Metagenome / Metatranscriptome Family F019940

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F019940
Family Type	Metagenome / Metatranscriptome
Number of Sequences	226
Average Sequence Length	40 residues
Representative Sequence	FMYDGRDKNTNSQTNSSTKHILNTYGGVMQNEIYCN
Number of Associated Samples	114
Number of Associated Scaffolds	226

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	0.46 %
% of genes near scaffold ends (potentially truncated)	82.74 %
% of genes from short scaffolds (< 2000 bps)	96.02 %
Associated GOLD sequencing projects	113
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.33

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Unclassified (83.186 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere (83.186 % of family members)
Environment Ontology (ENVO)	Unclassified (95.575 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant surface (74.336 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	Yes	Secondary Structure distribution:	α-helix: 46.88% β-sheet: 0.00% Coil/Unstructured: 53.12%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.33
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.33
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 226 Family Scaffolds
PF00931	NB-ARC	1.77
PF00450	Peptidase_S10	0.44
PF13966	zf-RVT	0.44
PF13540	RCC1_2	0.44
PF02896	PEP-utilizers_C	0.44
PF03107	C1_2	0.44
PF00067	p450	0.44

COG ID	Name	Functional Category	% Frequency in 226 Family Scaffolds
COG2124	Cytochrome P450	Defense mechanisms [V]	0.44
COG2939	Carboxypeptidase C (cathepsin A)	Amino acid transport and metabolism [E]	0.44

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	83.19 %
All Organisms	root	All Organisms	16.81 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	83.19 %
cellular organisms	root	All Organisms → cellular organisms	16.81 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	83.19 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	16.81 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	83.19 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	16.81 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	83.19 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	16.81 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	83.19 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	16.37 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	83.19 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	16.37 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	83.19 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	10.18 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	83.19 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	10.18 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	83.19 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	10.18 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	83.19 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	10.18 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	83.19 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	10.18 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	83.19 %
Liliopsida	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida	10.18 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	83.19 %
Petrosaviidae	subclass	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae	10.18 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	83.19 %
commelinids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids	10.18 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	83.19 %
Poales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales	10.18 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	83.19 %
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	10.18 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	83.19 %
PACMAD clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade	8.85 %
BOP clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade	0.44 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	83.19 %
Panicoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	7.52 %
Arundinoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae	1.33 %
Oryzoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae	0.44 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	83.19 %
Panicodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae	4.87 %
Andropogonodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae	1.33 %
Arundineae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae	1.33 %
Oryzeae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae	0.44 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	83.19 %
Paniceae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	4.87 %
Arundo	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo	1.33 %
Andropogoneae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	1.33 %
Oryzinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae	0.44 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	83.19 %
Panicinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae	3.54 %
Saccharinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae	1.33 %
Arundo donax	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax	1.33 %
Dichantheliinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Dichantheliinae	0.88 %
Oryzinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae	0.44 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	83.19 %
Panicum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	3.54 %
Miscanthus	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus	1.33 %
Arundo donax	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax	1.33 %
Dichanthelium	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Dichantheliinae → Dichanthelium	0.88 %
Oryzinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae	0.44 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	83.19 %
Panicum sect. Hiantes	section	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes	3.10 %
Miscanthus lutarioriparius	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	1.33 %
Arundo donax	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax	1.33 %
Dichanthelium oligosanthes	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Dichantheliinae → Dichanthelium → Dichanthelium oligosanthes	0.88 %
Panicum miliaceum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	0.44 %
Oryzinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae	0.44 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	83.19 %
Panicum virgatum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	3.10 %
Miscanthus lutarioriparius	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	1.33 %
Arundo donax	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax	1.33 %
Dichanthelium oligosanthes	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Dichantheliinae → Dichanthelium → Dichanthelium oligosanthes	0.88 %
Panicum miliaceum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	0.44 %
Oryzinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae	0.44 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300005719\|Ga0068861_102084983	Not Available	567	Open in IMG/M
3300005842\|Ga0068858_102341495	Not Available	528	Open in IMG/M
3300005843\|Ga0068860_102606788	Not Available	525	Open in IMG/M
3300009101\|Ga0105247_11826746	Not Available	506	Open in IMG/M
3300009981\|Ga0105133_114429	Not Available	642	Open in IMG/M
3300009990\|Ga0105132_112427	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	744	Open in IMG/M
3300010373\|Ga0134128_12810266	Not Available	536	Open in IMG/M
3300010399\|Ga0134127_13549780	Not Available	511	Open in IMG/M
3300010403\|Ga0134123_13165002	Not Available	529	Open in IMG/M
3300014325\|Ga0163163_12985092	Not Available	528	Open in IMG/M
3300014968\|Ga0157379_12132650	Not Available	556	Open in IMG/M
3300015270\|Ga0182183_1047572	Not Available	628	Open in IMG/M
3300015278\|Ga0182099_1052242	Not Available	557	Open in IMG/M
3300015280\|Ga0182100_1055288	Not Available	618	Open in IMG/M
3300015284\|Ga0182101_1026945	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	773	Open in IMG/M
3300015284\|Ga0182101_1065874	Not Available	583	Open in IMG/M
3300015290\|Ga0182105_1054130	Not Available	642	Open in IMG/M
3300015293\|Ga0182103_1044710	Not Available	662	Open in IMG/M
3300015293\|Ga0182103_1089510	Not Available	530	Open in IMG/M
3300015297\|Ga0182104_1032160	Not Available	789	Open in IMG/M
3300015297\|Ga0182104_1033254	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	781	Open in IMG/M
3300015297\|Ga0182104_1082664	Not Available	578	Open in IMG/M
3300015301\|Ga0182184_1058295	Not Available	608	Open in IMG/M
3300015301\|Ga0182184_1062513	Not Available	594	Open in IMG/M
3300015306\|Ga0182180_1087079	Not Available	519	Open in IMG/M
3300015309\|Ga0182098_1069118	Not Available	626	Open in IMG/M
3300015309\|Ga0182098_1099367	Not Available	552	Open in IMG/M
3300015309\|Ga0182098_1105408	Not Available	540	Open in IMG/M
3300015309\|Ga0182098_1125012	Not Available	507	Open in IMG/M
3300015310\|Ga0182162_1044804	Not Available	737	Open in IMG/M
3300015310\|Ga0182162_1051189	Not Available	705	Open in IMG/M
3300015310\|Ga0182162_1112424	Not Available	531	Open in IMG/M
3300015311\|Ga0182182_1078408	Not Available	592	Open in IMG/M
3300015312\|Ga0182168_1016388	Not Available	1043	Open in IMG/M
3300015312\|Ga0182168_1044063	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	766	Open in IMG/M
3300015312\|Ga0182168_1093970	Not Available	584	Open in IMG/M
3300015312\|Ga0182168_1129557	Not Available	514	Open in IMG/M
3300015312\|Ga0182168_1131597	Not Available	511	Open in IMG/M
3300015313\|Ga0182164_1054840	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	709	Open in IMG/M
3300015313\|Ga0182164_1095497	Not Available	580	Open in IMG/M
3300015313\|Ga0182164_1100583	Not Available	569	Open in IMG/M
3300015313\|Ga0182164_1104106	Not Available	561	Open in IMG/M
3300015313\|Ga0182164_1135263	Not Available	505	Open in IMG/M
3300015315\|Ga0182120_1038735	Not Available	805	Open in IMG/M
3300015316\|Ga0182121_1080271	Not Available	642	Open in IMG/M
3300015317\|Ga0182136_1035390	Not Available	829	Open in IMG/M
3300015317\|Ga0182136_1080057	Not Available	626	Open in IMG/M
3300015318\|Ga0182181_1026186	Not Available	829	Open in IMG/M
3300015318\|Ga0182181_1048970	Not Available	676	Open in IMG/M
3300015318\|Ga0182181_1083329	Not Available	565	Open in IMG/M
3300015320\|Ga0182165_1143567	Not Available	508	Open in IMG/M
3300015325\|Ga0182148_1009744	Not Available	1220	Open in IMG/M
3300015325\|Ga0182148_1119019	Not Available	545	Open in IMG/M
3300015326\|Ga0182166_1015599	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	1056	Open in IMG/M
3300015326\|Ga0182166_1038808	Not Available	806	Open in IMG/M
3300015327\|Ga0182114_1135206	Not Available	543	Open in IMG/M
3300015327\|Ga0182114_1138733	Not Available	537	Open in IMG/M
3300015327\|Ga0182114_1149505	Not Available	520	Open in IMG/M
3300015328\|Ga0182153_1014201	Not Available	1126	Open in IMG/M
3300015328\|Ga0182153_1077550	Not Available	654	Open in IMG/M
3300015328\|Ga0182153_1132610	Not Available	533	Open in IMG/M
3300015328\|Ga0182153_1138518	Not Available	524	Open in IMG/M
3300015329\|Ga0182135_1019896	Not Available	1035	Open in IMG/M
3300015329\|Ga0182135_1047865	Not Available	782	Open in IMG/M
3300015329\|Ga0182135_1114950	Not Available	568	Open in IMG/M
3300015329\|Ga0182135_1125955	Not Available	547	Open in IMG/M
3300015329\|Ga0182135_1126525	Not Available	546	Open in IMG/M
3300015330\|Ga0182152_1074294	Not Available	671	Open in IMG/M
3300015331\|Ga0182131_1062001	Not Available	719	Open in IMG/M
3300015332\|Ga0182117_1121866	Not Available	581	Open in IMG/M
3300015332\|Ga0182117_1148876	Not Available	532	Open in IMG/M
3300015333\|Ga0182147_1016914	Not Available	1148	Open in IMG/M
3300015334\|Ga0182132_1084832	Not Available	669	Open in IMG/M
3300015335\|Ga0182116_1055632	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	813	Open in IMG/M
3300015335\|Ga0182116_1105821	Not Available	633	Open in IMG/M
3300015335\|Ga0182116_1167759	Not Available	518	Open in IMG/M
3300015336\|Ga0182150_1061846	Not Available	738	Open in IMG/M
3300015337\|Ga0182151_1001279	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	2238	Open in IMG/M
3300015337\|Ga0182151_1008853	Not Available	1347	Open in IMG/M
3300015337\|Ga0182151_1088955	Not Available	646	Open in IMG/M
3300015339\|Ga0182149_1013929	Not Available	1238	Open in IMG/M
3300015339\|Ga0182149_1063660	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	752	Open in IMG/M
3300015339\|Ga0182149_1104737	Not Available	622	Open in IMG/M
3300015340\|Ga0182133_1119057	Not Available	619	Open in IMG/M
3300015340\|Ga0182133_1140196	Not Available	578	Open in IMG/M
3300015348\|Ga0182115_1061125	Not Available	1126	Open in IMG/M
3300015348\|Ga0182115_1152321	Not Available	740	Open in IMG/M
3300015348\|Ga0182115_1156414	Not Available	730	Open in IMG/M
3300015348\|Ga0182115_1167570	Not Available	704	Open in IMG/M
3300015348\|Ga0182115_1203742	Not Available	634	Open in IMG/M
3300015348\|Ga0182115_1286083	Not Available	521	Open in IMG/M
3300015349\|Ga0182185_1063329	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	1002	Open in IMG/M
3300015349\|Ga0182185_1130324	Not Available	740	Open in IMG/M
3300015349\|Ga0182185_1176615	Not Available	642	Open in IMG/M
3300015349\|Ga0182185_1248756	Not Available	541	Open in IMG/M
3300015350\|Ga0182163_1059482	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Dichantheliinae → Dichanthelium → Dichanthelium oligosanthes	1098	Open in IMG/M
3300015350\|Ga0182163_1068607	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	1036	Open in IMG/M
3300015350\|Ga0182163_1100131	Not Available	878	Open in IMG/M
3300015350\|Ga0182163_1148928	Not Available	727	Open in IMG/M
3300015350\|Ga0182163_1174242	Not Available	672	Open in IMG/M
3300015350\|Ga0182163_1286903	Not Available	515	Open in IMG/M
3300015352\|Ga0182169_1013936	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	1962	Open in IMG/M
