M |
3300032174|Ga0307470_10357719 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1015 | Open in IMG/M |
3300032180|Ga0307471_100004270 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus | 8731 | Open in IMG/M |
3300032180|Ga0307471_100408914 | All Organisms → cellular organisms → Bacteria | 1486 | Open in IMG/M |
3300032180|Ga0307471_101838367 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 756 | Open in IMG/M |
3300032892|Ga0335081_12606673 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 519 | Open in IMG/M |
3300033412|Ga0310810_10134585 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus | 2897 | Open in IMG/M |
3300033412|Ga0310810_10172933 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria | 2479 | Open in IMG/M |
3300034030|Ga0334952_135977 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 530 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 16.74% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 15.42% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.05% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.61% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 6.17% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 5.73% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 3.52% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.08% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.64% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 2.20% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.20% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.76% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.76% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.76% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.76% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.32% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.32% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.32% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.88% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.88% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.88% |
Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.88% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.88% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.88% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.88% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.88% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.88% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.88% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.88% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.44% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.44% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.44% |
Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.44% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.44% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.44% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.44% |
Biocrust | Environmental → Terrestrial → Soil → Soil Crust → Unclassified → Biocrust | 0.44% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.44% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.44% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.44% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.44% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.44% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.44% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.44% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.44% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.44% |
Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.44% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2088090014 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
