Basic Information | |
---|---|
Family ID | F020166 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 225 |
Average Sequence Length | 37 residues |
Representative Sequence | MKEPKIMKMDWRSLGYWPVYKDGKLTWEKDPDEDVN |
Number of Associated Samples | 133 |
Number of Associated Scaffolds | 225 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 39.19 % |
% of genes near scaffold ends (potentially truncated) | 14.67 % |
% of genes from short scaffolds (< 2000 bps) | 58.22 % |
Associated GOLD sequencing projects | 115 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.36 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (73.333 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (23.111 % of family members) |
Environment Ontology (ENVO) | Unclassified (53.778 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (62.222 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 14.06% β-sheet: 18.75% Coil/Unstructured: 67.19% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.36 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 225 Family Scaffolds |
---|---|---|
PF13640 | 2OG-FeII_Oxy_3 | 10.22 |
PF00166 | Cpn10 | 7.56 |
PF04973 | NMN_transporter | 4.89 |
PF02675 | AdoMet_dc | 2.67 |
PF09834 | DUF2061 | 2.22 |
PF04820 | Trp_halogenase | 1.78 |
PF13936 | HTH_38 | 1.78 |
PF08007 | JmjC_2 | 1.33 |
PF00255 | GSHPx | 1.33 |
PF00067 | p450 | 1.33 |
PF02627 | CMD | 0.89 |
PF07874 | DUF1660 | 0.89 |
PF16363 | GDP_Man_Dehyd | 0.89 |
PF00082 | Peptidase_S8 | 0.89 |
PF09360 | zf-CDGSH | 0.89 |
PF01583 | APS_kinase | 0.89 |
PF13662 | Toprim_4 | 0.44 |
PF13186 | SPASM | 0.44 |
PF00011 | HSP20 | 0.44 |
PF14579 | HHH_6 | 0.44 |
PF00154 | RecA | 0.44 |
PF13884 | Peptidase_S74 | 0.44 |
PF12849 | PBP_like_2 | 0.44 |
PF08241 | Methyltransf_11 | 0.44 |
PF05257 | CHAP | 0.44 |
PF02467 | Whib | 0.44 |
PF00085 | Thioredoxin | 0.44 |
PF01844 | HNH | 0.44 |
COG ID | Name | Functional Category | % Frequency in 225 Family Scaffolds |
---|---|---|---|
COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 7.56 |
COG3201 | Nicotinamide riboside transporter PnuC | Coenzyme transport and metabolism [H] | 4.89 |
COG1586 | S-adenosylmethionine decarboxylase | Amino acid transport and metabolism [E] | 2.67 |
COG0386 | Thioredoxin/glutathione peroxidase BtuE, reduces lipid peroxides | Defense mechanisms [V] | 1.33 |
COG2124 | Cytochrome P450 | Defense mechanisms [V] | 1.33 |
COG2850 | Ribosomal protein L16 Arg81 hydroxylase, contains JmjC domain | Translation, ribosomal structure and biogenesis [J] | 1.33 |
COG0529 | Adenylylsulfate kinase or related kinase | Inorganic ion transport and metabolism [P] | 0.89 |
COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 0.89 |
COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 0.89 |
COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 0.44 |
COG0468 | RecA/RadA recombinase | Replication, recombination and repair [L] | 0.44 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 86.22 % |
Unclassified | root | N/A | 13.78 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000736|JGI12547J11936_1043283 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 943 | Open in IMG/M |
3300000736|JGI12547J11936_1052858 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 818 | Open in IMG/M |
3300000756|JGI12421J11937_10002761 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7061 | Open in IMG/M |
3300000756|JGI12421J11937_10003086 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6699 | Open in IMG/M |
3300002161|JGI24766J26685_10122449 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 549 | Open in IMG/M |
3300002408|B570J29032_109816008 | All Organisms → Viruses → Predicted Viral | 1446 | Open in IMG/M |
3300002408|B570J29032_109823927 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1486 | Open in IMG/M |
3300002408|B570J29032_109955461 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7329 | Open in IMG/M |
3300002408|B570J29032_109957592 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10187 | Open in IMG/M |
3300002835|B570J40625_100028578 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8902 | Open in IMG/M |
3300003413|JGI25922J50271_10000832 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9070 | Open in IMG/M |
3300003430|JGI25921J50272_10061346 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 835 | Open in IMG/M |
3300003490|JGI25926J51410_1038296 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 866 | Open in IMG/M |
3300003491|JGI25924J51412_1038672 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 772 | Open in IMG/M |
3300004096|Ga0066177_10576380 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
3300004112|Ga0065166_10015057 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2176 | Open in IMG/M |
3300004112|Ga0065166_10448429 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 543 | Open in IMG/M |
3300005517|Ga0070374_10008346 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4977 | Open in IMG/M |
3300005517|Ga0070374_10045263 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2286 | Open in IMG/M |
3300005517|Ga0070374_10129605 | All Organisms → Viruses → Predicted Viral | 1312 | Open in IMG/M |
3300005517|Ga0070374_10129644 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1312 | Open in IMG/M |
3300005517|Ga0070374_10519161 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 594 | Open in IMG/M |
3300005517|Ga0070374_10556098 | Not Available | 571 | Open in IMG/M |
3300005517|Ga0070374_10630735 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 531 | Open in IMG/M |
3300005528|Ga0068872_10584611 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 593 | Open in IMG/M |
3300005583|Ga0049085_10003374 | Not Available | 6375 | Open in IMG/M |
3300005583|Ga0049085_10022833 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2361 | Open in IMG/M |
3300005585|Ga0049084_10083653 | Not Available | 1162 | Open in IMG/M |
3300005662|Ga0078894_10004379 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10797 | Open in IMG/M |
3300005662|Ga0078894_10006075 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9345 | Open in IMG/M |
3300005662|Ga0078894_10006587 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9005 | Open in IMG/M |
3300005662|Ga0078894_10008666 | Not Available | 7919 | Open in IMG/M |
3300005662|Ga0078894_10010359 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7313 | Open in IMG/M |
3300005662|Ga0078894_10036049 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4110 | Open in IMG/M |
3300005662|Ga0078894_10112094 | Not Available | 2419 | Open in IMG/M |
3300005662|Ga0078894_10390870 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1257 | Open in IMG/M |
3300005662|Ga0078894_10433917 | All Organisms → Viruses → Predicted Viral | 1184 | Open in IMG/M |
3300005662|Ga0078894_10440511 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1174 | Open in IMG/M |
3300005662|Ga0078894_10472708 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1128 | Open in IMG/M |
3300005662|Ga0078894_10708890 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 887 | Open in IMG/M |
3300005662|Ga0078894_10850175 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 795 | Open in IMG/M |