3300015352\|Ga0182169_1038706	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	1382	Open in IMG/M
3300015352\|Ga0182169_1068826	Not Available	1097	Open in IMG/M
3300015352\|Ga0182169_1120740	Not Available	847	Open in IMG/M
3300015352\|Ga0182169_1152674	Not Available	754	Open in IMG/M
3300015352\|Ga0182169_1195570	Not Available	661	Open in IMG/M
3300015352\|Ga0182169_1218720	Not Available	622	Open in IMG/M
3300015352\|Ga0182169_1228412	Not Available	607	Open in IMG/M
3300015352\|Ga0182169_1240882	Not Available	589	Open in IMG/M
3300015353\|Ga0182179_1012259	Not Available	1825	Open in IMG/M
3300015353\|Ga0182179_1050844	Not Available	1131	Open in IMG/M
3300015353\|Ga0182179_1075454	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	971	Open in IMG/M
3300015353\|Ga0182179_1146651	Not Available	734	Open in IMG/M
3300015353\|Ga0182179_1189606	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	652	Open in IMG/M
3300015353\|Ga0182179_1246434	Not Available	576	Open in IMG/M
3300015354\|Ga0182167_1000793	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	4394	Open in IMG/M
3300015354\|Ga0182167_1036897	Not Available	1608	Open in IMG/M
3300015354\|Ga0182167_1043158	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Dichantheliinae → Dichanthelium → Dichanthelium oligosanthes	1515	Open in IMG/M
3300015354\|Ga0182167_1044379	Not Available	1500	Open in IMG/M
3300015354\|Ga0182167_1134662	Not Available	912	Open in IMG/M
3300015354\|Ga0182167_1172174	Not Available	797	Open in IMG/M
3300015354\|Ga0182167_1340577	Not Available	526	Open in IMG/M
3300017412\|Ga0182199_1075315	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae	738	Open in IMG/M
3300017412\|Ga0182199_1144080	Not Available	578	Open in IMG/M
3300017414\|Ga0182195_1117736	Not Available	649	Open in IMG/M
3300017414\|Ga0182195_1150457	Not Available	590	Open in IMG/M
3300017414\|Ga0182195_1214659	Not Available	509	Open in IMG/M
3300017421\|Ga0182213_1194318	Not Available	577	Open in IMG/M
3300017422\|Ga0182201_1079472	Not Available	620	Open in IMG/M
3300017432\|Ga0182196_1037808	Not Available	815	Open in IMG/M
3300017432\|Ga0182196_1060142	Not Available	700	Open in IMG/M
3300017432\|Ga0182196_1133537	Not Available	532	Open in IMG/M
3300017439\|Ga0182200_1091655	Not Available	618	Open in IMG/M
3300017439\|Ga0182200_1104433	Not Available	591	Open in IMG/M
3300017440\|Ga0182214_1090570	Not Available	645	Open in IMG/M
3300017440\|Ga0182214_1127715	Not Available	555	Open in IMG/M
3300017440\|Ga0182214_1137837	Not Available	537	Open in IMG/M
3300017445\|Ga0182198_1065439	Not Available	772	Open in IMG/M
3300017445\|Ga0182198_1177628	Not Available	530	Open in IMG/M
3300017693\|Ga0182216_1080971	Not Available	751	Open in IMG/M
3300017693\|Ga0182216_1098675	Not Available	697	Open in IMG/M
3300017693\|Ga0182216_1137939	Not Available	611	Open in IMG/M
3300017693\|Ga0182216_1138581	Not Available	610	Open in IMG/M
3300017693\|Ga0182216_1224518	Not Available	502	Open in IMG/M
3300028050\|Ga0268328_1019398	Not Available	790	Open in IMG/M
3300028050\|Ga0268328_1020832	Not Available	773	Open in IMG/M
3300028050\|Ga0268328_1021101	Not Available	769	Open in IMG/M
3300028050\|Ga0268328_1072791	Not Available	500	Open in IMG/M
3300028053\|Ga0268346_1044527	Not Available	503	Open in IMG/M
3300028055\|Ga0268338_1024202	Not Available	613	Open in IMG/M
3300028055\|Ga0268338_1038566	Not Available	528	Open in IMG/M
3300028056\|Ga0268330_1061687	Not Available	506	Open in IMG/M
3300028058\|Ga0268332_1060886	Not Available	556	Open in IMG/M
3300028058\|Ga0268332_1069687	Not Available	528	Open in IMG/M
3300028061\|Ga0268314_1031284	Not Available	613	Open in IMG/M
3300028064\|Ga0268340_1058427	Not Available	583	Open in IMG/M
3300028139\|Ga0268355_1014368	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	549	Open in IMG/M
3300028140\|Ga0268334_1014758	Not Available	551	Open in IMG/M
3300028141\|Ga0268326_1008544	Not Available	586	Open in IMG/M
3300028141\|Ga0268326_1014264	Not Available	505	Open in IMG/M
3300028150\|Ga0268343_1011780	Not Available	603	Open in IMG/M
3300028154\|Ga0268341_1014164	Not Available	647	Open in IMG/M
3300028248\|Ga0268312_1012640	Not Available	713	Open in IMG/M
3300028381\|Ga0268264_11469467	Not Available	692	Open in IMG/M
3300028471\|Ga0268323_1006123	Not Available	728	Open in IMG/M
3300028472\|Ga0268315_1001206	Not Available	1236	Open in IMG/M
3300028473\|Ga0268319_1016316	Not Available	571	Open in IMG/M
3300028474\|Ga0268331_1019729	Not Available	565	Open in IMG/M
3300028474\|Ga0268331_1023273	Not Available	536	Open in IMG/M
3300028475\|Ga0268327_1008423	Not Available	713	Open in IMG/M
3300032466\|Ga0214503_1067512	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	1091	Open in IMG/M
3300032467\|Ga0214488_1025275	Not Available	1240	Open in IMG/M
3300032467\|Ga0214488_1104531	Not Available	611	Open in IMG/M
3300032469\|Ga0214491_1023311	Not Available	1401	Open in IMG/M
3300032490\|Ga0214495_1072324	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	803	Open in IMG/M
3300032551\|Ga0321339_1026002	Not Available	1259	Open in IMG/M
3300032551\|Ga0321339_1047208	Not Available	977	Open in IMG/M
3300032591\|Ga0214484_1033465	Not Available	1064	Open in IMG/M
3300032591\|Ga0214484_1035044	Not Available	1044	Open in IMG/M
3300032591\|Ga0214484_1104673	Not Available	580	Open in IMG/M
3300032592\|Ga0214504_1024854	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax	1146	Open in IMG/M
3300032593\|Ga0321338_1095679	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	1038	Open in IMG/M
3300032689\|Ga0214497_1034978	Not Available	1090	Open in IMG/M
3300032697\|Ga0214499_1035376	Not Available	1417	Open in IMG/M
3300032697\|Ga0214499_1041733	Not Available	1324	Open in IMG/M
3300032697\|Ga0214499_1058536	Not Available	1143	Open in IMG/M
3300032758\|Ga0314746_1027646	Not Available	1254	Open in IMG/M
3300032758\|Ga0314746_1041792	Not Available	1051	Open in IMG/M
3300032761\|Ga0314733_1024032	Not Available	1119	Open in IMG/M
3300032761\|Ga0314733_1041721	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	875	Open in IMG/M
3300032791\|Ga0314748_1036957	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	1027	Open in IMG/M
3300032791\|Ga0314748_1055394	Not Available	845	Open in IMG/M
3300032792\|Ga0314744_1096485	Not Available	560	Open in IMG/M
3300032812\|Ga0314745_1096659	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	617	Open in IMG/M
3300032822\|Ga0314740_1025328	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	883	Open in IMG/M
3300032844\|Ga0314743_1030802	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	1224	Open in IMG/M
3300032844\|Ga0314743_1096138	Not Available	682	Open in IMG/M
3300032875\|Ga0314737_1023664	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	1042	Open in IMG/M
3300032889\|Ga0314751_1033197	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	1034	Open in IMG/M
3300032890\|Ga0314747_1015108	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax	1152	Open in IMG/M