2170459006 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect in plug lysis (for fosmid construction) 0-10cm | Environmental | Open in IMG/M |
2170459009 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 indirect DNA Tissue lysis 0-10cm | Environmental | Open in IMG/M |
2170459011 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 indirect Gram positive lysis 0-10cm | Environmental | Open in IMG/M |
2170459019 | Litter degradation MG4 | Engineered | Open in IMG/M |
2189573000 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis 0-21cm (T0 for microcosms) | Environmental | Open in IMG/M |
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000893 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A001 | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300005146 | Soil and rhizosphere microbial communities from Laval, Canada - mgHAB | Environmental | Open in IMG/M |
3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Host-Associated | Open in IMG/M |
3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300009662 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-060 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012678 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ288 (22.06) | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300014156 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaG | Environmental | Open in IMG/M |
3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300014487 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG | Environmental | Open in IMG/M |
3300014488 | Bulk soil microbial communities from Mexico - San Felipe (SF) metaG | Environmental | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300015199 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-2c, rock/snow interface) | Environmental | Open in IMG/M |
3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300019878 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m2 | Environmental | Open in IMG/M |
3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
3300019996 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3a2 | Environmental | Open in IMG/M |
3300020059 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1a2 | Environmental | Open in IMG/M |
3300020062 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a1 | Environmental | Open in IMG/M |
3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021413 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c1 | Environmental | Open in IMG/M |
3300024186 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK29 | Environmental | Open in IMG/M |
3300024279 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK33 | Environmental | Open in IMG/M |
3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026217 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 (SPAdes) | Environmental | Open in IMG/M |
3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
3300026920 | Forest soil microbial communities from Willamette National Forest, Oregon, USA, amended with Nitrogen - NN397 (SPAdes) | Environmental | Open in IMG/M |
3300027018 | Grasslands soil microbial communities from Kansas, USA, that are Nitrogen fertilized - NN575 (SPAdes) | Environmental | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300028716 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198 | Environmental | Open in IMG/M |
3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
3300030844 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA11 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030916 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030979 | Forest soil microbial communities from France, for metatranscriptomics studies - Site 11 - Champenoux / Amance forest (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031873 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0 | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