3300005662|Ga0078894_11088767 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
3300005662|Ga0078894_11091727 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 681 | Open in IMG/M |
3300005662|Ga0078894_11177282 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 650 | Open in IMG/M |
3300005662|Ga0078894_11233809 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 632 | Open in IMG/M |
3300005662|Ga0078894_11283145 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 617 | Open in IMG/M |
3300005662|Ga0078894_11433938 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 575 | Open in IMG/M |
3300005662|Ga0078894_11576399 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 543 | Open in IMG/M |
3300005662|Ga0078894_11620907 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 533 | Open in IMG/M |
3300005941|Ga0070743_10180316 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 696 | Open in IMG/M |
3300005941|Ga0070743_10282406 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 536 | Open in IMG/M |
3300005941|Ga0070743_10290525 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 528 | Open in IMG/M |
3300006484|Ga0070744_10033506 | All Organisms → Viruses → Predicted Viral | 1517 | Open in IMG/M |
3300006484|Ga0070744_10136322 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 705 | Open in IMG/M |
3300006639|Ga0079301_1020328 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 2325 | Open in IMG/M |
3300006641|Ga0075471_10142926 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1268 | Open in IMG/M |
3300006862|Ga0079299_1004880 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 3242 | Open in IMG/M |
3300006875|Ga0075473_10257469 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 706 | Open in IMG/M |
3300006917|Ga0075472_10156859 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1118 | Open in IMG/M |
3300007363|Ga0075458_10096179 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 923 | Open in IMG/M |
3300007547|Ga0102875_1015566 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium | 2536 | Open in IMG/M |
3300007559|Ga0102828_1003808 | All Organisms → Viruses → Predicted Viral | 2852 | Open in IMG/M |
3300007559|Ga0102828_1167653 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 555 | Open in IMG/M |
3300007590|Ga0102917_1046372 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1527 | Open in IMG/M |
3300007593|Ga0102918_1006705 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2848 | Open in IMG/M |
3300007618|Ga0102896_1201105 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 627 | Open in IMG/M |
3300007624|Ga0102878_1038618 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1476 | Open in IMG/M |
3300007630|Ga0102903_1158835 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 619 | Open in IMG/M |
3300007632|Ga0102894_1096829 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 777 | Open in IMG/M |
3300007634|Ga0102901_1195551 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 570 | Open in IMG/M |
3300007661|Ga0102866_1008706 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2310 | Open in IMG/M |
3300007708|Ga0102859_1183633 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 619 | Open in IMG/M |
3300007974|Ga0105747_1281600 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 561 | Open in IMG/M |
3300008055|Ga0108970_10158717 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3256 | Open in IMG/M |
3300008107|Ga0114340_1000945 | Not Available | 37020 | Open in IMG/M |
3300008107|Ga0114340_1001631 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 16716 | Open in IMG/M |
3300008107|Ga0114340_1003079 | All Organisms → cellular organisms → Bacteria | 13648 | Open in IMG/M |
3300008107|Ga0114340_1030212 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2490 | Open in IMG/M |
3300008107|Ga0114340_1064872 | Not Available | 1556 | Open in IMG/M |
3300008108|Ga0114341_10189727 | Not Available | 1158 | Open in IMG/M |
3300008113|Ga0114346_1091545 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1412 | Open in IMG/M |
3300008261|Ga0114336_1005715 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 17834 | Open in IMG/M |
3300008261|Ga0114336_1015534 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4587 | Open in IMG/M |
3300008261|Ga0114336_1042622 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2410 | Open in IMG/M |
3300008261|Ga0114336_1093624 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1856 | Open in IMG/M |
3300008962|Ga0104242_1056752 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 657 | Open in IMG/M |
3300008996|Ga0102831_1109869 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 917 | Open in IMG/M |
3300008996|Ga0102831_1271224 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 560 | Open in IMG/M |
3300009068|Ga0114973_10694684 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 518 | Open in IMG/M |
3300009152|Ga0114980_10084726 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1900 | Open in IMG/M |
3300009152|Ga0114980_10182314 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1238 | Open in IMG/M |
3300009155|Ga0114968_10012247 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6123 | Open in IMG/M |
3300009155|Ga0114968_10216374 | Not Available | 1103 | Open in IMG/M |
3300009158|Ga0114977_10000196 | Not Available | 39672 | Open in IMG/M |
3300009159|Ga0114978_10016929 | Not Available | 5455 | Open in IMG/M |
3300009159|Ga0114978_10383813 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 844 | Open in IMG/M |
3300009159|Ga0114978_10487758 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 725 | Open in IMG/M |
3300009161|Ga0114966_10039959 | Not Available | 3391 | Open in IMG/M |
3300009161|Ga0114966_10139824 | All Organisms → Viruses → Predicted Viral | 1586 | Open in IMG/M |
3300009161|Ga0114966_10140296 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1583 | Open in IMG/M |
3300009181|Ga0114969_10052403 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2724 | Open in IMG/M |
3300009194|Ga0114983_1139846 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 519 | Open in IMG/M |
3300009419|Ga0114982_1018132 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2367 | Open in IMG/M |
3300010354|Ga0129333_10850393 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 775 | Open in IMG/M |
3300010374|Ga0114986_1005128 | All Organisms → Viruses → Predicted Viral | 2865 | Open in IMG/M |
3300010374|Ga0114986_1035594 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 917 | Open in IMG/M |
3300010885|Ga0133913_11500251 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1708 | Open in IMG/M |
3300010885|Ga0133913_12148611 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1379 | Open in IMG/M |
3300010965|Ga0138308_106962 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7764 | Open in IMG/M |
3300011268|Ga0151620_1032480 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1773 | Open in IMG/M |
3300012017|Ga0153801_1009075 | Not Available | 1822 | Open in IMG/M |
3300012663|Ga0157203_1013978 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Neorhizobium → Neorhizobium galegae | 1256 | Open in IMG/M |