3300032890\|Ga0314747_1016328	Not Available	1111	Open in IMG/M
3300032916\|Ga0314734_1088018	Not Available	618	Open in IMG/M
3300032918\|Ga0314726_108609	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax	1134	Open in IMG/M
3300032934\|Ga0314741_1024012	Not Available	1328	Open in IMG/M
3300032934\|Ga0314741_1045666	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	1008	Open in IMG/M
3300032976\|Ga0314752_1111206	Not Available	526	Open in IMG/M
3300033523\|Ga0314768_1032908	Not Available	1634	Open in IMG/M
3300033525\|Ga0314758_1070691	Not Available	978	Open in IMG/M
3300033526\|Ga0314761_1017917	Not Available	1433	Open in IMG/M
3300033526\|Ga0314761_1041147	Not Available	1010	Open in IMG/M
3300033530\|Ga0314760_1022608	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	1473	Open in IMG/M
3300033531\|Ga0314756_1040434	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	827	Open in IMG/M
3300033532\|Ga0314767_1104747	Not Available	706	Open in IMG/M
3300033534\|Ga0314757_1057161	Not Available	933	Open in IMG/M
3300033535\|Ga0314759_1016389	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	1888	Open in IMG/M
3300033535\|Ga0314759_1019723	Not Available	1776	Open in IMG/M
3300033537\|Ga0314766_1130406	Not Available	907	Open in IMG/M
3300033538\|Ga0314755_1068603	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	894	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	98.67%
Environmental	Environmental	1.33%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	98.67%
Terrestrial	Environmental → Terrestrial	1.33%

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	94.25%
Rhizoplane	Host-Associated → Plants → Rhizoplane	1.77%
Soil	Environmental → Terrestrial → Soil	1.33%
Unclassified	Host-Associated → Plants → Unclassified	1.33%
Roots	Host-Associated → Plants → Roots	0.44%
Rhizosphere	Host-Associated → Plants → Rhizosphere	0.89%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	94.25%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	1.77%
Unclassified	Environmental → Terrestrial → Soil → Unclassified	1.33%
Unclassified	Host-Associated → Plants → Unclassified → Unclassified	1.33%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.44%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	0.89%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	94.25%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	1.77%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	1.33%
Unclassified	Host-Associated → Plants → Unclassified → Unclassified → Unclassified	1.33%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	0.44%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	0.89%

Habitat	Taxonomy	Distribution
Switchgrass Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere	83.19%
Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere	11.06%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	1.77%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	1.33%
Switchgrass Associated	Host-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated	1.33%
Switchgrass Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere	0.44%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.44%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.44%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Host-Associated	Open in IMG/M
3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Host-Associated	Open in IMG/M
3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Host-Associated	Open in IMG/M
3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Host-Associated	Open in IMG/M
3300009981	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_208 metaG	Host-Associated	Open in IMG/M
3300009990	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_206 metaG	Host-Associated	Open in IMG/M
3300009995	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_227 metaG	Host-Associated	Open in IMG/M
3300010373	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4	Environmental	Open in IMG/M
3300010399	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3	Environmental	Open in IMG/M
3300010403	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3	Environmental	Open in IMG/M
3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Host-Associated	Open in IMG/M
3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Host-Associated	Open in IMG/M
3300015270	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015278	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015280	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015284	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015290	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015293	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015297	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015301	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015306	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015309	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015310	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015311	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015312	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015313	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015315	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015316	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015317	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015318	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015320	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015325	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015326	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015327	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015328	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015329	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015330	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015331	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015332	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015333	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015334	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015335	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015336	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015337	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015339	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015340	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015348	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015349	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015350	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015352	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015353	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015354	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017412	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017414	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017421	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017422	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017432	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017439	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017440	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017445	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017693	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300028050	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_17JUL2017_LD1	Host-Associated	Open in IMG/M