3300034030 | Biocrust microbial communities from Mojave Desert, California, United States - 48SNC | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
GPIPI_01457610 | 2088090014 | Soil | XGSGCDPTMAASLSSGWTGLMKAGFGFRLEVFFLVFGMEFD |
L01_04834200 | 2170459006 | Grass Soil | GSGCDPTMAASLSSGWTGLMKAGFGLRLEVFFLVFGMEAD |
L01_07554790 | 2170459006 | Grass Soil | ERGSGCDPTMAASLSSGWTGLMKAGFGLRLGVFFLAFGMEFD |
F47_00833010 | 2170459009 | Grass Soil | VSSERGSGCDPTMAASLSSGWTGLMKAGFGLRLEVFFLVFGMEID |
F64_05880770 | 2170459011 | Grass Soil | SSERGSGCDPTMAASLSSGWTGLMKAGFGLRLEVFFLVFGMEFV |
4MG_01278360 | 2170459019 | Switchgrass, Maize And Mischanthus Litter | DPTMAASLSSGWTGLMKAGFGLRLEVFFLVFGMEAQ |
N55_06734920 | 2189573000 | Grass Soil | ERGSGFEPTMAESLSSGWTGRMNAAFGLRLDFLALVFGMTAH |
INPhiseqgaiiFebDRAFT_1006818625 | 3300000364 | Soil | GFEPTMAESLSSGWTGRMNAAFGLRLEEDFLALVLGMMAH* |
AP72_2010_repI_A001DRAFT_10458972 | 3300000893 | Forest Soil | SERGSGCDPTMAASLSSGWTGLMKAGFGLRLEVFFLVFGMEAD* |
Ga0063356_1062208741 | 3300004463 | Arabidopsis Thaliana Rhizosphere | SERGSGFEPTMAESLSSGWTGRMNAAFGLRLDFLALVFGMTAH* |
Ga0066817_10081392 | 3300005146 | Soil | RLLMYAQSFFVSSGRDSGCEPTTAESLSSGCTGFMKAGFGLRLEVFLVFGMDAD* |
Ga0066672_108435622 | 3300005167 | Soil | RGSGFEPTMAESFSSGWTGRMNAAFGLRLDFLALVFGMTAD* |
Ga0066673_102192351 | 3300005175 | Soil | SGFEPTMAESFSSGWTGRMNAAFGLRLEGLFLALVFGMTAD* |
Ga0066673_108550372 | 3300005175 | Soil | SERGSGFEPTMAESFSSGWTGRMNAAFGLRLDFLALVFGMTAD* |
Ga0066679_110348562 | 3300005176 | Soil | SGFEPTMAESFSSGWTGRMNAAFGLRLEELFLALVFGMIAD* |
Ga0066690_105315671 | 3300005177 | Soil | RGSGFEPTMAESFSSGWTGRMNAAFGLRLEELFLALVFGMIAD* |
Ga0066671_100032161 | 3300005184 | Soil | SSERGSGFEPTMAESFSSGWTGRMNAAFGLRLDFLALVFGMTAD* |
Ga0066675_113031252 | 3300005187 | Soil | GSGFEPTIADNLSSGCTGLMKAGFGLRFEGVFLVFGIEAD* |
Ga0065712_101316462 | 3300005290 | Miscanthus Rhizosphere | GSGFDPTMAESFSSGWTGRMNAAFGLRLDFLALVFGMIAD* |
Ga0065712_105135012 | 3300005290 | Miscanthus Rhizosphere | SGFDPTMAESFSSGWTGRMNAAFGLRLDFLALVFGMTAD* |
Ga0065705_106058281 | 3300005294 | Switchgrass Rhizosphere | GRDSGCEPTTAASLSSGWTGLMKAGFGLRLEVFLVFGMDAD* |
Ga0065705_111497451 | 3300005294 | Switchgrass Rhizosphere | GSGCDPTMAASLSSGWTGLMKAGFGLRLDVFFLVFGMEVD* |
Ga0070676_113095251 | 3300005328 | Miscanthus Rhizosphere | RGSGFEPTMAESLSSGWTGRMNAAFGLRLDFLALVFGMTAD* |
Ga0070677_100694821 | 3300005333 | Miscanthus Rhizosphere | ERGSGFEPTMAESLSSGWTGRMNAAFGLRLDFLALVFGMTAD* |
Ga0070661_1016197221 | 3300005344 | Corn Rhizosphere | SSGRDSGVEPTTAASLSSGWTGFMKAGFGLRLEVFLVFGMDAD* |
Ga0070673_1008212061 | 3300005364 | Switchgrass Rhizosphere | ERGIGFEPTTAANLSSGCTGRMKAGFGLRLEGVFLVVGIKAD* |
Ga0070714_1005183692 | 3300005435 | Agricultural Soil | AQSFFVSSGRDSGVEPTTAASLSSGWTGFMKAGFGLRFEVFLVFGMEAD* |
Ga0066682_101529222 | 3300005450 | Soil | GSGFEPTMAESFSSGWTGRMNAAFGLRLDFLALVFGMTAD* |
Ga0066687_101368342 | 3300005454 | Soil | SHNFFVSSERGSGFEPTMAESLSSGWTGRINAAFGLRLEEDFLALVFGIIAD* |
Ga0070706_1000423954 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | SGCDPTMAASLSSGWTGLMKAGFGLRLEVFFLVFGMEAD* |
Ga0070706_1005955632 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | SGCDPTMAASLSSGWTGLMKAGFGLRLEVFFLVFGMEADYRFA* |
Ga0066695_101249611 | 3300005553 | Soil | PTMAESFSSGWTGRMNAAFGLRLDFLALVFGMTAD* |
Ga0066661_103121161 | 3300005554 | Soil | TMAESFSSGWTGRMNAAFGLRLDFLALVFGMTAD* |
Ga0066707_107691561 | 3300005556 | Soil | TTAESLSSGWTGLMKAGFGLRLEVFFLVFGMDAD* |
Ga0066704_109483291 | 3300005557 | Soil | GFEPTMAESFSSGWTGRMNAAFGLRLDFLALVFGMTAD* |
Ga0066698_101854321 | 3300005558 | Soil | PTMAASLSSGWTGLMKAGFGLRLEVFFLVFGMEAD* |
Ga0066698_108773101 | 3300005558 | Soil | VSSERGSGWDPTMAASLSSGWTGLMKAGFSLRLEVFFLVFGMETD* |