3300012665|Ga0157210_1000680 | Not Available | 12699 | Open in IMG/M |
3300013005|Ga0164292_10028373 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4523 | Open in IMG/M |
3300013006|Ga0164294_10471573 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 856 | Open in IMG/M |
3300014050|Ga0119952_1010848 | All Organisms → cellular organisms → Bacteria | 3587 | Open in IMG/M |
3300017766|Ga0181343_1016639 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2305 | Open in IMG/M |
3300017774|Ga0181358_1050710 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Neorhizobium → Neorhizobium galegae | 1571 | Open in IMG/M |
3300019784|Ga0181359_1221320 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 595 | Open in IMG/M |
3300020141|Ga0211732_1061301 | Not Available | 44174 | Open in IMG/M |
3300020141|Ga0211732_1076041 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2951 | Open in IMG/M |
3300020151|Ga0211736_10509849 | All Organisms → Viruses → Predicted Viral | 1364 | Open in IMG/M |
3300020151|Ga0211736_10884431 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1957 | Open in IMG/M |
3300020159|Ga0211734_10040526 | Not Available | 576 | Open in IMG/M |
3300020159|Ga0211734_11358516 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 842 | Open in IMG/M |
3300020161|Ga0211726_10835928 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1101 | Open in IMG/M |
3300020172|Ga0211729_11374494 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1066 | Open in IMG/M |
3300020483|Ga0207418_102158 | All Organisms → Viruses → Predicted Viral | 1614 | Open in IMG/M |
3300020498|Ga0208050_1000020 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 60220 | Open in IMG/M |
3300020498|Ga0208050_1012088 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 951 | Open in IMG/M |
3300020506|Ga0208091_1000440 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7659 | Open in IMG/M |
3300020524|Ga0208858_1015402 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1222 | Open in IMG/M |
3300020527|Ga0208232_1004478 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2341 | Open in IMG/M |
3300020543|Ga0208089_1004595 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2614 | Open in IMG/M |
3300021141|Ga0214163_1092395 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 711 | Open in IMG/M |
3300021519|Ga0194048_10116850 | All Organisms → Viruses → Predicted Viral | 1018 | Open in IMG/M |
3300021962|Ga0222713_10012089 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7669 | Open in IMG/M |
3300021962|Ga0222713_10013200 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7279 | Open in IMG/M |
3300021962|Ga0222713_10174619 | All Organisms → Viruses → Predicted Viral | 1460 | Open in IMG/M |
3300021962|Ga0222713_10308066 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1006 | Open in IMG/M |
3300021963|Ga0222712_10006739 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 11274 | Open in IMG/M |
3300021963|Ga0222712_10016365 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6367 | Open in IMG/M |
3300021963|Ga0222712_10121741 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1796 | Open in IMG/M |
3300022407|Ga0181351_1185503 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 711 | Open in IMG/M |
3300023174|Ga0214921_10000248 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae | 107027 | Open in IMG/M |
3300023174|Ga0214921_10075718 | All Organisms → Viruses → Predicted Viral | 2704 | Open in IMG/M |
3300023184|Ga0214919_10035144 | Not Available | 5110 | Open in IMG/M |
3300024343|Ga0244777_10000080 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 71570 | Open in IMG/M |
3300024343|Ga0244777_10063475 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2369 | Open in IMG/M |
3300024346|Ga0244775_10059204 | Not Available | 3313 | Open in IMG/M |
3300024346|Ga0244775_10360154 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1200 | Open in IMG/M |
3300024346|Ga0244775_10554732 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 935 | Open in IMG/M |
3300024346|Ga0244775_10707547 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 811 | Open in IMG/M |
3300024346|Ga0244775_11265121 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 572 | Open in IMG/M |
3300024346|Ga0244775_11403368 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 537 | Open in IMG/M |
3300024348|Ga0244776_10007942 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9393 | Open in IMG/M |
3300024348|Ga0244776_10455165 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 836 | Open in IMG/M |
3300024348|Ga0244776_10628808 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 673 | Open in IMG/M |
3300025635|Ga0208147_1155086 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 530 | Open in IMG/M |
3300027114|Ga0208009_1007257 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 2855 | Open in IMG/M |
3300027134|Ga0255069_1045378 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 509 | Open in IMG/M |
3300027135|Ga0255073_1058882 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 622 | Open in IMG/M |
3300027138|Ga0255064_1006721 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2146 | Open in IMG/M |
3300027217|Ga0208928_1006774 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1927 | Open in IMG/M |
3300027222|Ga0208024_1033465 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1002 | Open in IMG/M |
3300027240|Ga0208444_1016940 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1044 | Open in IMG/M |
3300027365|Ga0209300_1031864 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1034 | Open in IMG/M |
3300027365|Ga0209300_1073164 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 519 | Open in IMG/M |
3300027508|Ga0255072_1002838 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3875 | Open in IMG/M |
3300027531|Ga0208682_1025513 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1595 | Open in IMG/M |
3300027531|Ga0208682_1131155 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 571 | Open in IMG/M |
3300027563|Ga0209552_1097669 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 789 | Open in IMG/M |
3300027581|Ga0209651_1086973 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 892 | Open in IMG/M |
3300027597|Ga0255088_1108587 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 504 | Open in IMG/M |
3300027631|Ga0208133_1098229 | Not Available | 685 | Open in IMG/M |
3300027631|Ga0208133_1142397 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 554 | Open in IMG/M |
3300027642|Ga0209135_1253206 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 521 | Open in IMG/M |
3300027679|Ga0209769_1224001 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 578 | Open in IMG/M |
3300027679|Ga0209769_1253706 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 534 | Open in IMG/M |
3300027689|Ga0209551_1132819 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 789 | Open in IMG/M |
3300027710|Ga0209599_10005470 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4410 | Open in IMG/M |
3300027710|Ga0209599_10016544 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2131 | Open in IMG/M |
3300027720|Ga0209617_10048106 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1799 | Open in IMG/M |
3300027720|Ga0209617_10115059 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1076 | Open in IMG/M |
3300027733|Ga0209297_1211610 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 762 | Open in IMG/M |
3300027754|Ga0209596_1002320 | All Organisms → cellular organisms → Bacteria | 15741 | Open in IMG/M |
3300027754|Ga0209596_1007610 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7621 | Open in IMG/M |
3300027759|Ga0209296_1013272 | Not Available | 4864 | Open in IMG/M |
3300027769|Ga0209770_10003846 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7291 | Open in IMG/M |
3300027769|Ga0209770_10005669 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5910 | Open in IMG/M |
3300027769|Ga0209770_10220246 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 744 | Open in IMG/M |
3300027769|Ga0209770_10232410 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 719 | Open in IMG/M |
3300027782|Ga0209500_10040534 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2555 | Open in IMG/M |
3300027782|Ga0209500_10174441 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 991 | Open in IMG/M |
3300027797|Ga0209107_10000565 | Not Available | 21336 | Open in IMG/M |
3300027797|Ga0209107_10015490 | All Organisms → Viruses → Predicted Viral | 4342 | Open in IMG/M |
3300027797|Ga0209107_10034401 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2899 | Open in IMG/M |
3300027797|Ga0209107_10074913 | All Organisms → Viruses → Predicted Viral | 1859 | Open in IMG/M |
3300027805|Ga0209229_10391077 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 604 | Open in IMG/M |
3300027836|Ga0209230_10001646 | Not Available | 9011 | Open in IMG/M |
3300027892|Ga0209550_10033728 | Not Available | 4312 | Open in IMG/M |
3300027963|Ga0209400_1010842 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5765 | Open in IMG/M |
3300028025|Ga0247723_1027972 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1811 | Open in IMG/M |
3300028025|Ga0247723_1041001 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1377 | Open in IMG/M |
3300028027|Ga0247722_10002983 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8537 | Open in IMG/M |
3300028027|Ga0247722_10081957 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1208 | Open in IMG/M |
3300033981|Ga0334982_0037171 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2753 | Open in IMG/M |
3300033992|Ga0334992_0000229 | Not Available | 48211 | Open in IMG/M |
3300033992|Ga0334992_0046867 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2482 | Open in IMG/M |
3300034022|Ga0335005_0035881 | Not Available | 3401 | Open in IMG/M |
3300034062|Ga0334995_0198922 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1395 | Open in IMG/M |
3300034066|Ga0335019_0010009 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6490 | Open in IMG/M |
3300034066|Ga0335019_0175046 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 1400 | Open in IMG/M |
3300034068|Ga0334990_0002101 | Not Available | 11475 | Open in IMG/M |
3300034071|Ga0335028_0030672 | All Organisms → Viruses → Predicted Viral | 3712 | Open in IMG/M |
3300034082|Ga0335020_0435254 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 628 | Open in IMG/M |
3300034101|Ga0335027_0026114 | Not Available | 4905 | Open in IMG/M |
3300034102|Ga0335029_0041793 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3404 | Open in IMG/M |
3300034106|Ga0335036_0007466 | Not Available | 9146 | Open in IMG/M |
3300034106|Ga0335036_0046537 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3340 | Open in IMG/M |
3300034111|Ga0335063_0011956 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5575 | Open in IMG/M |
3300034166|Ga0335016_0370027 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 848 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 23.11% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 10.67% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 9.78% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 9.33% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 5.78% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 4.89% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 4.89% |
Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 4.89% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 4.44% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 3.11% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 2.67% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 2.22% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 2.22% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment | 1.78% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 1.78% |
Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 1.78% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 1.33% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 1.33% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.89% |
Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.44% |
Lake Chemocline | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake Chemocline | 0.44% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.44% |
Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.44% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.44% |
Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.44% |
Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 0.44% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000736 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 | Environmental | Open in IMG/M |
3300000756 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 | Environmental | Open in IMG/M |
3300002161 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA | Environmental | Open in IMG/M |
3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
3300003413 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD | Environmental | Open in IMG/M |
3300003430 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD | Environmental | Open in IMG/M |
3300003490 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN | Environmental | Open in IMG/M |
3300003491 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD | Environmental | Open in IMG/M |
3300004096 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 2) | Environmental | Open in IMG/M |
3300004112 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2) | Environmental | Open in IMG/M |
3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
3300005583 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF | Environmental | Open in IMG/M |
3300005585 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF | Environmental | Open in IMG/M |
3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
3300005941 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 | Environmental | Open in IMG/M |
3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
3300006639 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 | Environmental | Open in IMG/M |
3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
3300006862 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series LW 2014_7_11 | Environmental | Open in IMG/M |