3300028053	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_28AUG2017_LD1	Host-Associated	Open in IMG/M
3300028055	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_07AUG2017_LD1	Host-Associated	Open in IMG/M
3300028056	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_17JUL2017_LD1	Host-Associated	Open in IMG/M
3300028058	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_07AUG2017_LD1	Host-Associated	Open in IMG/M
3300028061	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_05JUN2017_LD1	Host-Associated	Open in IMG/M
3300028064	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_28AUG2017_LD1	Host-Associated	Open in IMG/M
3300028139	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_18SEP2017_LD1	Host-Associated	Open in IMG/M
3300028140	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_07AUG2017_LD1	Host-Associated	Open in IMG/M
3300028141	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_17JUL2017_LD1	Host-Associated	Open in IMG/M
3300028150	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_28AUG2017_LD1	Host-Associated	Open in IMG/M
3300028154	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_28AUG2017_LD1	Host-Associated	Open in IMG/M
3300028248	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_05JUN2017_LD1	Host-Associated	Open in IMG/M
3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300028471	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_26JUN2017_LD1	Host-Associated	Open in IMG/M
3300028472	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_05JUN2017_LD1	Host-Associated	Open in IMG/M
3300028473	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_26JUN2017_LD1	Host-Associated	Open in IMG/M
3300028474	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_17JUL2017_LD1	Host-Associated	Open in IMG/M
3300028475	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_17JUL2017_LD1	Host-Associated	Open in IMG/M
3300032466	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_12SEP2016_LR2 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032467	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_31MAY2016_LR2 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032469	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032490	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_12JUL2016_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032551	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_31MAY2016_LR2 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032591	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032592	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_12SEP2016_LR2 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032593	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032689	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_12JUL2016_LR2 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032697	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032758	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_17JUL2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032761	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_26JUN2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032791	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_07AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032792	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_17JUL2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032812	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_17JUL2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032822	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_17JUL2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032844	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_17JUL2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032875	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_26JUN2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032889	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_07AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032890	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_07AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032916	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_26JUN2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032918	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_05JUN2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032934	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_17JUL2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032976	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_07AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300033523	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_18SEP2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300033525	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_28AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300033526	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_28AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300033530	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_28AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300033531	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_28AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300033532	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_18SEP2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300033534	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_28AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300033535	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_28AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300033537	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_18SEP2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300033538	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_28AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0068861_1020849833	3300005719	Switchgrass Rhizosphere	YDGRDKNTNSQTNGSIKYISNAHENVMQNEIYCN*
Ga0068858_1023414952	3300005842	Switchgrass Rhizosphere	VFMYDGRDKNINSQTNGSIKFILIIYGGVMQYEIYSN*
Ga0068860_1026067881	3300005843	Switchgrass Rhizosphere	MYDGRDKNINSQTNSSTKHVLNAYGGVMQNKIYYN*
Ga0105247_118267461	3300009101	Switchgrass Rhizosphere	MCHHVFMYDGRDKANNSQTISSTKYISNTCGDEIQNEISIVTK*
Ga0105133_1144291	3300009981	Switchgrass Associated	DICHHVFMYDGRYKNTNSQTNNSSKHILNTYGGAPNKIYCN*
Ga0105132_1124271	3300009990	Switchgrass Associated	DICHHIFMYDIRDKNINSQTNSSIKYTSNTYGGVMQNEIYCN*
Ga0105139_10696611	3300009995	Switchgrass Associated	FMYDGRDKNTNSQTNDSFKYISDTNGGVMHNEGIGTCG*
Ga0134128_128102661	3300010373	Terrestrial Soil	MYDGRDKNINSQTNSSTKHILYTYGGAQNETIVTK