Ga0066699_101482241 | 3300005561 | Soil | SSERGSGFEPTMAESFSSGWTGRMNAAFGLRLEGLFLALVFGMTAD* |
Ga0066699_102400772 | 3300005561 | Soil | NGADPTTAESLSSGWTGLMKAGFGLRLEVFFLVFGMDAD* |
Ga0066699_107372431 | 3300005561 | Soil | EPTMAESFSSGWTGRMNAAFGLRLDFLALVFGMTAD* |
Ga0066703_100792503 | 3300005568 | Soil | PTTAASLSSGWTGLMKAGFGLRLEVFLVFGMDAD* |
Ga0066708_102452052 | 3300005576 | Soil | GSGCDPTTAASLSSGWTGLMKAGFGLRLEVFFLVFGMQAD* |
Ga0066691_100007301 | 3300005586 | Soil | TMAASLSSGWTGLMKAGFGLRLEGVFLVFGIKAD* |
Ga0066706_104369732 | 3300005598 | Soil | LLMYAQSFFVSSGRDSGCDPTTAASLSSGWTGLMKAGFGLRLEVFLVFGMDAD* |
Ga0066903_1002635001 | 3300005764 | Tropical Forest Soil | SGRDSGCEPTTAASLSSGWTGLMKAGFGLRLEVFLVFGMEAD* |
Ga0066903_1010444751 | 3300005764 | Tropical Forest Soil | QSFFVSSERGSGAEPTTAASLSSGWTGLMKAGLGLRFEGVFLVFGIQAD* |
Ga0066652_1013083291 | 3300006046 | Soil | GFEPTIADNLSSGCTGLMKAGFGLRFEGVFLVFGIEAD* |
Ga0066652_1015103081 | 3300006046 | Soil | LMYAQSFFVSSGRDSGCEPTMAESLSSGWTGFMKAGFGLRVEVFLVFGMDAD* |
Ga0070712_1001035804 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | SGRDSGVEPTTAASLSSGWTGFMKAGFGLRLEVFLVFGMDAD* |
Ga0070712_1002137582 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | SGRDSGVEPTTAASLSSGWTGFMKAGFGLRLEVFLVFGMEAD* |
Ga0070765_1020814062 | 3300006176 | Soil | SSERGIGFEPTTAASLSSGCTGLMKAGFGLRLEGVFLVFGIEAD* |
Ga0066658_106538282 | 3300006794 | Soil | FEPTMAESFSSGWTGRMNAAFGLRLDFLALVFGMTAD* |
Ga0066660_100028551 | 3300006800 | Soil | CDPTMAASLSSGWTGLMKAGFGLRLEVFFLVFGMEAD* |
Ga0075426_104537921 | 3300006903 | Populus Rhizosphere | SFLVSSERGSGVEPTTAASLSSGWTGLMKAGFGLRFEGVLVFGIQGD* |
Ga0066710_1006882432 | 3300009012 | Grasslands Soil | SERGSGADPTTAASLSSGWTGLIKAGLGLRLEVFFFVFGMDAD |
Ga0066710_1014833931 | 3300009012 | Grasslands Soil | GCEPTTAASLSSGWTGLMKAGFGLRLEVFLVFGMDAD |
Ga0066710_1025224352 | 3300009012 | Grasslands Soil | DPTTAESLSSGWTGLMKAGFGLRLEVFFLVFGMDAD |
Ga0099827_106449311 | 3300009090 | Vadose Zone Soil | MESLSSGWTGLMKAALGLRFEGVFLALDFGIKAD* |
Ga0105245_111062382 | 3300009098 | Miscanthus Rhizosphere | ESGVEPTTAASLSSGWTGFMKAGFGLRLEVFLVFGMDAD* |
Ga0066709_1002035431 | 3300009137 | Grasslands Soil | VDPTIAESFSSGWTGLMKAGFGLRLEGFFLVFGMDAD* |
Ga0066709_1004638401 | 3300009137 | Grasslands Soil | TMAESFSSGWTGRMNAAFGLRLDFLALVFGMTAH* |
Ga0066709_1012622951 | 3300009137 | Grasslands Soil | ERGSGWEPTMAASLSSGLTGLMKAGFSLRLEVFFLVFAMEAD* |
Ga0066709_1021091941 | 3300009137 | Grasslands Soil | NGFEPTIRESLSSGWTGLMKAGLGLRFEGVLVFGIQAD* |
Ga0066709_1037363422 | 3300009137 | Grasslands Soil | AESFSSGWTGRMNAAFGLRLEELFFALVFGMTAD* |
Ga0099792_102248292 | 3300009143 | Vadose Zone Soil | FFLSCRPRLLMYAQSFFVSSGRDSGVEPTTAESLSSGWTGFMKAGFGLRLEVFLVFGMDAD* |
Ga0111538_111026881 | 3300009156 | Populus Rhizosphere | SGCEPTTAASLSSGWTGLMKAGFGLRLEVFLVFGMDAD* |
Ga0075423_105906422 | 3300009162 | Populus Rhizosphere | ERGSGFEPTMAESLSSGWTGRMNAAFGLRLDFLALVFGMTAH* |
Ga0075423_118597092 | 3300009162 | Populus Rhizosphere | DPTMAESLSSGWTGFMKAGFGLRLEVFLVFGMDAD* |
Ga0105241_115050662 | 3300009174 | Corn Rhizosphere | LMYAQSFFVSSGRDSGDDPTTAASLSSGWTGFMKAGFGLRLEVFLVFGMDAD* |
Ga0105856_12701372 | 3300009662 | Permafrost Soil | ERGSGREPTIAESFSSGCTGFMKAALGLRLEVVFLVLALGIDAD* |
Ga0126382_100462604 | 3300010047 | Tropical Forest Soil | SSGRDSGCDPTIAASLSSGWTGLMKAGFGLRLEVFLVFGMDAD* |
Ga0126382_110431942 | 3300010047 | Tropical Forest Soil | GCEPTMAASLSSGWTGLMKAGFGLRLEVFLVFGMDAD* |
Ga0126382_111583971 | 3300010047 | Tropical Forest Soil | GCDPTMAASLSSGWTGLMKAGFGLRLEVFFLVFGMEAD* |
Ga0126373_103088861 | 3300010048 | Tropical Forest Soil | AHSFFVSSGRDSGCEPTTAASLSSGWTGLMKAGFGLRLEVFLVFGMDGD* |
Ga0099796_102878261 | 3300010159 | Vadose Zone Soil | FFVSSGRDSGCEPTTAASLSSGWTGLMKAGFGLRLEVFLVFGMDAD* |
Ga0134088_103185571 | 3300010304 | Grasslands Soil | VSSERGSGCDPTMAESLSSGWTGLMKAGFGLRLEVFFLVFGMEAD* |
Ga0134067_102097911 | 3300010321 | Grasslands Soil | SFFVSSERGNGVDPTIAESFSSGWTGLMKAGFGLRLEGFFLVFGMEAD* |
Ga0134065_100035774 | 3300010326 | Grasslands Soil | DPTMAASLSSGWTGLMKAGFGLRLEVFFLVFGMEAD* |
Ga0134080_100204741 | 3300010333 | Grasslands Soil | DPTTAASLSSGWTGLMKAGFGLRLEVFFLVFGMEAD* |
Ga0134062_105774262 | 3300010337 | Grasslands Soil | RGSGCDPTMAASLSSGWTGLMKAGFGLRLEVFFLVFGMEAD* |
Ga0126370_111249432 | 3300010358 | Tropical Forest Soil | RPRLLMYAQSFFVSSGRDSGCEPTMAASLSSGWTGFMKAGFGLRLEVFLVFGMEAD* |
Ga0126376_104530331 | 3300010359 | Tropical Forest Soil | PTMAASLSSGWTGLMKAGFGLRLEVFLVFGMDAD* |
Ga0126372_108380971 | 3300010360 | Tropical Forest Soil | SGCEPTMAASLSSGWTGFMKAGFGLRLEVFLVFGMEAD* |
Ga0126378_104386932 | 3300010361 | Tropical Forest Soil | ERGSGCDPTMAASLSSGWTGLMKAGFGLRLEVFFLVFGMEAD* |
Ga0126378_120605282 | 3300010361 | Tropical Forest Soil | YAQSFFVSSGRDIGCEPTMAASLSSGWTGLMKAGFGLRLEVFLVFGMDGD* |
Ga0126377_126650432 | 3300010362 | Tropical Forest Soil | ERGSGCDPTMAASLSSGWTGLMKAGFGLRLEVFFLVFGIEAR* |
Ga0126377_130619701 | 3300010362 | Tropical Forest Soil | RLLMYAQSFFVSSGRESGCEPTMAASLSSGCTGFMKAGFGLRLEVFLVFGMEAD* |
Ga0134066_101189671 | 3300010364 | Grasslands Soil | ERGSGFEPTMAESLSSGWTGRMNAAFGLRFDFLALVFGMTAD* |
Ga0126379_111060242 | 3300010366 | Tropical Forest Soil | SGRDSGCEPTIAASLSSGWTGLMKAGFGLRLEVFLVFGMDAD* |
Ga0126379_119715001 | 3300010366 | Tropical Forest Soil | ILFFLSCRPRLLMYAQSFFVSAGRDSGCEPTTAASLSSGWTGFMNAGFGLRLEVFLVFGMEAD* |
Ga0126381_1018869292 | 3300010376 | Tropical Forest Soil | YAQSFFVSSGRESGCEPTMAASLSSGWTGFIKAGFGLRLEVFLVFGMDAD* |
Ga0134124_102235183 | 3300010397 | Terrestrial Soil | VSSGRDSGCEPTTAASLSSGWTGFMKAGFGLRLEVFLVYGMDAD* |
Ga0126383_116344192 | 3300010398 | Tropical Forest Soil | SERGSGAEPTTAASLSSGWTGLMKAGLGLRFEGAFLVFGIQAD* |
Ga0134127_112172371 | 3300010399 | Terrestrial Soil | YAQSFFVSSGRESGVEPTTAASLSSGWTGFMKAGFGLRLEVFLVFGMDAD* |
Ga0137388_118522232 | 3300012189 | Vadose Zone Soil | SERGNGFEPTIRESLSSGWTGLMKAGLGLRFEGVLFFGIQAD* |
Ga0137364_107454342 | 3300012198 | Vadose Zone Soil | GWDPTMAASLSSGWTDLMKAGFGLRLDFFFLVFGMEVD* |
Ga0137365_101286371 | 3300012201 | Vadose Zone Soil | TMAASLSSGWTGLMKAGFGLRLEGFFLVFGIEAD* |
Ga0137365_108895072 | 3300012201 | Vadose Zone Soil | FFLSCRPRLLMYAQSFFVSSGRDSGCEQTTAASLSYGWTGFMKEGNGLRLEVFLVFGMDAD* |
Ga0137363_105157631 | 3300012202 | Vadose Zone Soil | SERGSGFEPTMAESFSSGWTGRMNAAFGLRLDFLALVFGMIAD* |
Ga0137363_105338432 | 3300012202 | Vadose Zone Soil | FLVSSERGNGCDPTMAESLSSGWTGLMKAGFGLRLEGFFLVFGMEAD* |
Ga0137363_106546222 | 3300012202 | Vadose Zone Soil | TMAASLSSGWTGLMKAGFGLRLEVFFLVFGMEAD* |
Ga0137363_118067791 | 3300012202 | Vadose Zone Soil | VSSERGSGCDPTMAASLSSGWTGLMKAGFGLRLEVFFLVFGMEAD* |
Ga0137374_101306844 | 3300012204 | Vadose Zone Soil | GSGCDPTMAASLSSGWTGLMKAGFGLRLEVFFLVFGMEAD* |
Ga0137380_103143142 | 3300012206 | Vadose Zone Soil | GSGVDPTTAESLSSGWTGLMKAGFGLRLEVFFLVFGMDAD* |
Ga0137381_109483192 | 3300012207 | Vadose Zone Soil | RLLMYAQSFFVSSGRDSGCEPTTAASLSSGWTGLMKAGFGLRLEVFLVFGMDAD* |
Ga0137381_112936631 | 3300012207 | Vadose Zone Soil | SSERGSGCDPTTAASLSSGCTGLMNAGFGLRLEVFFLVFGMEAD* |
Ga0137381_116311411 | 3300012207 | Vadose Zone Soil | RGSGCDPTTAASLSSGWTGLMKAGFGLRLEVFFLVFGMEAD* |
Ga0137376_100389345 | 3300012208 | Vadose Zone Soil | RLLMYAQSFFVSSGRDSGCEPTMAESLSSGWTGFMKAGFGLRLEVFLVFGMDAD* |
Ga0137376_111269211 | 3300012208 | Vadose Zone Soil | EPTTAASLSSGWTGLMKAGFGLRLEVFLVFGMDAD* |
Ga0137378_113173511 | 3300012210 | Vadose Zone Soil | MYAQSFFVSSGRDSGCEPTTAASLSSGWTGLMKAGFGLRLEVFLVFGMDAD* |
Ga0150985_1022938061 | 3300012212 | Avena Fatua Rhizosphere | PRLLMYAQSFFVSSGRDSGCEPTMAESLSSGWTGLMKAGFGLRLEVFLVFGMDAD* |
Ga0137370_100562484 | 3300012285 | Vadose Zone Soil | RLLMYAQSFFVSSGRDSGCEPTMADSLSSGWTGFMKAGFGLRLEVFLVFGMDAD* |
Ga0137370_103303411 | 3300012285 | Vadose Zone Soil | QSFFVSSGRDSGCEPTTAASLSSGWTGLMKAGFGLRLEVFLVFGMDAD* |
Ga0137386_101117133 | 3300012351 | Vadose Zone Soil | CDPTTAASLSSGWTGLMKAGFGLRLEVFLVFGMDAD* |
Ga0137386_101785642 | 3300012351 | Vadose Zone Soil | GNGFEPTIAESFSSGWTGLMKAGLGLRFEGVLVFGIQAD* |
Ga0137369_104654522 | 3300012355 | Vadose Zone Soil | CDPTMAASLSSGWTGLMKAGFGLRLEVFFLVFGMQAD* |
Ga0137371_104298061 | 3300012356 | Vadose Zone Soil | CDPTTAASLSSGWTGLMKAGFGLRLEVFFLVFGMEAD* |
Ga0137385_108385681 | 3300012359 | Vadose Zone Soil | IMESLSSGWTGLMKAALGLRFEGVFLALDFGIKAD* |
Ga0137360_111186132 | 3300012361 | Vadose Zone Soil | GSGVDPTIAESFSSGWTGLMKAGFGLRLEGFFLVFGMDAD* |
Ga0136615_103870522 | 3300012678 | Polar Desert Sand | VSSERGSGFDPTIAESLSSGCTGFMKAAFGFRLEGLLAVVFGIEAD* |
Ga0137396_108442452 | 3300012918 | Vadose Zone Soil | YAQSFFVSSGRDSGVEPTTAESLSSGWTGFMKAGFGLRLEVFLVFGMDAD* |
Ga0137413_108874682 | 3300012924 | Vadose Zone Soil | FVSSGRDSGVEPTTAASLSTGWTGLMKAGFGLRLEVFLVFGMDAD* |
Ga0137404_103711172 | 3300012929 | Vadose Zone Soil | ERGNGCDPTMAESLSSGCTGLMKAGFGLRLEGFFLVFGMDAD* |
Ga0137404_111914671 | 3300012929 | Vadose Zone Soil | PTMAESLSSGWTGLMKAGFGLRLEVFFLVFGMEAD* |
Ga0137410_110707531 | 3300012944 | Vadose Zone Soil | IGCDPTTAASLSSGWTGLMKAGFGLRLEVFLVFGMDAD* |
Ga0126375_119738572 | 3300012948 | Tropical Forest Soil | GRDSGCDPTIAASLSSGWTGLMKAGFGLRLEVFLVFGMDAD* |
Ga0134110_105296732 | 3300012975 | Grasslands Soil | LLMYAQSFFVSSGRDSGCEPTMADSLSSGWTGFMKAGFGLRLEVFLVFGMDAD* |
Ga0134076_102544212 | 3300012976 | Grasslands Soil | FLVSSERGSGCDPTMAASLSSGWTGLMKAGFGLRLEGFFLVFGMEAD* |
Ga0134076_103471272 | 3300012976 | Grasslands Soil | DPTMAASLSSGWTGLMKAGFGLRLEGFFLVFGMEAD* |
Ga0164307_113339832 | 3300012987 | Soil | LMYAQSFFVSSGRDSGCDPTTAASLSSGWTGLMKAGFGLRLEVFLVFGMDAD* |
Ga0164307_114239051 | 3300012987 | Soil | YAQSFFVSSGRDSGVEPTTAESLSSGWTVFLKAGFGLRLEVFLVFGMEAD* |
Ga0164306_109787141 | 3300012988 | Soil | LLMYAQSFFVSSGRDSGCEPTTAASLSSGWTGLMKAGFGLRLEVFLVFGMDAD* |
Ga0164306_114209892 | 3300012988 | Soil | GRESGVEPTTAESLSSGWTGFMKAGFGLRLEVFLVFGMHAD* |
Ga0157374_109339712 | 3300013296 | Miscanthus Rhizosphere | SERGSGFDPTMAESFSSGWTGRMNAAFGLRLDFLALVFGMTAD* |
Ga0157378_105492612 | 3300013297 | Miscanthus Rhizosphere | SGCDPTMAASLSSGWTGLMKAGFGLRLEVFFLVFGMDAD* |
Ga0157378_124184252 | 3300013297 | Miscanthus Rhizosphere | YAQSFLVSSGRDSGVEPTTAASLSSGWTGFMKAGFGLRLEVFLVFGMEAD* |
Ga0157372_104019243 | 3300013307 | Corn Rhizosphere | YAQSFFVSSGRDSGVEPTTAASLSSGWTGFMKAGFGLRLEVFLVFGMHAD* |
Ga0181518_100554184 | 3300014156 | Bog | RGSGAAPTTLASLSSGWTGFMNAALGLRFDFVFVAMPVY* |
Ga0134078_100527452 | 3300014157 | Grasslands Soil | ERGSGFDPTMAESFSSGWTGRMNAAFGLRLDFLALVFGMTAH* |
Ga0134078_101203201 | 3300014157 | Grasslands Soil | TIAESFSSGWTGLMKAGFGLRLEGFFLVFGMDAD* |
Ga0134079_104414492 | 3300014166 | Grasslands Soil | SHSFFVSSERGSGFEPTMAESFSSGWTGRMNAAFGLRLDFLALVFGMTAD* |
Ga0163163_104017722 | 3300014325 | Switchgrass Rhizosphere | PTTAASLSSGWTGFMKAGFGLRLEVFLVFGMDAD* |
Ga0182000_100006208 | 3300014487 | Soil | LVSSERGSGFEPTTAASLSSGWTGLMKAAFGLRFEGVFLALVFGIKVD* |
Ga0182001_101282062 | 3300014488 | Soil | SERGSGFEPTTAESFSSGSTGLMKAAFGLRFEGVFLAVVFGIEAD* |
Ga0157379_105042092 | 3300014968 | Switchgrass Rhizosphere | RLLMYAQSFFVSSGRDSGCEPTTAASLSSGWTGFMKAGFGLRLEVFLVFGMDAD* |
Ga0157376_117213231 | 3300014969 | Miscanthus Rhizosphere | SGVEPTTAASLSSGWTGFMKAGFGLRLEVFLVFGMDAD* |
Ga0167647_11145092 | 3300015199 | Glacier Forefield Soil | LEPTIAESLSSGCTGLMKAAFGLRFEGVFLALVFGIEAD* |
Ga0137412_101450533 | 3300015242 | Vadose Zone Soil | MYAQSFFVSSGRDSGVEPTTAESLSSGWTGFMKAGFGLRLEVFLVFGMDAD* |