3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
3300006917 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA | Environmental | Open in IMG/M |
3300007363 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA | Environmental | Open in IMG/M |
3300007547 | Estuarine microbial communities from the Columbia River estuary - metaG 1547B-02 | Environmental | Open in IMG/M |
3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
3300007590 | Estuarine microbial communities from the Columbia River estuary - metaG 1562A-02 | Environmental | Open in IMG/M |
3300007593 | Estuarine microbial communities from the Columbia River estuary - metaG 1563A-3 | Environmental | Open in IMG/M |
3300007618 | Estuarine microbial communities from the Columbia River estuary - metaG 1554A-02 | Environmental | Open in IMG/M |
3300007624 | Estuarine microbial communities from the Columbia River estuary - metaG 1548A-02 | Environmental | Open in IMG/M |
3300007630 | Estuarine microbial communities from the Columbia River estuary - metaG 1555C-02 | Environmental | Open in IMG/M |
3300007632 | Estuarine microbial communities from the Columbia River estuary - metaG 1554A-3 | Environmental | Open in IMG/M |
3300007634 | Estuarine microbial communities from the Columbia River estuary - metaG 1555A-02 | Environmental | Open in IMG/M |
3300007661 | Estuarine microbial communities from the Columbia River estuary - metaG 1546A-3 | Environmental | Open in IMG/M |
3300007708 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 | Environmental | Open in IMG/M |
3300007974 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um | Environmental | Open in IMG/M |
3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
3300008261 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA | Environmental | Open in IMG/M |
3300008962 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT5 | Environmental | Open in IMG/M |
3300008996 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 | Environmental | Open in IMG/M |
3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
3300009194 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 RT | Environmental | Open in IMG/M |
3300009419 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT | Environmental | Open in IMG/M |
3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
3300010374 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S-1-Day17 | Environmental | Open in IMG/M |
3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
3300010965 | Microbial communities from Lake Cadagno chemocline, Switzerland. Combined Assembly of Gp0156211, Gp0156621 | Environmental | Open in IMG/M |
3300011268 | Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555 | Environmental | Open in IMG/M |
3300012017 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m | Environmental | Open in IMG/M |
3300012663 | Freshwater microbial communities from Indian River, Ontario, Canada - S50 | Environmental | Open in IMG/M |
3300012665 | Freshwater microbial communities from Talbot River, Ontario, Canada - S11 | Environmental | Open in IMG/M |
3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
3300013006 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaG | Environmental | Open in IMG/M |
3300014050 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007B | Environmental | Open in IMG/M |
3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
3300020483 | Freshwater microbial communities from Lake Mendota, WI - 05AUG2008 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020498 | Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020506 | Freshwater microbial communities from Lake Mendota, WI - 26OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020524 | Freshwater microbial communities from Lake Mendota, WI - 16NOV2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020527 | Freshwater microbial communities from Lake Mendota, WI - 24AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020543 | Freshwater microbial communities from Lake Mendota, WI - 29JUN2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300021141 | Freshwater microbial communities from Lake Mendota, WI - Practice 15JUN2010 epilimnion | Environmental | Open in IMG/M |
3300021438 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17 MG | Environmental | Open in IMG/M |
3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
3300024343 | Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction | Environmental | Open in IMG/M |
3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
3300025635 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300027114 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16 (SPAdes) | Environmental | Open in IMG/M |
3300027134 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepA_8h | Environmental | Open in IMG/M |
3300027135 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepB_8h | Environmental | Open in IMG/M |
3300027138 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_0h | Environmental | Open in IMG/M |
3300027217 | Estuarine microbial communities from the Columbia River estuary - metaG 1547A-3 (SPAdes) | Environmental | Open in IMG/M |
3300027222 | Estuarine microbial communities from the Columbia River estuary - metaG 1546B-02 (SPAdes) | Environmental | Open in IMG/M |
3300027240 | Estuarine microbial communities from the Columbia River estuary - metaG 1555A-3 (SPAdes) | Environmental | Open in IMG/M |
3300027365 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 RT (SPAdes) | Environmental | Open in IMG/M |
3300027508 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepA_8h | Environmental | Open in IMG/M |
3300027531 | Estuarine microbial communities from the Columbia River estuary - metaG 1568-02 (SPAdes) | Environmental | Open in IMG/M |
3300027563 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
3300027581 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
3300027597 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepB_8d | Environmental | Open in IMG/M |
3300027631 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes) | Environmental | Open in IMG/M |
3300027642 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
3300027679 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
3300027689 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
3300027710 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes) | Environmental | Open in IMG/M |
3300027720 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027769 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes) | Environmental | Open in IMG/M |
3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
3300027836 | Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion Metagenome (SPAdes) | Environmental | Open in IMG/M |
3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
3300028027 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 3H_FC | Environmental | Open in IMG/M |
3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
3300033992 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035 | Environmental | Open in IMG/M |
3300034022 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Apr2018-rr0058 | Environmental | Open in IMG/M |
3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
3300034068 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Apr2016-rr0031 | Environmental | Open in IMG/M |
3300034071 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110 | Environmental | Open in IMG/M |
3300034082 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088 | Environmental | Open in IMG/M |
3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
3300034111 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Oct2011-rr0186 | Environmental | Open in IMG/M |
3300034166 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Sep2012-rr0079 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12547J11936_10432833 | 3300000736 | Freshwater And Sediment | MGKERLRMREPKIMKMDWRPLGYWPVYKDGKLTWEKDPDVRDE* |
JGI12547J11936_10528581 | 3300000736 | Freshwater And Sediment | MREPKIMKMDWRPLGYWPVYKDGKLTWEKDPDVQDE* |
JGI12421J11937_100027611 | 3300000756 | Freshwater And Sediment | MKEPKIMKMDWRPLGYWPVYKDGKLTWEKDPDVQD |
JGI12421J11937_1000308611 | 3300000756 | Freshwater And Sediment | MKEPKIMKMDWRSLGYWPVYKDGKLTWEKDPDKNVN* |
JGI24766J26685_101224492 | 3300002161 | Freshwater And Sediment | MAEAKIMRMDWRSLGYWPVYKDGRLEWEPDKDKE* |
B570J29032_1098160083 | 3300002408 | Freshwater | MREPKIIKMDWRPLGYWPVYKDGKLTWEKDPNENVN* |
B570J29032_1098239275 | 3300002408 | Freshwater | MKEPKIMKMDWRSLGYWPVYKDGKLTWEKDPKEDVQ* |
B570J29032_1099554611 | 3300002408 | Freshwater | MKEPRIMKMDWRSLGYWPVYKDGNLTWEKDPKEDVQ* |
B570J29032_1099575921 | 3300002408 | Freshwater | MKEPKIISMDWRGLGYWPVWKDGRIVWEKEDKETCD* |
B570J40625_10002857819 | 3300002835 | Freshwater | VKEPRIMKMDWRSLGYWPVYKDGKLTWERDPDEAEDNLLL* |
B570J40625_1016050012 | 3300002835 | Freshwater | VKEPKIMKMDWRSLGYWPVYKDGKLTWEKDTDEKEDNLLL* |
JGI25922J50271_1000083212 | 3300003413 | Freshwater Lake | LAEINVSREAKIMRMDWRSLGYWPVYKDGKLTWEKDPDENVN* |
JGI25921J50272_100613462 | 3300003430 | Freshwater Lake | LAEINVSTAKIMRMDWRSLGYWPVYKDGQLTWEKNPEHDVQ* |
JGI25926J51410_10382962 | 3300003490 | Freshwater Lake | LAAIDVSKEAKIMXMDWRXXGYWPVYKDGKLTWEKDPDVRDE* |
JGI25924J51412_10386722 | 3300003491 | Freshwater Lake | MGKERLRMKEPKIMKMDWRPLGYWPVYKDGKLTWEKDPDENVN* |
Ga0066177_105763803 | 3300004096 | Freshwater Lake | AAIDVSKEAKIMRMDWRSLGYWPVYKDGKLTWEKDSDDVQ* |
Ga0065166_100150576 | 3300004112 | Freshwater Lake | MAEPKIMRMDWRQLNYWPVYRDGRLEWEKDPDDRRKDSRV* |
Ga0065166_104484291 | 3300004112 | Freshwater Lake | VSYLQKLAAIDVSREAKIMRMDWRSLGYWPVYKDGKLTWEKDPDSGEQVR* |
Ga0070374_1000834617 | 3300005517 | Freshwater Lake | MKEPKIMKMDWRPLGYWPVYKDGKLTWEKDPKDD* |
Ga0070374_100452633 | 3300005517 | Freshwater Lake | MKEPKIMKMDWRSLGYWPVYKDGKLTWEKDPDEDVN* |
Ga0070374_101296053 | 3300005517 | Freshwater Lake | MKEPKIMKMDWRSLGYWPVYKDGKLTWEKDTDENVN* |
Ga0070374_101296443 | 3300005517 | Freshwater Lake | LAEINVNIEPKIMRMDWRSLGYWPVYKDGKLTWEKDPDENVN* |
Ga0070374_105191611 | 3300005517 | Freshwater Lake | MEGFMVKEPKIMKMDWRPLGYWPVYKDGKLTWEKDPDENVN* |
Ga0070374_105560982 | 3300005517 | Freshwater Lake | MREPKIMKMDWRPLGYWPVYKDGKLTWEKDPDENVN* |
Ga0070374_106307352 | 3300005517 | Freshwater Lake | MKEPKIMKMDWRPLGYWPVYKDGKLTWEKDPEDND* |
Ga0068872_105846112 | 3300005528 | Freshwater Lake | MKEPKIMKMDWRSLGYWPVYKDGKLTWEKDIDENVN* |
Ga0049085_100033744 | 3300005583 | Freshwater Lentic | MKEPKIMKMDWRPLGYWPVYKDGKLTWEKDPEND* |
Ga0049085_1002283310 | 3300005583 | Freshwater Lentic | MGCGVPTEPKIMRMDWRSLGYWPVYKDGKLIWEKDPEND* |
Ga0049084_100836532 | 3300005585 | Freshwater Lentic | MKEPKIMKMDWRPLGYWPVYKDGKLTWEKDPENND* |
Ga0078894_1000437914 | 3300005662 | Freshwater Lake | MPNKEPKIMKMDWRSLGYWPVYKDGKMTWEKDPDERTAV* |
Ga0078894_100060753 | 3300005662 | Freshwater Lake | MKEPKIMKMDWRSLGYWPVYKDGKLKWEKDPKEDVQ* |
Ga0078894_1000658711 | 3300005662 | Freshwater Lake | MKEPKIMKMDWRPLGYWPVYKDGKLTWEKDTDVQDE* |
Ga0078894_1000866612 | 3300005662 | Freshwater Lake | MKEPKIMKMDWRSLGYWPVYKDGKLTWEKEPENND* |
Ga0078894_1001035916 | 3300005662 | Freshwater Lake | MKEPKIMKMDWRSLGYWPVYKDGNLTWEKDPDNDVQ* |
Ga0078894_100360497 | 3300005662 | Freshwater Lake | MREPKIMKMDWRPLGYWPVYKDGKLTWEKDPDEDVN* |
Ga0078894_101120944 | 3300005662 | Freshwater Lake | MKEPKIMKMDWRPLGYWPVYKDGKLTWEKDPDENVN* |
Ga0078894_103908701 | 3300005662 | Freshwater Lake | MKEPKIMKMDWRPLGYWPVYKDGKLTWEKDPDNEV* |
Ga0078894_104339173 | 3300005662 | Freshwater Lake | LAEINVSREPKIMRMDWRSLGYWPVYKDGKLTWEKDPDENVN* |
Ga0078894_104405111 | 3300005662 | Freshwater Lake | MREPKIMKMDWRSLGYWPVYKDGKLTWEKDPENEKA* |
Ga0078894_104727082 | 3300005662 | Freshwater Lake | MKEPRIMKMDWRSLGYWPVYKDGKLTWKKDPDEEHNNLSF* |
Ga0078894_107088901 | 3300005662 | Freshwater Lake | LAAIDVSREAKIMRMDWRSLGYWPVYKDGKLTWEKDPDENVN* |
Ga0078894_108501752 | 3300005662 | Freshwater Lake | MKEPKIMKMDWRPLGYWPVYKDGKLTWEKDPSDGE* |
Ga0078894_110887671 | 3300005662 | Freshwater Lake | MKEPKIMKMDWRSLGYWPVYKDGKLTWEKESDAN* |
Ga0078894_110917273 | 3300005662 | Freshwater Lake | SYLQKLAAIDVSREAKIMRMDWRSLGYWPVYKDGKLTWEKDPKDD* |
Ga0078894_111772823 | 3300005662 | Freshwater Lake | MKEPKIMKMDWRSLGYWPVYKDGKLTWEKDPDDAK* |
Ga0078894_112338093 | 3300005662 | Freshwater Lake | MKEPKIMKMDWRSLGYWPVYKDGKLTWEKDPEND* |
Ga0078894_112831453 | 3300005662 | Freshwater Lake | VSKEAKIMRMDWRSLGYWPVYKDGKLTWEKDPDNGEQVR* |
Ga0078894_114339381 | 3300005662 | Freshwater Lake | MKEPKIMKMDWRSLGYWPVYKDGKLTWEKDTKNDS* |
Ga0078894_115763992 | 3300005662 | Freshwater Lake | MKEPKIMKMDWRPLGYWPVYKDGKLTWEKDPDND* |
Ga0078894_116209073 | 3300005662 | Freshwater Lake | MKEPKIMKMDWRSLGYWPIYKDGKLTWEKDPDEDVN* |
Ga0070743_101803162 | 3300005941 | Estuarine | MKEPKIMKMDWRSLGYWPVYKDGKLTWEKDPDVQDE* |
Ga0070743_102824062 | 3300005941 | Estuarine | VKEPKIMKMDWRPLGYWPVYKDGKLTWEKDPENND* |
Ga0070743_102905251 | 3300005941 | Estuarine | MGKERLRMKEPKIMKMDWRPLGYWPVYKDGKLTWEKDPDVQDE* |
Ga0070744_100335063 | 3300006484 | Estuarine | MREPKIMRMDWRPLGYWPVYRDGKLEWEKDSEDVQ* |
Ga0070744_101363223 | 3300006484 | Estuarine | MREPRIMKMDWRSLGYWPVYKDGKLTWEKDPDVQDE* |
Ga0079301_10203286 | 3300006639 | Deep Subsurface | MKEPKIMSMDWRGLGYWPVWKDGRIVWEKEDKENL* |
Ga0075471_101429262 | 3300006641 | Aqueous | MAEPKIMRMDWRPLGYWPVYRDGRLEWEKDPDDRRKNSRV* |
Ga0079299_10048808 | 3300006862 | Deep Subsurface | MKELKIMSMDWRGLGYWPVWKDGRIVWEKEDKENL* |
Ga0075473_102574691 | 3300006875 | Aqueous | MAEPKIMRMDWRPLGYWPVYRDGRLEWEKDPDDRRKDS |
Ga0075472_101568593 | 3300006917 | Aqueous | MTEPKIMRMDWRQLGYWPVYRDGRLEWEKDTDDRRKDSRV* |
Ga0075458_100961793 | 3300007363 | Aqueous | MKEPKIMKMDWRSLGYWPVYKEGKLTWEKDDTNEFN* |
Ga0102875_10155662 | 3300007547 | Estuarine | LAEIDVSKEPKIMRMDWRSLGYWPVYKDGKLTWEKDPKND* |
Ga0102828_10038082 | 3300007559 | Estuarine | MKEPKIMKMDWRPLGYWPVYKDGKLTWEKESDAN* |
Ga0102828_11676532 | 3300007559 | Estuarine | MKEPKIMKMDWRSLGYWPVYKDGKLTWEKDPKND* |
Ga0102917_10463723 | 3300007590 | Estuarine | MKEPKIMKMDWRSLGYWPVYKDGKLTWEKDPDKDDN* |
Ga0102918_10067058 | 3300007593 | Estuarine | VSKEPKIMRMDWRSLGYWPVYKDGKLTWEKDPKND* |
Ga0102896_12011051 | 3300007618 | Estuarine | MKEPKIMKMDWRPLGYWPVYKDGKLTWEKDPDKDDN* |
Ga0102878_10386186 | 3300007624 | Estuarine | LQKLAEIDVSKEPKIMRMDWRSLGYWPVYKDGKLTWEKDPKND* |
Ga0102903_11588353 | 3300007630 | Estuarine | VSKEPKIMRMDWRSLGYWPVYKDGKLTWEKDPDVQDE* |
Ga0102894_10968291 | 3300007632 | Estuarine | YMREPKIMKMDWRSLGYWPVYKDGKLTWEKEPDND* |
Ga0102901_11955512 | 3300007634 | Estuarine | LAAIDVSKEAKIMRMDWRSLGYWPVYKDGKLTWEKDP |
Ga0102866_10087067 | 3300007661 | Estuarine | LAEIDVSKEAKIMRMDWRSLGYWPVYKDGKLTWEKDPKND* |
Ga0102859_11836332 | 3300007708 | Estuarine | MKEPKIMKMDWRPLGYWPVYKDGKLTWEKDPEGND* |
Ga0105747_12816002 | 3300007974 | Estuary Water | MKEPKIMKMDWRSLGYWPVYKDGKLTWEKDPENND* |
Ga0108970_1015871710 | 3300008055 | Estuary | LAAIDVSKEAKIMRMDWRSLGYWPVYKDGKLTWEKDPDVQDE* |
Ga0114340_10009457 | 3300008107 | Freshwater, Plankton | MREPKIMKMDWRSLGYWPVYKDGKLTWEKDPDENAN* |
Ga0114340_100163130 | 3300008107 | Freshwater, Plankton | MKEPRIMKMDWRPLGYWPVYKDGKLTWEKDPDENVN* |
Ga0114340_100307928 | 3300008107 | Freshwater, Plankton | MNEPKIMKMDWRPLGYWPVYRDGRLEWEKDPDND* |
Ga0114340_10302126 | 3300008107 | Freshwater, Plankton | VSREAKIMRMDWRSLGYWPVYKDGKLTWEKDPDENVN* |
Ga0114340_10648723 | 3300008107 | Freshwater, Plankton | MREPKIMKMDWRPLGYWPVYNDGKLTWEKDPDKDVN* |
Ga0114341_101897271 | 3300008108 | Freshwater, Plankton | MREPKIMKMDWRPLGYWPVYNDGKLTWEKDPDVQD |
Ga0114346_10915454 | 3300008113 | Freshwater, Plankton | LAAIDVSKEPKIMRMDWRSLGYWPVYKDGKLTWKKDPDENVN* |
Ga0114336_100571547 | 3300008261 | Freshwater, Plankton | MKEPKIMKMDWRSLGYWPVYKDGKLTWEKDPEDVQ* |
Ga0114336_101553411 | 3300008261 | Freshwater, Plankton | VSREPKIMRMDWRSLGYWPVYKDGKLTWEKDPDENVN* |
Ga0114336_10426226 | 3300008261 | Freshwater, Plankton | VSREAKIMRMDWRSLGYWPVYKDGKLTWEKDPNENVN* |
Ga0114336_10936241 | 3300008261 | Freshwater, Plankton | LAAIDVSREAKIMRMDWRSLGYWPVYKDGKLTWEKDP |
Ga0104242_10567522 | 3300008962 | Freshwater | MSEPKIMKMDWRSLGYWPVYRDGRLEWEKDKSEEIYN* |
Ga0102831_11098692 | 3300008996 | Estuarine | MKEPKIMKMDWRSLGYWPVYKNGKLTWEKESDVQDE* |
Ga0102831_12712241 | 3300008996 | Estuarine | MREPKIMKMDWRPLGYWPVYKDGKLTWEKDPDENV |
Ga0114973_106946842 | 3300009068 | Freshwater Lake | MKEPKIMKMDWRSLGYWPVYKDGKLTWEKDPDNAN* |
Ga0114980_100847263 | 3300009152 | Freshwater Lake | MKEPKIMSMDWRGLGYWPVWKDGKIVWEKEDKENL* |
Ga0114980_101823143 | 3300009152 | Freshwater Lake | MREPKIMKMDWRSLGYWPVYKDGKLTWEKDPEND* |
Ga0114968_100122475 | 3300009155 | Freshwater Lake | VSKEPKIMRMDWRPLGYWPVYKDGKLTWEKDPDENVN* |
Ga0114968_102163742 | 3300009155 | Freshwater Lake | MSKEPKIMKMDWRSLGYWPVWKDGKIVWEKDPHDK* |
Ga0114977_1000019666 | 3300009158 | Freshwater Lake | MKEPKIMKMDWRSLGYWPVYKDGKLTWEKDPKDD* |
Ga0114978_1001692913 | 3300009159 | Freshwater Lake | MKEPKIMKMDWRPLGYWPVYKDGKLTWEKDPKNND* |
Ga0114978_103838132 | 3300009159 | Freshwater Lake | MKEPKIIKMDWRSLGYWPVYKDGKLTWEKDPDNAN* |
Ga0114978_104877583 | 3300009159 | Freshwater Lake | MKEPKIMSMDWRGLGYWPVWKDGRIVWEKEDDSQ* |
Ga0114966_100399593 | 3300009161 | Freshwater Lake | MKEPKIMKMDWRSLGYWPVYKDNKLTWEKDSKND* |
Ga0114966_101398242 | 3300009161 | Freshwater Lake | MKEPKIMKMDWRPLGYWPVYKNGKLTWEKDPDNVV* |
Ga0114966_101402966 | 3300009161 | Freshwater Lake | MKEPKIMSMDWRGLGYWPVWKDGRIVWEKEDKKNL* |
Ga0114969_100524037 | 3300009181 | Freshwater Lake | MREPKIMKMDWRSLGYWPVYKDGKLTWEKDPEKND* |
Ga0114983_11398462 | 3300009194 | Deep Subsurface | MPRSIMEMDWRALGYWPVYKDGKLKWEKDPDKDDN* |
Ga0114982_10181324 | 3300009419 | Deep Subsurface | MPNKEPKIMRMDWRSLGYWPVYKDGKLTWEKDPDERTTV* |
Ga0129333_108503932 | 3300010354 | Freshwater To Marine Saline Gradient | MREPKIMKMDWRSLGYWPVYKDGKLTWEKDPENEKVFN* |
Ga0114986_10051286 | 3300010374 | Deep Subsurface | MREPKIMKMDWRPLGYWPVYNDGKLTWEKDPDEDVN* |
Ga0114986_10355944 | 3300010374 | Deep Subsurface | EYMREPKIMKMDWRPLGYWPVYKDGKLTWEKDPDEDVN* |
Ga0133913_115002515 | 3300010885 | Freshwater Lake | MKEPKIMKMDWRSLGYWPVYKDGKLTWEKDSKDD* |
Ga0133913_121486112 | 3300010885 | Freshwater Lake | MKEPKIMKMDWRSLGYWPVYKDGKLTWEKDTDNDN* |
Ga0138308_10696215 | 3300010965 | Lake Chemocline | MKEPKIMKMDWRSLGYWPVYKDGKLTWEKDPEKDAV* |
Ga0151620_10324802 | 3300011268 | Freshwater | MREPKIMKMDWRSLGYWPVYKDGKLTWEKDPYVQDE* |
Ga0153801_10090752 | 3300012017 | Freshwater | MKDPKIMKMDWRPLGYWPVYKDGKITWEKDVEKNEKSYR* |
Ga0157203_10139783 | 3300012663 | Freshwater | MKEPKIMKMDWRPLGYWPVYKDGKLTWEKDPDVQDE* |
Ga0157210_10006808 | 3300012665 | Freshwater | VKEPKIMKMDWRPLGYWPVYTDGKLTWEKDSDEE* |
Ga0164292_1002837314 | 3300013005 | Freshwater | MNEPKIMKMDWRPLGYWPVYRDGRLEWEKDPDNDR* |
Ga0164294_104715734 | 3300013006 | Freshwater | NSGGSMKEPKIMKMDWRPLGYWPVYKDGKLTWEKDPKNND* |
Ga0119952_10108485 | 3300014050 | Freshwater | VSREAKIMRMDWRSLGYWPVYKDGKLTWEKDPDEDVN* |
Ga0181343_10166399 | 3300017766 | Freshwater Lake | LAEINVSREAKIMRMDWRSLGYWPVYKDGKLTWEKDPDENVN |
Ga0181358_10507102 | 3300017774 | Freshwater Lake | MKEPKIMKMDWRPLGYWPVYKDGKLIWEKDPENND |
Ga0181359_12213202 | 3300019784 | Freshwater Lake | MKEPKIMKMDWRSLGYWPVYKDGKLTWEKDTDENVN |
Ga0211732_106130171 | 3300020141 | Freshwater | MPNKEPKIMKMDWRSLGYWPVYKDGKLTWEKDPKDD |
Ga0211732_10760416 | 3300020141 | Freshwater | MGKERLRMREPKIMKMDWRPLGYWPVYKDGKLTWEKDPDENVN |
Ga0211736_105098491 | 3300020151 | Freshwater | MKEPKIMKMDWRSLGYWPVYKDGKLTWEKDPKDAR |
Ga0211736_108844315 | 3300020151 | Freshwater | MREPKIMKMDWRPLGYWPVYKDGKLTWEKDPDENVN |
Ga0211734_100405262 | 3300020159 | Freshwater | MGKERLRMREPKIMKMDWRPLGYWPVYKDGKLTWEKDPDKDVN |
Ga0211734_113585162 | 3300020159 | Freshwater | MKEPKIMKMDWRSLGYWPVYKDGKLTWEKDPEENVQ |
Ga0211726_108359282 | 3300020161 | Freshwater | MKEPKIMKMDWRSLGYWPVYKDGKLTWEKDPNENVN |
Ga0211729_113744941 | 3300020172 | Freshwater | YMREPKIMKMDWRPLGYWPVYKDGKLTWEKDPDENVN |
Ga0207418_1021582 | 3300020483 | Freshwater | MKEPKIMKMDWRSLGYWPVYKDGKLTWEKDIDENVN |
Ga0208050_100002016 | 3300020498 | Freshwater | MKEPKIMKMDWRPLGYWPVYKDGKLTWEKDPDENVN |
Ga0208050_10120881 | 3300020498 | Freshwater | VKEPKIMKMDWRSLGYWPVYKDGKLTWEKDTDEKEDNLLL |
Ga0208091_10004401 | 3300020506 | Freshwater | MKEPKIISMDWRGLGYWPVWKDGRIVWEKEDKETCD |
Ga0208858_10154022 | 3300020524 | Freshwater | VKEPRIMKMDWRSLGYWPVYKDGKLTWERDPDEAEDNLLL |
Ga0208232_10044781 | 3300020527 | Freshwater | MKESSIFRMDWKSLGYWPVYKDGRLVWEKDDNHED |
Ga0208089_10045956 | 3300020543 | Freshwater | MKEPRIMKMDWRSLGYWPVYKDGNLTWEKDPKEDVQ |
Ga0214163_10923953 | 3300021141 | Freshwater | FFLMKEPKIMKMDWRSLGYWPAYKNGKLTWEKDPENDSVVS |
Ga0213920_10544763 | 3300021438 | Freshwater | MKEPSILRMDWKALGYWPVYKDGKLTWEKDESIRDS |
Ga0194048_101168503 | 3300021519 | Anoxic Zone Freshwater | ILYNRIMKEPKIMKMDWRSLGYWPVYKDGKLTWEKDTDNDN |
Ga0222713_1001208916 | 3300021962 | Estuarine Water | MKEPRIMKMDWRSLGYWPVYKDGKLTWEKDPDEDVQ |
Ga0222713_100132003 | 3300021962 | Estuarine Water | MQEPKIMKMDWRPLGYWPVYKDGKLTWEKDPDKDVN |
Ga0222713_101746192 | 3300021962 | Estuarine Water | MKEPKIMKMDWRSLGYWPVYKNGKLTWEKESDVQDE |
Ga0222713_103080664 | 3300021962 | Estuarine Water | SGTKMAEPKIMRMDWRSLGYWPVYKDGRLEWEKDQDDSSRP |
Ga0222712_1000673911 | 3300021963 | Estuarine Water | MKEPKIMKMDWRSLGYWPVYKDGKLTWEKDPDVQDE |
Ga0222712_100163652 | 3300021963 | Estuarine Water | MKEPKIMKMDWRPLGYWPVYKDGKLTWEKDPDELK |
Ga0222712_101217416 | 3300021963 | Estuarine Water | GTKMAEPKIMRMDWRSLGYWPVYKDGRLEWEKDQDDSSRP |
Ga0181351_11855032 | 3300022407 | Freshwater Lake | MKEPKIMKMDWRPLGYWPVYKDGKLTWEKDPDDRND |
Ga0214921_10000248100 | 3300023174 | Freshwater | MKETKIMKMDWRSLGYWPVYKDGKLTWEKDPENND |
Ga0214921_100757187 | 3300023174 | Freshwater | MKEPKIMKMDWRSLGYWPVYKDGKLTWEKDTKNDS |
Ga0214919_1003514415 | 3300023184 | Freshwater | MKEPKIMKMDWRPLGYWPVYKEGKLTWEKDPDNAN |
Ga0244777_1000008098 | 3300024343 | Estuarine | VSKEPKIMRMDWRSLGYWPVYKDGKLTWEKDPKND |
Ga0244777_100634757 | 3300024343 | Estuarine | MREPKIMKMDWRPLGYWPVYKDGKLTWEKDPDVQDE |
Ga0244775_100592047 | 3300024346 | Estuarine | MSKEPKIMKMDWRSLGYWPVWKDGKIVWEKDPYDK |
Ga0244775_103601545 | 3300024346 | Estuarine | MKEPKIMKMDWRSLGYWPVYKDGKLTWEKDPEKND |
Ga0244775_105547322 | 3300024346 | Estuarine | MKEPKIMKMDWRSLGYWPVYKDGKLTWEKDPENND |
Ga0244775_107075472 | 3300024346 | Estuarine | VKEPKIMKMDWRPLGYWPVYKDGKLTWEKDPENND |
Ga0244775_112651212 | 3300024346 | Estuarine | MKEPKIMKMDWRPLGYWPVYRDGKLTWEKDPEEEENDD |
Ga0244775_114033681 | 3300024346 | Estuarine | MKEPKIMKMDWRSLGYWPAYKDGKLTWEKDPGEQRINNN |
Ga0244776_1000794219 | 3300024348 | Estuarine | MKEPKIMKMDWRPLGYWPVYKDGKLTWEKDPENND |
Ga0244776_104551654 | 3300024348 | Estuarine | MREPKIMKMDWRPLGYWPVYKDGKLTWEKDPDEDVN |
Ga0244776_106288082 | 3300024348 | Estuarine | MKEPKIMKMDWRPLGYWPVYKDGKLTWEKDPEGND |
Ga0208147_11550861 | 3300025635 | Aqueous | MKEPKIMKMDWRSLGYWPVYKEGKLTWEKDDTNEFN |
Ga0208009_10072575 | 3300027114 | Deep Subsurface | MKEPKIMSMDWRGLGYWPVWKDGRIVWEKEDKENL |
Ga0255069_10453782 | 3300027134 | Freshwater | MAEPKIMRMDWRQLGYWPVYRDGRLEWEKDPDDRRKDSRV |
Ga0255073_10588823 | 3300027135 | Freshwater | LAAIDVSKEAKIMRMDWRSLGYWPVYKDGKLTWEKDPDVQDE |
Ga0255064_10067219 | 3300027138 | Freshwater | HMREPKIMKMDWRPLGYWPVYKDGKLTWEKDPDENVN |
Ga0208928_10067746 | 3300027217 | Estuarine | ISYLQKLAEIDVSKEPKIMRMDWRSLGYWPVYKDGKLTWEKEPDND |
Ga0208024_10334653 | 3300027222 | Estuarine | LAEIDVSKEPKIMRMDWRSLGYWPVYKDGKLTWEKDPKND |
Ga0208444_10169402 | 3300027240 | Estuarine | LAEIDVSKEPKIMRMDWRSLGYWPVYKDGKLTWEKEPDND |
Ga0209300_10318643 | 3300027365 | Deep Subsurface | LYNKYMREPKIMKMDWRPLGYWPVYNDGKLTWEKDPDEDVN |
Ga0209300_10731642 | 3300027365 | Deep Subsurface | MPRSIMEMDWRALGYWPVYKDGKLKWEKDPDKDDN |
Ga0255072_10028382 | 3300027508 | Freshwater | VSKEAKIMRMDWRSLGYWPVYKDGKLTWEKDPDVQDE |
Ga0208682_10255131 | 3300027531 | Estuarine | IYMREPKIMKMDWRSLGYWPVYKDGKLTWEKEPDND |
Ga0208682_11311551 | 3300027531 | Estuarine | ISYLQKLAEIDVSKEPKIMRMDWRSLGYWPVYKDGKLTWEKDPKND |
Ga0209552_10976693 | 3300027563 | Freshwater Lake | MGKERLRMKEPKIMKMDWRPLGYWPVYKDGKLTWEKDPDENVN |
Ga0209651_10869732 | 3300027581 | Freshwater Lake | LAAIDVSKEAKIMRMDWRSLGYWPVYKDGKLTWEKDPDVRDE |
Ga0255088_11085871 | 3300027597 | Freshwater | EHMREPKIMKMDWRPLGYWPVYKDGKLTWEKDPDENVN |
Ga0208133_10982292 | 3300027631 | Estuarine | MSREPKIMKMDWRSLGYWPVWKDGKIVWEKDPYDK |
Ga0208133_11423972 | 3300027631 | Estuarine | MNEPKIMRMDWRALGYWPVYKDGKLTWEKDPDDVQ |
Ga0209135_12532062 | 3300027642 | Freshwater Lake | GMKEPKIMKMDWRSLGYWPVYKDGKLTWEKDPKND |
Ga0209769_12240011 | 3300027679 | Freshwater Lake | ILYNEYMREPKIMKMDWRPLGYWPVYKDGKLTWEKDPDDRND |
Ga0209769_12537063 | 3300027679 | Freshwater Lake | NSMGKERLRMKEPKIMKMDWRPLGYWPVYKDGKLTWEKDPDENVN |
Ga0209551_11328192 | 3300027689 | Freshwater Lake | MKEPKIMKMDWRSLGYWPVYKDGKLTWEKDPDEDVN |
Ga0209599_100054708 | 3300027710 | Deep Subsurface | VSREAKIMRMDWRSLGYWPVYKDGKLTWEKDPDENVN |
Ga0209599_100165443 | 3300027710 | Deep Subsurface | MPNKEPKIMRMDWRSLGYWPVYKDGKLTWEKDPDERTTV |
Ga0209617_100481063 | 3300027720 | Freshwater And Sediment | MKEPKIMKMDWRSLGYWPVYKDGKLTWEKDPDKNVN |
Ga0209617_101150592 | 3300027720 | Freshwater And Sediment | MGKERLRMREPKIMKMDWRPLGYWPVYKDGKLTWEKDPDVRDE |
Ga0209297_12116101 | 3300027733 | Freshwater Lake | SRGTMKEPKIMKMDWRSLGYWPVYKDGKLTWEKESDAN |
Ga0209596_10023209 | 3300027754 | Freshwater Lake | MSKEPKIMKMDWRSLGYWPVWKDGKIVWEKDPHDK |
Ga0209596_100761020 | 3300027754 | Freshwater Lake | MREPKIMKMDWRSLGYWPVYKDGKLTWEKDPEKND |
Ga0209296_101327214 | 3300027759 | Freshwater Lake | MKEPKIMKMDWRSLGYWPVYKDGKLTWEKDTDNDN |
Ga0209770_1000384616 | 3300027769 | Freshwater Lake | MKEPKIMKMDWRSLGYWPVYKDGNLTWEKDPDNDVQ |
Ga0209770_1000566915 | 3300027769 | Freshwater Lake | MKEPKIMKMDWRSLGYWPVYKDGKLKWEKDPKEDVQ |
Ga0209770_102202463 | 3300027769 | Freshwater Lake | NKEPKIMKMDWRSLGYWPVYKDGKMTWEKDPDERTAV |
Ga0209770_102324102 | 3300027769 | Freshwater Lake | MKEPKIMKMDWRSLGYWPIYKDGKLTWEKDPDEDVN |
Ga0209500_100405349 | 3300027782 | Freshwater Lake | MKEPKIMKMDWRPLGYWPVYKDGKLTWEKDPKNND |
Ga0209500_101744413 | 3300027782 | Freshwater Lake | MKEPKIIKMDWRSLGYWPVYKDGKLTWEKDPDNAN |
Ga0209107_100005659 | 3300027797 | Freshwater And Sediment | MKEPKIMKMDWRPLGYWPVYKDGKLTWEKDPDVQDE |
Ga0209107_1001549011 | 3300027797 | Freshwater And Sediment | MSKEPKIMKMDWRPLGYWPVYKDGKLTWEKDPYDRND |
Ga0209107_100344012 | 3300027797 | Freshwater And Sediment | MREPKIMKMDWRPLGYWPVYKDGKLTWEKDPDVRDE |
Ga0209107_100749137 | 3300027797 | Freshwater And Sediment | MKEPKIMKMDWRLLGYWPVYKDGKLTWEKDPDKNVN |
Ga0209229_103910772 | 3300027805 | Freshwater And Sediment | MREPKIMKMDWRSLGYWPVYKDGQLTWEKDPDENAN |
Ga0209230_1000164615 | 3300027836 | Freshwater And Sediment | MKEPKIMKMDWRPLGYWPVYKDGKLTWEKDELNGPMEQ |
Ga0209550_100337287 | 3300027892 | Freshwater Lake | MEGFMVKEPKIMKMDWRPLGYWPVYKDGKLTWEKDPDENVN |
Ga0209550_103927143 | 3300027892 | Freshwater Lake | MKEPKIMRMDWRSLGYWPVYKNGRLEWEKDDEQESKG |
Ga0209400_10108425 | 3300027963 | Freshwater Lake | VSKEPKIMRMDWRPLGYWPVYKDGKLTWEKDPDENVN |
Ga0247723_10279723 | 3300028025 | Deep Subsurface Sediment | MKEPKIMKMDWRSLGYWPVYKDGKLTWEKDPEKDAI |
Ga0247723_10410014 | 3300028025 | Deep Subsurface Sediment | MPNKEPKIMRMDWRSLGYWPVYKEGKITWEKDPDERTAV |
Ga0247722_1000298319 | 3300028027 | Deep Subsurface Sediment | MREPKIMKMDWRPLGYWPVYKDGKLTWEKDPDDAN |
Ga0247722_100819575 | 3300028027 | Deep Subsurface Sediment | NEYMREPKIMKMDWRPLGYWPVYKDGKLTWEKDPDEDVN |
Ga0334982_0037171_197_304 | 3300033981 | Freshwater | MNEPKIMKMDWRPLGYWPVYRDGRLEWEKDPDNDR |
Ga0334992_0000229_46032_46142 | 3300033992 | Freshwater | MREPRIMKMDWRSLGYWPVYKDGKLTWEKDPDVQDE |
Ga0334992_0046867_885_1007 | 3300033992 | Freshwater | MKEPRIMKMDWRSLGYWPVYKDGKLTWERDPDEAEDNLLL |
Ga0335005_0035881_1_108 | 3300034022 | Freshwater | MKEPKIMKMDWRPLGYWPVYKDGKLTWEKDTEDND |
Ga0334995_0198922_497_616 | 3300034062 | Freshwater | MPNKESKIMKMDWRSLGYWPVYKEGKITWEKDPDERTAV |
Ga0335019_0010009_1903_2013 | 3300034066 | Freshwater | MKEPRIMKMDWRPLGYWPVYKDGKLTWEKDPDENVN |
Ga0335019_0175046_781_891 | 3300034066 | Freshwater | MKEPKIMTMDWKSLGYSPVWKDGRIVWEKESNEKNK |
Ga0334990_0002101_7876_7986 | 3300034068 | Freshwater | MKEPKIMKMDWRPLGYWPVYKNGKLTWEKDPDVQDE |
Ga0335028_0030672_536_646 | 3300034071 | Freshwater | MREPKIMKMDWRPLGYWPVYKDGKLTWEKDPDDRND |
Ga0335020_0435254_124_234 | 3300034082 | Freshwater | MREPKIMKMDWRSLGYWPVYKDGKLTWEKDPDVQDE |
Ga0335027_0026114_2596_2706 | 3300034101 | Freshwater | MKEPKIMKMDWRSLGYWPVYKDGKLTWEKDPKEDVQ |
Ga0335029_0041793_1536_1667 | 3300034102 | Freshwater | MGKERLRMKEPKIMKMDWRPLGYWPVYKDGKLTWEKDPDVQDK |
Ga0335036_0007466_9040_9144 | 3300034106 | Freshwater | MKEPRIMKMDWRSLGYWPVYKDGNLTWERDPDEAE |
Ga0335036_0046537_2567_2701 | 3300034106 | Freshwater | MRISLKGLKMNEPKIMKMDWRPLGYWPVYRDGRLEWEKDPDNDR |
Ga0335063_0011956_2285_2398 | 3300034111 | Freshwater | MPAEPKIMKMDWRPLGYWPVYKDGKLTWEKDPDEDVN |
Ga0335016_0370027_666_776 | 3300034166 | Freshwater | MKEPKIISMDWRGLGSWPVWKDGRIVWEKEDKETCD |
⦗Top⦘ |