Ga0134127_135497801	3300010399	Terrestrial Soil	MCHHVFMYDERDKNTNSQTNGSTKYILNIHADVMQNEIYCN*
Ga0134123_131650021	3300010403	Terrestrial Soil	RYMSPYNGRDKNTTSQTNYSTKHILNTYGVAQNEIYCN*
Ga0163163_129850921	3300014325	Switchgrass Rhizosphere	ILPMMCHHVFMYDGRDKTTNSQTNSSKTKYISNTCGGGMQNEIYCN*
Ga0157379_121326501	3300014968	Switchgrass Rhizosphere	NQHVFMYDGRDKNTNSQIYSSIKYISNTCGGVMQNKIGCK*
Ga0182183_10475721	3300015270	Switchgrass Phyllosphere	YDGRDKNTNSQTIGSIKYISNTHGGVMQNKIYYN*
Ga0182099_10522422	3300015278	Switchgrass Phyllosphere	MLLFTTHPMCYHMFMYDEKDKNTNSQTNGSIKYISNIHGDVMQNEICCN*
Ga0182100_10552881	3300015280	Switchgrass Phyllosphere	YDGRCKNTNLQTNSSTKYISNTYRGVIQNEIYCN*
Ga0182101_10269452	3300015284	Switchgrass Phyllosphere	FMYYERDKNINSQRNGSINYISNEQGGVIQNEIY*
Ga0182101_10658741	3300015284	Switchgrass Phyllosphere	IFMYDARDKNTNSQTNRSTKYILNTYGGAQNEIYCN*
Ga0182105_10541301	3300015290	Switchgrass Phyllosphere	NISRDIYHHISMYDERDRNINSQTNSSTKHTSNPYGGEMRNKIYCK*
Ga0182103_10447101	3300015293	Switchgrass Phyllosphere	CHYIFMYDGRDKNINSQTNNSTKHILNIYGCVMQNEIYYN*
Ga0182103_10895101	3300015293	Switchgrass Phyllosphere	HDICHHIFMYDGRNKNTNSQTNSSTKHILNTYGGVM*
Ga0182104_10321601	3300015297	Switchgrass Phyllosphere	NTNHDICHHIFMYDGRDKNTNSQINTLTKYIWNTYGGVMQNKIYCN*
Ga0182104_10332542	3300015297	Switchgrass Phyllosphere	FMYDGRHKDTNSQTNSSTKYISNAYGDMMQNEIYCN*
Ga0182104_10826641	3300015297	Switchgrass Phyllosphere	THDMGHHVFIYVGRDKNTNSQENSSIKYISNTHGGVMQNKIYCN*
Ga0182184_10582951	3300015301	Switchgrass Phyllosphere	DMCHHVFMYDRRDQNNNSQTNASIKYILNNRHAMQNEIK*
Ga0182184_10625131	3300015301	Switchgrass Phyllosphere	YIFMYDGRDKNINSQTNSSTKHILNTYGGVMQNEIYCN*
Ga0182180_10870791	3300015306	Switchgrass Phyllosphere	MIYVTILINDGRDNNTNSQTNSSTEHILNIYGGAQNEIYCN*
Ga0182098_10691182	3300015309	Switchgrass Phyllosphere	KILPTMCHHVFMYDGRDKTNNSQTISSTKYISNTCGDEMQNEISIVTK*
Ga0182098_10993671	3300015309	Switchgrass Phyllosphere	ICHHVFMYGGRDKTTNSKTNSSTKYMSNKFGGVMQNEIYRN*
Ga0182098_11054081	3300015309	Switchgrass Phyllosphere	RVFFNICHHIFMYDGRDKNTNSQTNNSTKHILNAYGGAQNEIYCN*
Ga0182098_11250121	3300015309	Switchgrass Phyllosphere	HVGMYDGRGKNSNLQINDSIKCILNTYGGVMQTKIYCN*
Ga0182162_10448041	3300015310	Switchgrass Phyllosphere	TTYDICHHIFMYDARDKNTNSQTNRSTKYILNTYGGAQNEIYCN*
Ga0182162_10511891	3300015310	Switchgrass Phyllosphere	DMCHHLFMYDGRDKNINSQTDGSIKYISNTHGGVMQNEIYCN*
Ga0182162_11124241	3300015310	Switchgrass Phyllosphere	DGRDKTTNSQTNSSTIYIYIYINTCGGGMQNEIYCN*
Ga0182182_10784081	3300015311	Switchgrass Phyllosphere	TTHDMCHHILMYDERDKNTNSQTNSSIKYISNTHGGVMQNKI*
Ga0182168_10163881	3300015312	Switchgrass Phyllosphere	KICHHIFMYDESDKNINSQINDSIKYMSNLHGGVMQNKIYYN*
Ga0182168_10440631	3300015312	Switchgrass Phyllosphere	MYDGRDKNINSQTNSSTKHVLNAYGGVMENKIYYN*
Ga0182168_10939701	3300015312	Switchgrass Phyllosphere	HDICHHIFIYDGRDKNTNSQINSSTKHILNAYGGAQNKIYCN*
Ga0182168_11295571	3300015312	Switchgrass Phyllosphere	MWHHIFIYDGRDKNINLQTNSSTKHILNTYRGAQNEIYCN*
Ga0182168_11315971	3300015312	Switchgrass Phyllosphere	MYDERDKNTNSQTNSSIKYISNTHGGVMQKEIYCK*
Ga0182164_10548401	3300015313	Switchgrass Phyllosphere	MCHHVFVYDEGDKNTNSHTNDLIKYISNTVGGVMQNEIYCNYKMN*
Ga0182164_10954971	3300015313	Switchgrass Phyllosphere	HVFMYDERNKNINLQTNSSTKYTSNTYGGVMQNKIYCN*
Ga0182164_11005831	3300015313	Switchgrass Phyllosphere	MCHHVFMYDRKDKNTNSQTNGSIKYISNTHRGVMQNEIYCN
Ga0182164_11041061	3300015313	Switchgrass Phyllosphere	HHVFMYDGRDMNTNLKINYLIEYISNTYGGVMQNEIYCN*
Ga0182164_11352632	3300015313	Switchgrass Phyllosphere	CHHAFMNDGRDKNTSSETNSSTKYISNIYGGVMQNEL*
Ga0182120_10387352	3300015315	Switchgrass Phyllosphere	MMCHHVFMYDGRDKTINSQTNSSAKYISNTYGGGMQNEISCN*
Ga0182121_10802711	3300015316	Switchgrass Phyllosphere	HHVFTYDGKDKNIRSQTNDSIKYISNTRGVEMQNEIYCN*
Ga0182136_10353901	3300015317	Switchgrass Phyllosphere	FMYDVRDKNINSQTNSSIKYTSNTYGGVMQNEIYTN*
Ga0182136_10800571	3300015317	Switchgrass Phyllosphere	MHHHIFMYDGRDKTINSQTNSSAKYISNTYGGGMQNEIYFD*
Ga0182181_10261861	3300015318	Switchgrass Phyllosphere	DIYHHIFMYDGRDKNTNSQTNSLTKHILNTYGGAQNEIYCN*
Ga0182181_10489701	3300015318	Switchgrass Phyllosphere	HHIFMYDGRDKNINSQTNSSTKHILNTYGGAQNKIHCN*
Ga0182181_10833291	3300015318	Switchgrass Phyllosphere	MCHHVFMYDGRDKTNNSQTISSTKYISNTCGDEMQNEISIVTK*
Ga0182165_11435671	3300015320	Switchgrass Phyllosphere	YDERDKNTNSKRNGSVKYISNAHGDVMKNKIYCN*
Ga0182148_10097441	3300015325	Switchgrass Phyllosphere	NTTHDICHHIFMYGGRDKNISSQTNSSTKHILNTYGCAKNKIYYN*
Ga0182148_11190191	3300015325	Switchgrass Phyllosphere	MCHHIFMHDGRDKNTNSQTNGSIKYISNIHGGVIQNEYIVTS*
Ga0182166_10155991	3300015326	Switchgrass Phyllosphere	NVYHHVFTYDGKDKNIRSQTNDSIKYISNTRGVEMQNEIYCN*
Ga0182166_10388081	3300015326	Switchgrass Phyllosphere	FIYDGRHKNTNSQTNSSIKYILNTYGGAQNKIYYN*
Ga0182114_11352061	3300015327	Switchgrass Phyllosphere	CHHIFIYDGRDKNTNSQINSLTKDILNTYGGAQNEIYCN*
Ga0182114_11387331	3300015327	Switchgrass Phyllosphere	HHIFMYDGRDSNTNSQTNSSTEHILNIYGGAQNEIYCN*
Ga0182114_11495051	3300015327	Switchgrass Phyllosphere	NTTLDMCHHLFMYDERDKSINSQTNGSIKCISNIHGSMMQNEIYYN*
Ga0182153_10142011	3300015328	Switchgrass Phyllosphere	MHDGRDKNINSQIKSSTKHILNTYGCVQNEIYCN*
Ga0182153_10775501	3300015328	Switchgrass Phyllosphere	FMYDVRDKNTNLQTNGSIKYISNTYIYEGVLQNKIYCN*
Ga0182153_11326101	3300015328	Switchgrass Phyllosphere	MYHERDKNTTSQTNSSIKYISNTYGGMVQNKIYCNRIIIN
Ga0182153_11385181	3300015328	Switchgrass Phyllosphere	FMYDGKYKNTNQTNSSTKHVLNAYGGVMQNEIYCN
Ga0182135_10198961	3300015329	Switchgrass Phyllosphere	MCQHAFMYDGRDKNTNSQTNSSIKYISNIYGGVMKIKIYCN*
Ga0182135_10478651	3300015329	Switchgrass Phyllosphere	KNTSHDICHHIFMYDGGDKNTNSQVNSATKYISNTYGGVMQNEIYCN*
Ga0182135_11149501	3300015329	Switchgrass Phyllosphere	HDICHHIFMYDGRDKITNSKKSSSTKYISNTYGGMMQNEIYSN*
Ga0182135_11259551	3300015329	Switchgrass Phyllosphere	FMYDGRDKNTNLQTNSSTKYISNTYGGVVQNEIYCN*
Ga0182135_11265251	3300015329	Switchgrass Phyllosphere	FMYDGRDKNNNSQINSSIKYISNMYVVVMQNKIYCNYI*
Ga0182152_10742941	3300015330	Switchgrass Phyllosphere	IFMYDGRDKNTNSQKNSSTKHILNTYGCAQNEIYCN*
Ga0182131_10452261	3300015331	Switchgrass Phyllosphere	YFYIKILPAICVTGHVFMYDGRDKNTNSQINSSTKYKSNTYGGAQNEIYCK*
Ga0182131_10620011	3300015331	Switchgrass Phyllosphere	IYIIYHHIFIYDGKCKNINSQINGLIKYISNIHGGVMQNKIYCN*
Ga0182117_11218661	3300015332	Switchgrass Phyllosphere	MYDGRDKNINSQTNSSIKYISNAHENVMQNEIYCN*
Ga0182117_11488761	3300015332	Switchgrass Phyllosphere	SCIMYDGRDKNINLQINSSTKYISNIYEGMMQNKIYCN*
Ga0182147_10169141	3300015333	Switchgrass Phyllosphere	YLSPYNGRDKNSNSQINGLIKYILNTHEGAMQNEIHCN*
Ga0182132_10848321	3300015334	Switchgrass Phyllosphere	MIYVTILMYDGRDNNTNSQTNSSTEHILNIYGGAQNEIYCN*
Ga0182116_10556322	3300015335	Switchgrass Phyllosphere	YKNTTGDICRHIFMFDGRDKNINLQTNNSTKHILNTYEGSQNEIYCN*
Ga0182116_10836751	3300015335	Switchgrass Phyllosphere	IYYRRDNSTNSQTNISTKYVSNTYGGAMQNKIYCN*
Ga0182116_11058211	3300015335	Switchgrass Phyllosphere	KNTTHNICHHMFMYDERNKNTNSQTNSSTKHILNTYGGVI*
Ga0182116_11677591	3300015335	Switchgrass Phyllosphere	MYDGRDNNVNTQTNSSTKHILNTCGGAQNEIYCN*
Ga0182150_10618461	3300015336	Switchgrass Phyllosphere	MCHHLFMYDERDKSINSQTNGSIKYISNIHGSMMQNEICCNYIMI