Ga0134073_100954671 | 3300015356 | Grasslands Soil | SSERGSGADPTTAASLSSGWTGLIKAGLGLRLEVFFFVFGMDAD* |
Ga0132256_1002493861 | 3300015372 | Arabidopsis Rhizosphere | PTMAESLSSGWTGRMNAAFGLRLDFLALVFGMTAD* |
Ga0132256_1010711762 | 3300015372 | Arabidopsis Rhizosphere | RGFEPTIAESLSSGCTGLMKAAFGLRFEGVLVVFGIRAD* |
Ga0132255_1004208283 | 3300015374 | Arabidopsis Rhizosphere | EPTMAESLSSGWTGFMKAGFGLRLEVFLVFGMDAD* |
Ga0132255_1061727151 | 3300015374 | Arabidopsis Rhizosphere | SSERGSGCDPTMAASLSSGWTGLMKAGFGLRLEVFLLLFGMKID* |
Ga0182041_114855601 | 3300016294 | Soil | RGSGFEPTMAESLSSGWTGRMNAAFGLRFDFLALVFGMTAD |
Ga0182034_100623702 | 3300016371 | Soil | MYAQSFFVSSGRDSGCEPTMAASLSSGWTGFMKAGFGLRLEVFLVFGMDAD |
Ga0182037_100229186 | 3300016404 | Soil | ADPTTAASLSSGWTGLMKAGFGLRLEVFFLVFGMDAD |
Ga0182039_102366252 | 3300016422 | Soil | MYAQSFFVSSGRDSGCEPTTAASLSSGWTGLMKAGFGLRLEVFLVFGMDAD |
Ga0184605_102728142 | 3300018027 | Groundwater Sediment | TAASLSSGCTGLMKAAFGLRFEGVFLALVFGIEAD |
Ga0184621_100434452 | 3300018054 | Groundwater Sediment | FQSFLVSSERGRGCDPTMAESLSSGWTGLMKAGFGLRLEVFFLVFGMEAD |
Ga0184635_100636692 | 3300018072 | Groundwater Sediment | PTMAESLSSGWTDLMKAGFGLRLEVFFLVFGMEAD |
Ga0184635_101903322 | 3300018072 | Groundwater Sediment | SGRDSGCEPTTAESLSSGWTGFMKAGFGLRLEVFLVFGMDAD |
Ga0066655_100200564 | 3300018431 | Grasslands Soil | CDPTMAASLSSGWTGLMKAGFGLRLEVFFLVFGMEAD |
Ga0066667_110786871 | 3300018433 | Grasslands Soil | PTMAESFSSGWTGRMNAAFGLRLDFLALVFGMTAD |
Ga0066662_107925862 | 3300018468 | Grasslands Soil | EPTMAASLSSGCTGLMKAGFGLRLEVFLVFGIEGD |
Ga0066669_113689652 | 3300018482 | Grasslands Soil | SGCEPTMAESLSSGWTGFMKAGFGLRLEVFLVFGMDAD |
Ga0137408_11168801 | 3300019789 | Vadose Zone Soil | NAAKRGNGFEPTIAESFSSGWTGLMKAGLGLRFEGVLVFGIQAD |
Ga0193715_10856391 | 3300019878 | Soil | SSGRDSGVEPTTAASLSSGWTGFMKAGFGLRLEVFLVFGMDAD |
Ga0193723_10033509 | 3300019879 | Soil | LVSSERGIGREPTTAANLSSGCTGRINAGFGLRLEGVFLVFGIKAD |
Ga0193693_10630881 | 3300019996 | Soil | VSSERGSGFDPTMAESFSSGWTGRMNAAFGLRLDFLALVFGMIAD |
Ga0193745_10247591 | 3300020059 | Soil | SGRDSGVEPTTAASLSSGWTGFMKAGFGLRLEVFLVFGMDAD |
Ga0193724_10058665 | 3300020062 | Soil | RGSGFEPTTMESLSSGWTGLMNAAFGLRLEGVLVFGIEAD |
Ga0210382_101470661 | 3300021080 | Groundwater Sediment | SSGRDIGCDPTTAASLSSGWTGLMKAGFGLRLEVFLVFGMDAD |
Ga0210404_103601122 | 3300021088 | Soil | ERGSGAEPTTAASLSSGWTGLMKAGLGLRFEGVLVFGIQAD |
Ga0193750_10390691 | 3300021413 | Soil | HSFFVSSERGIGFEPTMAESFSSGWTGRMNAAFGLRLDFLALVFGMTAD |
Ga0247688_10066291 | 3300024186 | Soil | RLLMYAQSFFVSSGRDSGVEPTTAASLSSGWTGFMKAGFGLRLEVFLVFGMEAD |
Ga0247692_10093021 | 3300024279 | Soil | VSSGRDSGVEPTTAASLSSGWTGFMKAGFGLRLEVFLVFGMDA |
Ga0207685_107618861 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | RGSGVDPTIAESFSSGWTGLMKAGFGLRLEGFFLVFGMDAD |
Ga0207645_101721042 | 3300025907 | Miscanthus Rhizosphere | PRLLMYAQSFLVSSGRDSGVEPTTAASLSSGWTGFMKAGFGLRLEVFLVFGMDAD |
Ga0207701_100372141 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | PRFLMYAQSFFVSSGRDSGVEPTTAASLSSGWTGFMKAGFGLRLEVFLVFGMDAD |
Ga0207701_102427033 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | PRFLMYAQSFFVSSGRDSGCEPTTAESLSSGWTGFMKAGFGLRLEVFLVFGMHAD |
Ga0207644_116176862 | 3300025931 | Switchgrass Rhizosphere | SSERGSGCDPTMAASLSSGWTGLMKAGFGLRLEVFFLVFGMEAD |
Ga0207706_101936193 | 3300025933 | Corn Rhizosphere | FVSSGRDSGVEPTTAASLSSGWTGFMKAGFGLRLEVFLVFGMDAD |
Ga0207704_113857532 | 3300025938 | Miscanthus Rhizosphere | SSERGSGFDPTMAESFSSGWTGRMNAAFGLRLDFLALVFGMIAD |
Ga0207703_121191211 | 3300026035 | Switchgrass Rhizosphere | RDSGVEPTTAASLSSGWTGFMKAGFGLRLEVFLVFGMDA |
Ga0209871_10590692 | 3300026217 | Permafrost Soil | FLVSSERGSGLEPTIAESFSSGCTGLMKAALGLRFEGVFLGFGIEAD |
Ga0209027_11696041 | 3300026300 | Grasslands Soil | SGFEPTTAASLSSGCTGLMKAAFGLRFEAVFLAVVFGIKVD |
Ga0209027_12296261 | 3300026300 | Grasslands Soil | ERGSGVDPTIAESFSSGWTGLMKAGFGLRLEGFFLVFGMDAD |
Ga0209153_12223721 | 3300026312 | Soil | EPTMAESFSSGWTGRMNAAFGLRLDFLALVFGMTAD |
Ga0209154_11410962 | 3300026317 | Soil | GFEPTMAESFSSGWTGRMNAAFGLRLDFLALVFGMTAD |
Ga0209687_11430002 | 3300026322 | Soil | GSGVDPTIAESFSSGWTGLIKAGFGLRLEGFFLVFGMDAD |
Ga0209687_12249132 | 3300026322 | Soil | GRDSGCDPTTAASLSSGWTGLMKAGFGLRLEVFLVFGMDAD |
Ga0209801_10120411 | 3300026326 | Soil | QSFLVSSERGSGCDPTTAASLSSGWTGLMKAGFGLRLEVFFLVFGMQAD |
Ga0209377_11281052 | 3300026334 | Soil | DPTMAESLSSGWTGLMKAGFGLRLEGFFLVFGMEAD |
Ga0209057_11945041 | 3300026342 | Soil | VSSERGSGWDPTMAESLSSGWTGLMKAGFSLRLEVFFLVFGMETD |
Ga0209059_10484124 | 3300026527 | Soil | FVSSERGSGFEPTMAESLSSGWTGRINAAFGLRLEEDFLALVFGIIAH |
Ga0209378_12478932 | 3300026528 | Soil | DPTMAESFSSGWTGRMNAAFGLRLDFLALVFGMTAD |
Ga0209807_11318531 | 3300026530 | Soil | VSSERGSGFEPTMAESFSSGWTGRMNAAFGLRLDFLALVFGMTAD |
Ga0209807_11338912 | 3300026530 | Soil | ERGSGFEPTMAESFSSGWTGRMNAAFGLRLDFLALVFGMTAD |
Ga0209058_10852291 | 3300026536 | Soil | DPTMAASLSSGWTGLMKAGFGLRLEVFFLVFGMEAD |
Ga0208575_10056881 | 3300026920 | Soil | FFVSSERGSGCDPTIAASLSSGWTGLMKAGFGLRLEVFFLVFGMEAD |
Ga0208475_10036492 | 3300027018 | Soil | GSGCDPTTAESLSSGWTGLMKAGFGLRLEVFFLVFGMEAD |
Ga0137415_110593592 | 3300028536 | Vadose Zone Soil | QSFLVSSERGSGFEPTTAASLSSGWTGLMKAAFGLRLEGVLVFGIKAD |
Ga0307311_100498881 | 3300028716 | Soil | GFDPTMAESFSSGWTGRMNAAFGLRLDFLALVFGMTAD |
Ga0307305_101266412 | 3300028807 | Soil | LMYAQSFFVSSGRDSGCEPTTAASLSSGWTGLMKAGFGLRLEVFLVFGMDAD |
Ga0075377_100156871 | 3300030844 | Soil | SSERGSGCDPTMAASLSSGWTGLMKAGFGLRLDVFFLAFGMEVD |
Ga0075377_100242642 | 3300030844 | Soil | RGSGCDPTMAASLSSGWTGLMKAGFGLRLDVFFLVFGMEVD |
Ga0075386_121998402 | 3300030916 | Soil | PTMAASLSSGWTGLMKAGFGLRLDVFFLVFGMEID |
Ga0068589_119810352 | 3300030979 | Soil | MPKAFFVSSGRDSGVEPTTAASLSSGWTGFMKAGFGLRLEVFLVFGMDAD |
Ga0170834_1095280623 | 3300031057 | Forest Soil | SERGSGCDPTMAASLSSGWTGLMKAGFGLRLEVFFLVFGMEFD |
Ga0170834_10954578323 | 3300031057 | Forest Soil | SERGSGCDPTMAASLSSGWTGLMKAGFGLRLEVFFLVFGMEAD |
Ga0170824_1014266852 | 3300031231 | Forest Soil | QSFLISSERGSGCDPTMAASLSSGWTGLMKAGFGLRLDVFFLVFGMEVD |
Ga0170824_1149821103 | 3300031231 | Forest Soil | SERGSGCDPTMAASLSSGWTGLMKAGFGLRLEVFFLVFGMEID |
Ga0170820_172899822 | 3300031446 | Forest Soil | GSGCDPTMAASLSSGWTGLMKAGFGLRLEVFFLVFGMEA |
Ga0170820_177928371 | 3300031446 | Forest Soil | GRESGVEPTTAESLSSGWTGFMKAGFGLRLEVFFGFRHGR |
Ga0170818_1041790591 | 3300031474 | Forest Soil | GSGWDPTMAASLSSGWTGIMKAGFGLRLEVFFLVFRMEVY |
Ga0310813_118854851 | 3300031716 | Soil | SSGRDSGVEPTTAASLSSGWTGFMKAGFGLRLEVFLVFGMHAD |
Ga0307468_1011214101 | 3300031740 | Hardwood Forest Soil | MAASLSSGCTGFIKAAFGLRFEDVFLAVVLGIEAD |
Ga0307473_111170931 | 3300031820 | Hardwood Forest Soil | RGSGFEPTTAASLSSGWTGLIKAGLGLRFEVFLVFGILGDYRLAC |
Ga0315297_101664534 | 3300031873 | Sediment | RGSGLEPTIAESFSSGCTGFMKAAFGLRFEGVFLGFGI |
Ga0307470_103577191 | 3300032174 | Hardwood Forest Soil | SSERGSGFEPTMAESFSSGWTGRMNAAFGLRLDFLALVFGMIAD |
Ga0307471_1000042701 | 3300032180 | Hardwood Forest Soil | PTMAASLSSGWTGLMKAGFGLRLEVFFLVFGMEAD |
Ga0307471_1004089143 | 3300032180 | Hardwood Forest Soil | FQSFLVSSERDSGCDPTMAASLSSGWTGLMKAGFGLRLEVFFLVFGMEFD |
Ga0307471_1018383672 | 3300032180 | Hardwood Forest Soil | VSSERGNGFEPTIAASLSSGWTGLMKAGLGLRFEGVLSFGIQAD |
Ga0335081_126066732 | 3300032892 | Soil | LVSSERGSGVEPTTAASLSSGWTGLMKAGFGLRFEGVLVFGIQAD |
Ga0310810_101345851 | 3300033412 | Soil | VSSERGSGFDPTMAESFSSGWTGRMNAAFGLRLDFLALVFGMTAD |
Ga0310810_101729332 | 3300033412 | Soil | MYAQSFFVSSGRDSGDDPTTAASLSSGWTGFMKAGFGLRLEVFLVFGMDAD |
Ga0334952_135977_17_136 | 3300034030 | Biocrust | LEPTISESFSSGCTGRMNAAFGLRVEDFLEEVVFGIEAD |
⦗Top⦘ |