Ga0182151_10012793	3300015337	Switchgrass Phyllosphere	MCHHVFMYDGRDKNTDSQTIYSIRYISNTYGGEMQNEISIAIR*
Ga0182151_10088531	3300015337	Switchgrass Phyllosphere	VFMYDERDKNTNSQTNSSIKYISNTHGGVMQKEIYCK*
Ga0182151_10889552	3300015337	Switchgrass Phyllosphere	YDGRDKNTNSQTNSSTKHILNTYGGVMQNEIYCN*
Ga0182149_10139292	3300015339	Switchgrass Phyllosphere	FMYDGRDKNTNSQTNSSTKHILNTYGGVMQNEIYCN*
Ga0182149_10636601	3300015339	Switchgrass Phyllosphere	MYNGRDKNTNSQTNGSIKYISNKHGGVMQNETTI*
Ga0182149_11047371	3300015339	Switchgrass Phyllosphere	HHIFMYDGRDKNTNSQTNSSTKHILNTYGGAQNKIYYN*
Ga0182133_11190571	3300015340	Switchgrass Phyllosphere	YDERDKNTNSQINSSTKYISSTYGGVMQNEIYTN*
Ga0182133_11401961	3300015340	Switchgrass Phyllosphere	HDICHHIFKYDGRDKNVNSQINSSIKYILNTYGGVMQNEIYCN*
Ga0182115_10611252	3300015348	Switchgrass Phyllosphere	YDGRDKNTNSKTKSSTKYILNTYGGVMQNKPIVTR*
Ga0182115_11523211	3300015348	Switchgrass Phyllosphere	VYHHVFTYDGKDKNIRSQTNDSIKYISNTRGVEMQNEIY
Ga0182115_11564141	3300015348	Switchgrass Phyllosphere	IYDGRGKNTNSQTNSSTKYISNTYLGVIQNEIYCN*
Ga0182115_11675701	3300015348	Switchgrass Phyllosphere	NTTHDMCHHEFMYDEKGKNTNSQTNSSIKYMSNTYGDVM*
Ga0182115_11980951	3300015348	Switchgrass Phyllosphere	MYDGRDNNTNSQTNDSFKYISDTNGGVMHNEGIGTCG
Ga0182115_12037421	3300015348	Switchgrass Phyllosphere	HIFMYDERDKNINSQINSSTKYISNTYGDVMQNKIDLL*
Ga0182115_12860831	3300015348	Switchgrass Phyllosphere	KNTTHDICHHIFMHDGRDKNINSQINSRTKHILNTYGCVQNEIYCN*
Ga0182185_10633292	3300015349	Switchgrass Phyllosphere	KNTTHDICHHIFMYDGRDKNTNSQTNSSIKHALYAYEGVMQNEIYCN*
Ga0182185_11303241	3300015349	Switchgrass Phyllosphere	YKNTIHNIYHRVFMYDGRDKNTNSQTNSLTIYISNTYEGVMQNERYYN*
Ga0182185_11766151	3300015349	Switchgrass Phyllosphere	DMCHHIFMYDGRDKNINSQTNSSIKYMSDIYGGGMQSEI*
Ga0182185_12487561	3300015349	Switchgrass Phyllosphere	LHVFIYDGRDKNTNSQANSSIKYISNIYGGVMQNKINTTT*
Ga0182163_10594821	3300015350	Switchgrass Phyllosphere	MCRHVFIYDGRDKTTNSQTNVSIKYISNIHGGVMQNKIYIN*
Ga0182163_10686071	3300015350	Switchgrass Phyllosphere	VFMYYERDKNINSQRNGSINYISYEHGGVIQNEIY*
Ga0182163_11001311	3300015350	Switchgrass Phyllosphere	DERDKDTNLQTNNSKTNSSTKYILNTYGGAQNKIYCN*
Ga0182163_11489282	3300015350	Switchgrass Phyllosphere	MCHHVSMYDERDKNINSQTNGSLKYISNTYGGAMQNEIYCN*
Ga0182163_11742421	3300015350	Switchgrass Phyllosphere	IFMYNGRDKNTNSQINSSTKHVLNTYGGQNEIYCN
Ga0182163_12869032	3300015350	Switchgrass Phyllosphere	YDGRDKNINSQTNSSTKHTSNIYGGVIQNEIYCN*
Ga0182169_10139364	3300015352	Switchgrass Phyllosphere	HNICHHIFMYDERDKNTNSHTNSSTKHILNAYGGVM*
Ga0182169_10387061	3300015352	Switchgrass Phyllosphere	MCHHVFMYDERDNNTNSQTNGSIKYISNTNGGVMQNEIYCN*
Ga0182169_10688261	3300015352	Switchgrass Phyllosphere	MCHHVFMYERRYKNTNSQANGSINYISNTHGGVMQNKIYC
Ga0182169_11207401	3300015352	Switchgrass Phyllosphere	HHIFMYDGRDKNTNSQTNISTKHILNTYGGAQNEIYCN*
Ga0182169_11526741	3300015352	Switchgrass Phyllosphere	MCHHLFMYDERDKSINSQTNGSIKCISNIHGSMMQNEICCNYIM
Ga0182169_11955701	3300015352	Switchgrass Phyllosphere	MYDGRDNNTNSQTNSSIKYISNTYGGVMQNEIFYN*
Ga0182169_12187201	3300015352	Switchgrass Phyllosphere	KNTTHDICHHIFMYDGRDKNTNSQINSSTKYKSNTYGGAQNEIYCK*
Ga0182169_12284121	3300015352	Switchgrass Phyllosphere	VYINTIHNICHHIFMYGGKDKNTHFQTNSSTKHILNTYGSVMQNEIYCN*
Ga0182169_12408821	3300015352	Switchgrass Phyllosphere	MHDGRDKNTNSQTNGSIKFIPNKKNKHGVVMQNKISCN*
Ga0182169_12759191	3300015352	Switchgrass Phyllosphere	KYTIHGICHHVFMYYERDKNINSQRNGSINYISNEHGGVMQNEIYRN*
Ga0182179_10122591	3300015353	Switchgrass Phyllosphere	MCHRIFMYDGRDKNTNSQTNGSIKYISNTYEGVMHNGTYCN*
Ga0182179_10205741	3300015353	Switchgrass Phyllosphere	YENTTHDICHHIFMYDGRDKTTNLKTNSLTEYISNKCGGMMQNEIYRN*
Ga0182179_10508441	3300015353	Switchgrass Phyllosphere	THDMCHHIFIYDGRDKNTSSQTNGSIKYISNTHGDVMQNKIHCN*
Ga0182179_10754542	3300015353	Switchgrass Phyllosphere	ICHHVFMYYERDKNINSQRNGSINYISNKQGGVIQNEIY*
Ga0182179_11466511	3300015353	Switchgrass Phyllosphere	IFMYDERDKNINSQINSSTKYISNTYGDVMQNKIDLL*
Ga0182179_11896062	3300015353	Switchgrass Phyllosphere	AFMYDGRDKNTNSQTNSSIKYISNIYGVMKIKIYCN*
Ga0182179_12464341	3300015353	Switchgrass Phyllosphere	LYDGRYKNINSQINSLTKHILNTYGCAQNKIYYN*
Ga0182167_10007931	3300015354	Switchgrass Phyllosphere	KNTTHDIFYHIFMYDGRDKNNNSQTNSSTKHILNAYGGVM*
Ga0182167_10368971	3300015354	Switchgrass Phyllosphere	NTTHNMYHHVFMYDGTDKNTNSETNVSAIKYILNTHGGVMQNEVYCN*
Ga0182167_10431581	3300015354	Switchgrass Phyllosphere	KDITHDICHHIFKYDGRDKNTNSQINSSIKHIFNTKNGGAHNEIYCN*
Ga0182167_10443791	3300015354	Switchgrass Phyllosphere	MCHHVFMYDRRDQNNNSQTNASIKYILNNRRAMQNEIK*
Ga0182167_11045601	3300015354	Switchgrass Phyllosphere	FILLFIENTTHDICHHLFMYYGRDKNINSQTNNSTKNILKTYGGVM*
Ga0182167_11346621	3300015354	Switchgrass Phyllosphere	HIFMYDGRDKTTNSQTNSSTIYISNICGGGMQNKIYCN*
Ga0182167_11721741	3300015354	Switchgrass Phyllosphere	VTMYSYDVRDKKTNSQTNVSIKYISNTYGGVMQNEFYCN*
Ga0182167_13405771	3300015354	Switchgrass Phyllosphere	MYDGRDKNTNSQINSPTKYISNTHTAMQNKIYYN*
Ga0182199_10753151	3300017412	Switchgrass Phyllosphere	VFVYDEEDKNTNSHTNDLIKYISNTVGGVMQNEIYCNYKMN
Ga0182199_11440801	3300017412	Switchgrass Phyllosphere	PYIHQFIYDRRDKNTNSQTNSSIKHILNTYGGAQNEIYCN
Ga0182195_11177361	3300017414	Switchgrass Phyllosphere	MCHHVFMGDVRDKNINSERNSSIKYMSDIYGGGMQSEI
Ga0182195_11504571	3300017414	Switchgrass Phyllosphere	ICHHIFMYDGRDKNINSQTNSSTKYTSNTYGGVIQNEIYCN
Ga0182195_12146591	3300017414	Switchgrass Phyllosphere	HVFIYDGRDKNTNSQANSSIKYISNIYGGVMQNKINTTT
Ga0182213_11943181	3300017421	Switchgrass Phyllosphere	HHIFMHDGRDKNINSQINSSTKHILNTYGCVQNEIYCN
Ga0182201_10794721	3300017422	Switchgrass Phyllosphere	MCRHAFIYDGRDKTTNSQTNVSIKYISNIHGGVMQNKIYIN
Ga0182196_10378082	3300017432	Switchgrass Phyllosphere	VFMYDERDKNTNSQTNSSIKYISNTHGGVMQKEIYCK
Ga0182196_10601422	3300017432	Switchgrass Phyllosphere	MCHHVFMYDKRDKNTNSPTNGSIKYISNPYRGVMQNE
Ga0182196_11335371	3300017432	Switchgrass Phyllosphere	MCHHIFMYDGKDKNINSQTNSSTKYISNTYGDVMQ
Ga0182200_10916551	3300017439	Switchgrass Phyllosphere	MCHHVFMYDERDKTTNSQTNSSTKYILNTCGGGKQNEIYYN
Ga0182200_11044331	3300017439	Switchgrass Phyllosphere	IYMYDERDKNTNSQTNSSTKYISSTYGGVMQNEIYTN
Ga0182214_10905701	3300017440	Switchgrass Phyllosphere	CHHVFMYDGKDKNTNLQTNSXTKYISNTYGGVMQKXNLL
Ga0182214_11277152	3300017440	Switchgrass Phyllosphere	ITHDICHHIFMYDGRDKNINSQKNSSTKHVLNAYGGVMQNEIYYN
Ga0182214_11378371	3300017440	Switchgrass Phyllosphere	FMYNERDKNTNSQINSSTKHVLNTYGGAQNEIYCN
Ga0182198_10654391	3300017445	Switchgrass Phyllosphere	HDICHRIFMYDRRDKNTNSQTNSSTKYILNTYGGVMQNKIYCN
Ga0182198_11776281	3300017445	Switchgrass Phyllosphere	IFMYNGKDKNINSQTNSSIKYISSTHGGVMQNKIYCN
Ga0182216_10809713	3300017693	Switchgrass Phyllosphere	MCHHVFMYDGRDKYTNSQTNSSIKYISNTHREVMQNK
Ga0182216_10986751	3300017693	Switchgrass Phyllosphere	HIFMYDGRDKNTNSQTNSSTKHILNTYGGAQNEIYCN
Ga0182216_11379391	3300017693	Switchgrass Phyllosphere	FMYDVRDKNINSQTNNSIKYISNTLGGVMQNEIYCN
Ga0182216_11385811	3300017693	Switchgrass Phyllosphere	MCHHVFIYDERDKNTNSQTNGSFKYISNTHEGVMQNEIYYN
Ga0182216_12245181	3300017693	Switchgrass Phyllosphere	CHHIFMHDGRDKNTNSQTNGSIKYISNIHGGVIQNEYIVTS
Ga0268328_10193981	3300028050	Phyllosphere	SYMMEEINTNSQTNSTIKYISNTYKGVMQNKIYCN
Ga0268328_10208321	3300028050	Phyllosphere	MYRIFMYDGRDKNTNSQTNSSTKHILNAYGGAQNEIYCNYI
Ga0268328_10211011	3300028050	Phyllosphere	MLHVFIYDGRDKNTNSQANSSIKYISNIYGGVMQNKINTTT
Ga0268328_10727911	3300028050	Phyllosphere	YYLYKNITHDICYHIFMYDGRDKNNNSQTNSSTKHILNAYGGVM
Ga0268346_10445271	3300028053	Phyllosphere	KICHHIFMYDESDKNINSQINDSIKYMSNLHGGVMQNKIYYN
Ga0268338_10242021	3300028055	Phyllosphere	KNTTHDICHYIFMYDGRDKNTNSQINNSTKHILNIYGCVMQNEIYCN
Ga0268338_10385661	3300028055	Phyllosphere	FMYDGRDKNTNSQTNSSTKHILNTYGAAENEIYCN
Ga0268330_10616871	3300028056	Phyllosphere	CIMYDGRDKNINLQINSSTKYISNIYEGMMQNKIYCN
Ga0268332_10608862	3300028058	Phyllosphere	MYDGRYKNTNSQTNSSTKHVLNVYGVVMQNKIYCN
Ga0268332_10696871	3300028058	Phyllosphere	FMLLVIYMIYDGRDKNINSQXNDSIKYISNTHEDVMQNEIYYN
Ga0268314_10312841	3300028061	Phyllosphere	MHDVRDKNINSQTNSSTKYISNTYEDMMQYKIYCN
Ga0268340_10584271	3300028064	Phyllosphere	MCHHVFMYDGRDKNNNSQINSSIKYISNMYVVVMQNKIYCNY
Ga0268355_10143681	3300028139	Phyllosphere	IFMYDGRDKNTNSQTNSSTKHVLNAYGGVMQNEIYFN
Ga0268334_10147581	3300028140	Phyllosphere	GHHIFMYDGRDKNTNSQTNSSTKHILNTYGGVMQNKSIVST
Ga0268326_10085441	3300028141	Phyllosphere	YIFMYDGRYKNTNSQTNSSIKYILNTYGGVMQNEIYCN
Ga0268326_10142641	3300028141	Phyllosphere	LYKNTTYDICHHIFMYDARDKNTNSQTNRSTKYILNTYGGAQNEIYCN
Ga0268343_10117801	3300028150	Phyllosphere	MRHHVFMYDGRDKTTNSQTNSSTKYISNTRGGGMQNEIYCN
Ga0268341_10141641	3300028154	Phyllosphere	MSPYIHIYDGRNKNTNSQTNSSTKHILNTYGGAQNEMYC
Ga0268312_10126403	3300028248	Phyllosphere	FMYDGRDKNTNSQTNSSTKHILNTYGGVMQNEIYCN
Ga0268264_114694672	3300028381	Switchgrass Rhizosphere	HDIYHHIFMYDGRDKNNNSQINSSTKYISNTYGGVMQNEIYYN
Ga0268323_10061231	3300028471	Phyllosphere	MCQHAFMYDGRDKNTNSQTNSSIKYISNIYGGVMK
Ga0268315_10012061	3300028472	Phyllosphere	HDMCHRIFMYDGRDKNTNSQTNGSIKYISNTYEGVMHNGTYCN
Ga0268319_10163161	3300028473	Phyllosphere	MCHHVSMYDGRDKNTNSQTNGSLKYISNTYGGAMQNEIYCN
Ga0268331_10197292	3300028474	Phyllosphere	FMYDGRDKNINLQTNGSIRYILNIHGDVMQNKIYCN
Ga0268331_10232731	3300028474	Phyllosphere	MCRHVFIYDGRDKTTDSQTNVSIKYISNIHGGVMQNKIYIN
Ga0268327_10084231	3300028475	Phyllosphere	NSTDDMCHHVFMYDGRDKNINLQTNGLIKYISNTLGCVMQN
Ga0214503_10675122	3300032466	Switchgrass Phyllosphere	MCYHVSMYDGRDKNTNSQTNGLIKYISNTHGGVMQNEIYCN
Ga0214488_10252752	3300032467	Switchgrass Phyllosphere	HDICHHIFMYDGRYKNTNSQTNISTKHILNTYGGAQNEIYCN
Ga0214488_11045311	3300032467	Switchgrass Phyllosphere	HHVFIYDARDKNINSQINGSVRYISNTHGGVIQNKIYCN
Ga0214491_10233111	3300032469	Switchgrass Phyllosphere	HDICHHIFIYDGRDKNTNSQTNISTKHILNTYGGAQNEIYCN
Ga0214495_10723241	3300032490	Switchgrass Phyllosphere	HDIYHHIFMYDGRDKNTNSQTNSLTKHILNTYGGAQNEIYCN
Ga0321339_10260021	3300032551	Switchgrass Phyllosphere	KNITHDIFYHIFMYDGRDKNNNSQTNSSTKHILNAYGGVM
Ga0321339_10472081	3300032551	Switchgrass Phyllosphere	HDICHHIFMYDGRDKNTNSQTNISTKHILNTYGGAQNEIYCN
Ga0214484_10334651	3300032591	Switchgrass Phyllosphere	RDICYHIFMYDGRDKNNNSQTNSSTKHILNAYGGVM
Ga0214484_10350441	3300032591	Switchgrass Phyllosphere	VFIYDERDKNTNSETNGLIKYILNTHEGLMQNETYCN
Ga0214484_11046731	3300032591	Switchgrass Phyllosphere	MYDGRDKNTNSQTNSSTKHVLNVYGVVMQNKIYCN
Ga0214504_10248541	3300032592	Switchgrass Phyllosphere	HNICHRIFMYDGRDKNTNSQTNSSTKHMLNTYGGVMQNEIYCK
Ga0321338_10956792	3300032593	Switchgrass Phyllosphere	MCYRVSMYDGRDKNTNSQTNGSIKYISNTHGGVMQNEIYCN
Ga0214497_10349781	3300032689	Switchgrass Phyllosphere	HDIFYHIFMYDGRDKNNNSQTNSSTKHILNAYGGVM
Ga0214499_10353761	3300032697	Switchgrass Phyllosphere	DICHHIFMYDGRDKNTNSQTNSSTKHVLNAYGGVIQYEIYCN
Ga0214499_10417331	3300032697	Switchgrass Phyllosphere	HDICYHIFMYDGRDKNNNSQTKSSTKHILNAYGGVM
Ga0214499_10585361	3300032697	Switchgrass Phyllosphere	HDICHHIFMYDGRDKNTSSQTKGSTKHILNTYGGAQNEIYCN
Ga0314746_10276461	3300032758	Switchgrass Phyllosphere	NTTHDICHHIFMYDGRDKNTNSQTNSSTKHVLNAYGGVIQYEIYCN
Ga0314746_10417921	3300032758	Switchgrass Phyllosphere	DICHHIFMYDGRYKNTNSQTNISTKHILNTYGGAQNEIYCN
Ga0314733_10240321	3300032761	Switchgrass Phyllosphere	HDICHHIFIYDGRDKNTNSQINSLTKDILNTYGGAQNEIYCN
Ga0314733_10417212	3300032761	Switchgrass Phyllosphere	CYHVSMYDGRDKNTNSQTNGSIKYISNTHGGVMQNEIYCS
Ga0314748_10369572	3300032791	Switchgrass Phyllosphere	MCYHVSMYDGRDKNTNSQTNGSIKYISNTHGGVMQNEIYCN
Ga0314748_10553941	3300032791	Switchgrass Phyllosphere	HDICRHIFMYDGRDKNTNSQTNSSTKHVLNAYGGVIQYEIYCN
Ga0314744_10964851	3300032792	Switchgrass Phyllosphere	MYDGRDKNTNSQTNSSTKHVLNAYGGVIQYEIYCN
Ga0314745_10966591	3300032812	Switchgrass Phyllosphere	HHIFMHDGRDENINSQANSSTKHILNTYECAQNEIYCN
Ga0314740_10253282	3300032822	Switchgrass Phyllosphere	YDMCYHVSMYDGRDKNTNSQTNGSIKYISNTHGGVMQNEIYCN
Ga0314743_10308021	3300032844	Switchgrass Phyllosphere	MYYHVFMYDGRDKTTNSQTNSSTKYIYISNTCGGGMQNEIYYN
Ga0314743_10961381	3300032844	Switchgrass Phyllosphere	HDICYHIFMYDGRDKNNNSQTNSSTKHILNAYGGVM
Ga0314737_10236641	3300032875	Switchgrass Phyllosphere	PFVIGSAIMYGGRDKNINSQTNGSIKYRLNTHGGVMQNKIYCNN
Ga0314751_10331972	3300032889	Switchgrass Phyllosphere	MCYHVSMYDGRDKNTNSQTNGSIKYISNTYGGVMQNEIYCN
Ga0314747_10151081	3300032890	Switchgrass Phyllosphere	TTHDICHHIFMFDGRDKNINSQTNSSTKHILNTYGGVMQNEIYCN
Ga0314747_10163281	3300032890	Switchgrass Phyllosphere	NTTHDICHHIFMYDGRDKNTSSQTKGSTKHILNTYGGAQNEIYCN
Ga0314734_10880182	3300032916	Switchgrass Phyllosphere	DICHHIFMFDGRDKNINSQANSSTKHILNTYGGVMQNEIYCN
Ga0314726_1086091	3300032918	Switchgrass Phyllosphere	KTTHDICHHIFMFDGRDKNINSQTNSSTKHILNTYGGVMQNEIYCN
Ga0314741_10240121	3300032934	Switchgrass Phyllosphere	APDICYHIFMYDGRDKNNNSQTNSSTKHILNAYGGVM
Ga0314741_10456661	3300032934	Switchgrass Phyllosphere	IHSICHHVFMYYERDKNINSQTNGSIKYISNEHGGVMQNEIY
Ga0314752_11112061	3300032976	Switchgrass Phyllosphere	MRHHVFMYDGRDKTTNSQTNSSTKYIYISNTCGGGMQNEIYYN
Ga0314768_10329081	3300033523	Switchgrass Phyllosphere	MCYHVSMYDGRDKNINSQTNGSIKYISNTHGGVMQNEIY
Ga0314758_10706911	3300033525	Switchgrass Phyllosphere	HIFMFDGRDKNINSQTNSSTKHILNTYGGVMQNEICCN
Ga0314761_10179171	3300033526	Switchgrass Phyllosphere	SAIMYGGRDKNINSQTNGSIKYRLNTHGVVMQNKIYCN
Ga0314761_10411471	3300033526	Switchgrass Phyllosphere	AHDICHHIFMYDGRDKNTSSQTKGSTKHILNTYGGAQNEIYCN
Ga0314760_10226082	3300033530	Switchgrass Phyllosphere	MCYHVSMYDGRDKNINSQTNGSIKYISNTHGGVMQNEIYCN
Ga0314756_10404341	3300033531	Switchgrass Phyllosphere	HVSMYDGRDKNTNSQTNGSIKYISNTHGGVMQNEIYCN
Ga0314767_11047471	3300033532	Switchgrass Phyllosphere	MYDGRDKNTNSQTNGSIKYISNTHGGVMQNEIYCN
Ga0314757_10571611	3300033534	Switchgrass Phyllosphere	THDICHHIFMYDGRDKNTSSQTKGSTKHILNTYGGAQNEIYCN
Ga0314759_10163892	3300033535	Switchgrass Phyllosphere	ATHDICHHIFMYDGRYKNTNSQTNISTKHILNTYGGAQNEIYCN
Ga0314759_10197231	3300033535	Switchgrass Phyllosphere	HVFMYDGRDKNIQIDDSIKYISNTCKDVMQNEIYFN
Ga0314766_11304061	3300033537	Switchgrass Phyllosphere	DICHHIFMFDGRDKNINSQTNNSTKHILNTYGGVMQNEICCN
Ga0314755_10686031	3300033538	Switchgrass Phyllosphere	NITYDMCYHVSMYDGRDKNTNSQTNGSIKYISNTHGGVMQNEIYCN

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F019940

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences