Basic Information | |
---|---|
Family ID | F020237 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 225 |
Average Sequence Length | 42 residues |
Representative Sequence | MTIGKKLYVNFGAVLAMVVVLFLVNLVAVQREHSAKAAA |
Number of Associated Samples | 193 |
Number of Associated Scaffolds | 225 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 99.55 % |
% of genes near scaffold ends (potentially truncated) | 99.11 % |
% of genes from short scaffolds (< 2000 bps) | 86.22 % |
Associated GOLD sequencing projects | 182 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.55 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (90.667 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (11.111 % of family members) |
Environment Ontology (ENVO) | Unclassified (22.667 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.889 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 53.73% β-sheet: 0.00% Coil/Unstructured: 46.27% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.55 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 225 Family Scaffolds |
---|---|---|
PF03544 | TonB_C | 75.56 |
PF13185 | GAF_2 | 10.22 |
PF13492 | GAF_3 | 1.33 |
PF01590 | GAF | 1.33 |
PF13426 | PAS_9 | 0.89 |
PF00072 | Response_reg | 0.44 |
PF08448 | PAS_4 | 0.44 |
PF00158 | Sigma54_activat | 0.44 |
PF02954 | HTH_8 | 0.44 |
COG ID | Name | Functional Category | % Frequency in 225 Family Scaffolds |
---|---|---|---|
COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 75.56 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 90.67 % |
Unclassified | root | N/A | 9.33 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2124908043|A2_c1_ConsensusfromContig18879 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 605 | Open in IMG/M |
3300001471|JGI12712J15308_10020293 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1749 | Open in IMG/M |
3300001593|JGI12635J15846_10048855 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3240 | Open in IMG/M |
3300001915|JGI24741J21665_1058128 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 570 | Open in IMG/M |
3300002245|JGIcombinedJ26739_100335661 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1393 | Open in IMG/M |
3300002908|JGI25382J43887_10115273 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1405 | Open in IMG/M |
3300003296|Ga0006840J48914_126497 | Not Available | 601 | Open in IMG/M |
3300004080|Ga0062385_10144025 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1221 | Open in IMG/M |
3300004091|Ga0062387_100033453 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2299 | Open in IMG/M |
3300004091|Ga0062387_100069657 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1774 | Open in IMG/M |
3300004092|Ga0062389_104891035 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 505 | Open in IMG/M |
3300004612|Ga0068961_1268825 | Not Available | 622 | Open in IMG/M |
3300004635|Ga0062388_100098916 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2084 | Open in IMG/M |
3300005434|Ga0070709_11793824 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 502 | Open in IMG/M |
3300005538|Ga0070731_10072339 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2288 | Open in IMG/M |
3300005543|Ga0070672_100684638 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 897 | Open in IMG/M |
3300005553|Ga0066695_10280588 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1052 | Open in IMG/M |
3300005554|Ga0066661_10005333 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 5982 | Open in IMG/M |
3300005554|Ga0066661_10416433 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 823 | Open in IMG/M |
3300005564|Ga0070664_101981464 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 553 | Open in IMG/M |
3300005577|Ga0068857_101500586 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 657 | Open in IMG/M |
3300005591|Ga0070761_10711047 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 629 | Open in IMG/M |
3300005602|Ga0070762_10442111 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 844 | Open in IMG/M |
3300005616|Ga0068852_101153961 | Not Available | 795 | Open in IMG/M |
3300005617|Ga0068859_100496172 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1316 | Open in IMG/M |
3300005712|Ga0070764_10387076 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 824 | Open in IMG/M |
3300005764|Ga0066903_106309910 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 619 | Open in IMG/M |
3300005842|Ga0068858_102004082 | Not Available | 572 | Open in IMG/M |
3300005891|Ga0075283_1025765 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 942 | Open in IMG/M |
3300005903|Ga0075279_10019451 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 969 | Open in IMG/M |
3300005944|Ga0066788_10041641 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1068 | Open in IMG/M |
3300006052|Ga0075029_100471711 | All Organisms → cellular organisms → Bacteria | 825 | Open in IMG/M |
3300006059|Ga0075017_100343977 | All Organisms → cellular organisms → Bacteria | 1109 | Open in IMG/M |
3300006059|Ga0075017_100613447 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 832 | Open in IMG/M |
3300006173|Ga0070716_100269329 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1169 | Open in IMG/M |
3300006175|Ga0070712_100113696 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2025 | Open in IMG/M |
3300006175|Ga0070712_101184003 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
3300006176|Ga0070765_100850542 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 862 | Open in IMG/M |
3300006755|Ga0079222_10911287 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
3300006800|Ga0066660_10669005 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 858 | Open in IMG/M |
3300006854|Ga0075425_101816897 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 684 | Open in IMG/M |
3300007258|Ga0099793_10203178 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 950 | Open in IMG/M |
3300007788|Ga0099795_10387151 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 632 | Open in IMG/M |
3300009088|Ga0099830_10234841 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1446 | Open in IMG/M |
3300009088|Ga0099830_11707281 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 525 | Open in IMG/M |
3300009137|Ga0066709_100556217 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1626 | Open in IMG/M |
3300009174|Ga0105241_11328866 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 686 | Open in IMG/M |
3300009521|Ga0116222_1162346 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 962 | Open in IMG/M |
3300009523|Ga0116221_1511928 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 526 | Open in IMG/M |
3300009525|Ga0116220_10425329 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 596 | Open in IMG/M |
3300009545|Ga0105237_10499368 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1223 | Open in IMG/M |
3300009545|Ga0105237_12431971 | Not Available | 534 | Open in IMG/M |
3300009638|Ga0116113_1046166 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1001 | Open in IMG/M |
3300010043|Ga0126380_11112115 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 674 | Open in IMG/M |
3300010048|Ga0126373_11100669 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 860 | Open in IMG/M |
3300010339|Ga0074046_10057802 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2558 | Open in IMG/M |
3300010358|Ga0126370_10540482 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 993 | Open in IMG/M |
3300010360|Ga0126372_11386747 | Not Available | 735 | Open in IMG/M |
3300010361|Ga0126378_12706677 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 567 | Open in IMG/M |
3300010375|Ga0105239_10331378 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1717 | Open in IMG/M |
3300010376|Ga0126381_100402974 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1906 | Open in IMG/M |
3300010376|Ga0126381_100528132 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1669 | Open in IMG/M |
3300010398|Ga0126383_12546170 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 596 | Open in IMG/M |
3300010403|Ga0134123_12982179 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 542 | Open in IMG/M |
3300010937|Ga0137776_1044812 | Not Available | 814 | Open in IMG/M |
3300011069|Ga0138592_1005845 | Not Available | 640 | Open in IMG/M |
3300011119|Ga0105246_10466151 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1065 | Open in IMG/M |
3300012189|Ga0137388_10875132 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 831 | Open in IMG/M |
3300012189|Ga0137388_11109779 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 728 | Open in IMG/M |
3300012201|Ga0137365_11230707 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 534 | Open in IMG/M |
3300012203|Ga0137399_10234814 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1500 | Open in IMG/M |
3300012206|Ga0137380_10287669 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1474 | Open in IMG/M |
3300012207|Ga0137381_10758782 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 842 | Open in IMG/M |
3300012208|Ga0137376_10502627 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1052 | Open in IMG/M |
3300012210|Ga0137378_10758185 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 882 | Open in IMG/M |
3300012211|Ga0137377_10610949 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1027 | Open in IMG/M |
3300012285|Ga0137370_10044591 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2360 | Open in IMG/M |
3300012349|Ga0137387_11080194 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 572 | Open in IMG/M |
3300012359|Ga0137385_10250698 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1533 | Open in IMG/M |
3300012363|Ga0137390_10752226 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 934 | Open in IMG/M |
3300012363|Ga0137390_10929052 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 824 | Open in IMG/M |
3300012469|Ga0150984_106308955 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 615 | Open in IMG/M |
3300012918|Ga0137396_10311720 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1164 | Open in IMG/M |
3300012927|Ga0137416_10555047 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 995 | Open in IMG/M |
3300012927|Ga0137416_10738949 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 867 | Open in IMG/M |
3300012929|Ga0137404_12097031 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 528 | Open in IMG/M |
3300012930|Ga0137407_10369114 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1324 | Open in IMG/M |
3300012930|Ga0137407_12093072 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 540 | Open in IMG/M |
3300012971|Ga0126369_10456825 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1327 | Open in IMG/M |
3300012988|Ga0164306_10863287 | Not Available | 734 | Open in IMG/M |
3300013306|Ga0163162_12438797 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 601 | Open in IMG/M |
3300013306|Ga0163162_13303466 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 516 | Open in IMG/M |
3300013772|Ga0120158_10487499 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 546 | Open in IMG/M |
3300014166|Ga0134079_10129715 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 996 | Open in IMG/M |
3300014168|Ga0181534_10402675 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 757 | Open in IMG/M |
3300014493|Ga0182016_10389189 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 828 | Open in IMG/M |
3300014654|Ga0181525_10630155 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 599 | Open in IMG/M |
3300014968|Ga0157379_11503061 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 655 | Open in IMG/M |
3300015373|Ga0132257_101469880 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 869 | Open in IMG/M |
3300015373|Ga0132257_101656419 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 819 | Open in IMG/M |
3300015374|Ga0132255_100100407 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3929 | Open in IMG/M |
3300016357|Ga0182032_11762870 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 541 | Open in IMG/M |
3300016404|Ga0182037_10280263 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1331 | Open in IMG/M |
3300017822|Ga0187802_10044407 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1613 | Open in IMG/M |
3300017933|Ga0187801_10349720 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 608 | Open in IMG/M |
3300017943|Ga0187819_10019437 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3940 | Open in IMG/M |
3300017943|Ga0187819_10205126 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1162 | Open in IMG/M |
3300017943|Ga0187819_10274252 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 984 | Open in IMG/M |
3300017959|Ga0187779_10435980 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 859 | Open in IMG/M |
3300017961|Ga0187778_11261504 | Not Available | 519 | Open in IMG/M |
3300017970|Ga0187783_10978812 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 610 | Open in IMG/M |
3300017972|Ga0187781_10158999 | All Organisms → cellular organisms → Bacteria | 1588 | Open in IMG/M |
3300017975|Ga0187782_10086012 | All Organisms → cellular organisms → Bacteria | 2306 | Open in IMG/M |
3300018019|Ga0187874_10428914 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 532 | Open in IMG/M |
3300018026|Ga0187857_10073761 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1696 | Open in IMG/M |
3300018030|Ga0187869_10053064 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2134 | Open in IMG/M |
3300018038|Ga0187855_10094001 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1816 | Open in IMG/M |
3300018043|Ga0187887_10602332 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 649 | Open in IMG/M |
3300018044|Ga0187890_10038238 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2893 | Open in IMG/M |
3300018085|Ga0187772_10127496 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1665 | Open in IMG/M |
3300018086|Ga0187769_11551243 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 501 | Open in IMG/M |
3300018088|Ga0187771_11163275 | Not Available | 654 | Open in IMG/M |
3300018090|Ga0187770_10281978 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1291 | Open in IMG/M |
3300018468|Ga0066662_11283447 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 749 | Open in IMG/M |
3300019789|Ga0137408_1083049 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1784 | Open in IMG/M |
3300019870|Ga0193746_1031706 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 536 | Open in IMG/M |
3300019881|Ga0193707_1147548 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 660 | Open in IMG/M |
3300019887|Ga0193729_1094236 | Not Available | 1149 | Open in IMG/M |
3300020000|Ga0193692_1049248 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 958 | Open in IMG/M |
3300020021|Ga0193726_1300266 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 622 | Open in IMG/M |
3300020580|Ga0210403_11073670 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 627 | Open in IMG/M |
3300020582|Ga0210395_10677451 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 772 | Open in IMG/M |
3300020583|Ga0210401_10024148 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5823 | Open in IMG/M |
3300020583|Ga0210401_10128149 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2379 | Open in IMG/M |
3300020583|Ga0210401_10362452 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1311 | Open in IMG/M |
3300021170|Ga0210400_11174552 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 619 | Open in IMG/M |
3300021181|Ga0210388_10370816 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1259 | Open in IMG/M |
3300021181|Ga0210388_11137330 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 665 | Open in IMG/M |
3300021401|Ga0210393_10072438 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2721 | Open in IMG/M |
3300021402|Ga0210385_10089672 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2126 | Open in IMG/M |
3300021403|Ga0210397_10407205 | Not Available | 1018 | Open in IMG/M |
3300021405|Ga0210387_10980097 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 741 | Open in IMG/M |
3300021406|Ga0210386_11274450 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 619 | Open in IMG/M |
3300021406|Ga0210386_11342488 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 601 | Open in IMG/M |
3300021420|Ga0210394_10611320 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 958 | Open in IMG/M |
3300021432|Ga0210384_10001842 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 27258 | Open in IMG/M |
3300021432|Ga0210384_10463481 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1141 | Open in IMG/M |
3300021432|Ga0210384_11833369 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 512 | Open in IMG/M |
3300021433|Ga0210391_10605054 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 860 | Open in IMG/M |
3300021478|Ga0210402_10899041 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 812 | Open in IMG/M |
3300021478|Ga0210402_12003822 | Not Available | 505 | Open in IMG/M |
3300021559|Ga0210409_10310419 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1420 | Open in IMG/M |
3300021560|Ga0126371_11811065 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 732 | Open in IMG/M |
3300022730|Ga0224570_100731 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2623 | Open in IMG/M |
3300024186|Ga0247688_1082636 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 545 | Open in IMG/M |
3300025223|Ga0207672_1002467 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1117 | Open in IMG/M |
3300025906|Ga0207699_11103510 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 587 | Open in IMG/M |
3300025910|Ga0207684_10547749 | Not Available | 990 | Open in IMG/M |
3300025917|Ga0207660_10700986 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 826 | Open in IMG/M |
3300025921|Ga0207652_11376233 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 609 | Open in IMG/M |
3300025928|Ga0207700_10491700 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1085 | Open in IMG/M |
3300025929|Ga0207664_11482431 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 600 | Open in IMG/M |
3300025929|Ga0207664_11615849 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 570 | Open in IMG/M |
3300025939|Ga0207665_11195146 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 607 | Open in IMG/M |
3300025949|Ga0207667_10626830 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1083 | Open in IMG/M |
3300026121|Ga0207683_10205209 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1792 | Open in IMG/M |
3300026294|Ga0209839_10084306 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1101 | Open in IMG/M |
3300026325|Ga0209152_10006337 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4263 | Open in IMG/M |
3300026467|Ga0257154_1002889 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2118 | Open in IMG/M |
3300026552|Ga0209577_10021740 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5667 | Open in IMG/M |
3300027587|Ga0209220_1063777 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 980 | Open in IMG/M |
3300027641|Ga0208827_1059193 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1250 | Open in IMG/M |
3300027648|Ga0209420_1057894 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1151 | Open in IMG/M |
3300027681|Ga0208991_1042474 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1374 | Open in IMG/M |
3300027696|Ga0208696_1158299 | Not Available | 731 | Open in IMG/M |
3300027729|Ga0209248_10016267 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2330 | Open in IMG/M |
3300027842|Ga0209580_10513741 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 596 | Open in IMG/M |
3300027855|Ga0209693_10387598 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 676 | Open in IMG/M |
3300027855|Ga0209693_10524152 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 565 | Open in IMG/M |
3300027867|Ga0209167_10156933 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1196 | Open in IMG/M |
3300027879|Ga0209169_10189834 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1073 | Open in IMG/M |
3300027894|Ga0209068_10136545 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1318 | Open in IMG/M |
3300027895|Ga0209624_10091173 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1983 | Open in IMG/M |
3300027898|Ga0209067_10893835 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 522 | Open in IMG/M |
3300027986|Ga0209168_10046414 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2336 | Open in IMG/M |
3300027986|Ga0209168_10415190 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 654 | Open in IMG/M |
3300028013|Ga0265350_104193 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 685 | Open in IMG/M |
3300028047|Ga0209526_10317206 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1051 | Open in IMG/M |
3300028047|Ga0209526_10979307 | Not Available | 507 | Open in IMG/M |
3300028651|Ga0302171_10099925 | Not Available | 698 | Open in IMG/M |
3300028906|Ga0308309_10158801 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1827 | Open in IMG/M |
3300029636|Ga0222749_10100293 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1359 | Open in IMG/M |
3300030051|Ga0302195_10336368 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 662 | Open in IMG/M |
3300030058|Ga0302179_10009058 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5224 | Open in IMG/M |
3300030617|Ga0311356_11810836 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 544 | Open in IMG/M |
3300030706|Ga0310039_10105401 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1175 | Open in IMG/M |
3300030706|Ga0310039_10187982 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 819 | Open in IMG/M |
3300030760|Ga0265762_1050609 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 833 | Open in IMG/M |
3300030862|Ga0265753_1104445 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 577 | Open in IMG/M |
3300031057|Ga0170834_112740630 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
3300031128|Ga0170823_16410741 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 833 | Open in IMG/M |
3300031231|Ga0170824_124320605 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 559 | Open in IMG/M |
3300031234|Ga0302325_10255940 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2907 | Open in IMG/M |
3300031446|Ga0170820_11358339 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 700 | Open in IMG/M |
3300031446|Ga0170820_15705080 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1206 | Open in IMG/M |
3300031753|Ga0307477_10868875 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 596 | Open in IMG/M |
3300031754|Ga0307475_11076059 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 630 | Open in IMG/M |
3300031823|Ga0307478_10424786 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1103 | Open in IMG/M |
3300031879|Ga0306919_10847604 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 701 | Open in IMG/M |
3300031962|Ga0307479_10413215 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1334 | Open in IMG/M |
3300031962|Ga0307479_11645545 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 596 | Open in IMG/M |
3300032160|Ga0311301_11130849 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1014 | Open in IMG/M |
3300032180|Ga0307471_100149916 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2241 | Open in IMG/M |
3300032180|Ga0307471_101489131 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 835 | Open in IMG/M |
3300032180|Ga0307471_102531693 | Not Available | 649 | Open in IMG/M |
3300032783|Ga0335079_10791522 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 983 | Open in IMG/M |
3300032828|Ga0335080_11803460 | Not Available | 597 | Open in IMG/M |
3300032829|Ga0335070_10186550 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2076 | Open in IMG/M |
3300033134|Ga0335073_10138627 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3096 | Open in IMG/M |
3300033158|Ga0335077_10079689 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3891 | Open in IMG/M |
3300033158|Ga0335077_10933574 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 871 | Open in IMG/M |
3300033433|Ga0326726_11860564 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 586 | Open in IMG/M |
3300034065|Ga0334827_057212 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1411 | Open in IMG/M |
3300034163|Ga0370515_0049541 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1854 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.11% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.11% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.89% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.44% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.00% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.00% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.00% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.56% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.56% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.56% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.67% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.67% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.67% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.67% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.22% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.22% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.22% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.22% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.78% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.78% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.33% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.33% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.33% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.33% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.33% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.89% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.89% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.89% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.89% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.89% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.89% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.44% |
Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment | 0.44% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.44% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.44% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.44% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.44% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.44% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.44% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.44% |
Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.44% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.44% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.44% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.44% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.44% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.44% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.44% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.44% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.44% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.44% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.44% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.44% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.44% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.44% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.44% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2124908043 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active Layer A2 | Environmental | Open in IMG/M |
3300001471 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 | Environmental | Open in IMG/M |
3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Host-Associated | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
3300003296 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 41 (Metagenome Metatranscriptome, Counting Only) | Environmental | Open in IMG/M |
3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004612 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 53 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
3300005891 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_304 | Environmental | Open in IMG/M |
3300005903 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_303 | Environmental | Open in IMG/M |
3300005944 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 | Environmental | Open in IMG/M |
3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300009638 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_10 | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300010937 | Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139 | Environmental | Open in IMG/M |
3300011069 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 19 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300013772 | Permafrost microbial communities from Nunavut, Canada - A10_80_0.25M | Environmental | Open in IMG/M |
3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
3300014168 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaG | Environmental | Open in IMG/M |
3300014493 | Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaG | Environmental | Open in IMG/M |
3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018019 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150 | Environmental | Open in IMG/M |
3300018026 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100 | Environmental | Open in IMG/M |
3300018030 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100 | Environmental | Open in IMG/M |
3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300019870 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m1 | Environmental | Open in IMG/M |
3300019881 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2 | Environmental | Open in IMG/M |
3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
3300020000 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3a1 | Environmental | Open in IMG/M |
3300020021 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1 | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022730 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU2 | Host-Associated | Open in IMG/M |
3300024186 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK29 | Environmental | Open in IMG/M |
3300025223 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026006 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_302 (SPAdes) | Environmental | Open in IMG/M |
3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026294 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes) | Environmental | Open in IMG/M |
3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
3300026467 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-A | Environmental | Open in IMG/M |
3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
3300027587 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027641 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes) | Environmental | Open in IMG/M |
3300027648 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027681 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027696 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG (SPAdes) | Environmental | Open in IMG/M |
3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300028013 | Soil microbial communities from Maridalen valley, Oslo, Norway - NSE2 | Environmental | Open in IMG/M |
3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300028651 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N2_2 | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030051 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N1_2 | Environmental | Open in IMG/M |
3300030058 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1 | Environmental | Open in IMG/M |
3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
3300030706 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2) | Environmental | Open in IMG/M |
3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030862 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
3300034065 | Peat soil microbial communities from Stordalen Mire, Sweden - 714 S1 1-5 | Environmental | Open in IMG/M |
3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
A2_c1_01153120 | 2124908043 | Soil | MTIAKKLYISFGAVLAMVLVLFLVNYLAVQREHSA |
JGI12712J15308_100202931 | 3300001471 | Forest Soil | MTIGKKLYGSFGIILTMVVVLFGVNWFAVQREHAAKSAAA |
JGI12635J15846_100488553 | 3300001593 | Forest Soil | MTIGKKLYLNFGAILAMVVVLFLINLIAVQREHSAKAAASQALQMAETTD |
JGI24741J21665_10581282 | 3300001915 | Corn Rhizosphere | MTIGKKLYVNFGAVLAMVVVLFLVNFFAVQREHVAKAAAAASLDMAEAT |
JGIcombinedJ26739_1003356613 | 3300002245 | Forest Soil | MTIGKKLYLNFGIILSMVVVLFLVNLLAVQREHAAKA |
JGI25382J43887_101152733 | 3300002908 | Grasslands Soil | MTIGRKLYSSFGAVLAMVLVLFLVNLTAVYREHSAKAAAGKALQLADAS |
Ga0006840J48914_1264972 | 3300003296 | Peatlands Soil | MTIGKKLYLNFGAVLAMVVVLFLINLIAVQREHSAKASASQALQMAETTD |
Ga0062385_101440253 | 3300004080 | Bog Forest Soil | MTISKKLYMNFGAVLAMVIVLFLVNLIAVEREHAAKAAASQ |
Ga0062387_1000334533 | 3300004091 | Bog Forest Soil | MTIGKKLYVNFGAVLAMVVVLFLVNLVAVQREHSAKAAAS |
Ga0062387_1000696573 | 3300004091 | Bog Forest Soil | MTIGKKLYLNFGIILTTVMVLFLVNWSAVQREHSAKAAAAA |
Ga0062389_1048910352 | 3300004092 | Bog Forest Soil | MTISKKLYMNFGAVLAMVIVLFLVNLIAVEREHAAKAAASQALQ |
Ga0068961_12688251 | 3300004612 | Peatlands Soil | MTIGKKLYLNFGAVLAMVVVLFLINLIAVQREHSAKASASQALQMAET |
Ga0062388_1000989161 | 3300004635 | Bog Forest Soil | MTIGKKLYVNFGAVLAMVVVLFLVNLVAVQREHSAKAAASQ |
Ga0070709_117938242 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MKIGKKLYLNFGAVLAMVVVLFLVNLIAVQREHSAKAAASQ |
Ga0070731_100723394 | 3300005538 | Surface Soil | MTIGKKLYVNFGAVLAMVVVLFLVIMVAVQREHSAKAS |
Ga0070672_1006846381 | 3300005543 | Miscanthus Rhizosphere | MTIGKKLYINFGAVLAMVVVLFLVNMIAVQREHAAKSSAQQ |
Ga0066695_102805883 | 3300005553 | Soil | MTIGKKLYMNFGAILAMVLVLFLINLVAVQREHSAKAAASQAL |
Ga0066661_100053331 | 3300005554 | Soil | MTIGKKLYVNFGAILAMVLVLFLINLVAVQSEHSAKAAASQALALADAT |
Ga0066661_104164332 | 3300005554 | Soil | MTIGRKLYANFGAVLAMVLVLFLVNYFAVQREHSAKAAA |
Ga0070664_1019814641 | 3300005564 | Corn Rhizosphere | MTLGKKLYLNFGFILGMVLLLFLVNYLAVEREHSAKEAA |
Ga0068857_1015005861 | 3300005577 | Corn Rhizosphere | MTIGRKLYINFGAVLAMVVVLFLVNMIAVQREHAAKSSAQQ |
Ga0070761_107110471 | 3300005591 | Soil | MTIGKKLYRGFAYVLSMVLVLFIVNLLAVQREHAAKAAATASL |
Ga0070762_104421112 | 3300005602 | Soil | MTIAKQLYLSFGIILIMVVLLFVVNWSAVQREQDAKA |
Ga0068852_1011539612 | 3300005616 | Corn Rhizosphere | MTIAKKLYISFGAVLAMVLVLFLVNYLAVRREHSAK |
Ga0068859_1004961721 | 3300005617 | Switchgrass Rhizosphere | MSLSKKLYLNFGFVLAMVIVLFLVIVVAVQREHSAKAAAAQALQVTEGTDK |
Ga0070764_103870761 | 3300005712 | Soil | MTIGKKLYVNFGAVLAMVVVLFLVNLVAVQREHSAKAAA |
Ga0066903_1063099102 | 3300005764 | Tropical Forest Soil | MSMSKKLYLNFGFILAMVVVLFLVIVVAVQREHSAKAAAAQALQVTEGTDKVR |
Ga0068858_1020040821 | 3300005842 | Switchgrass Rhizosphere | MTIAKKLYISFGAVLAMVLVLFLVNYLAVRREHSAKAA |
Ga0075283_10257653 | 3300005891 | Rice Paddy Soil | MTIGRRLYTNFGAILAMVVMLFLVNMIAVQREHAAKTAAAQSLAMAEATD |
Ga0075279_100194511 | 3300005903 | Rice Paddy Soil | MTIGRRLYTNFGAILAMVVMLFLVNMIAVQREHAAKTAAAQSLAMAE |
Ga0066788_100416413 | 3300005944 | Soil | MTIGKKLYLNFGIILTMVVVLFLVNLVAVQREHAAKAA |
Ga0075029_1004717112 | 3300006052 | Watersheds | MKIGKKLYLNFGAVLAMVVVLFLVNLVAVQREHSAKAAASQ |
Ga0075017_1003439773 | 3300006059 | Watersheds | MTIGRKLYVSFGAVLAMVVVLFAVNLAAVYREHSAKAAASQALQLADATD |
Ga0075017_1006134471 | 3300006059 | Watersheds | MTIGKKLYVNFGIILTMVLALFLANWLAVRREHDARKASQQSQD |
Ga0070716_1002693293 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLGKKLYLNFGFILGMVLLLFLVNYLAVEREHSAKEAAAKSLKL |
Ga0070712_1001136961 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MTIGRKLYMSFGAVLVMVVVLFAVNLVAVYREHSAK |
Ga0070712_1011840033 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MSMSKKLYLNFGIILAMVVMLFLVTWYAVHREHDTKATA |
Ga0070765_1008505422 | 3300006176 | Soil | MGMTIGKKLYMNFGIILAMVVVLFLVNIIAVQREHAAKAAATASLELED |
Ga0079222_109112872 | 3300006755 | Agricultural Soil | MSMSKKLYMNFGIILAMVLVLFLVTWYAVHREHDTKAAASQAM |
Ga0066660_106690051 | 3300006800 | Soil | MTIGKKLYMNFGAILAMVLVLFLINLVAVQREHSAKAAASQALSLADATD |
Ga0075425_1018168972 | 3300006854 | Populus Rhizosphere | MSMSKKLYLNFGIILAMVIVLFLVIVVAVQREHSAKAAAAQALQVTEGTDKVRS |
Ga0099793_102031781 | 3300007258 | Vadose Zone Soil | MTIGKKLYANFGIILTMVIVLFLVNWFAVQREHAATAA |
Ga0099795_103871512 | 3300007788 | Vadose Zone Soil | MTIGKKLYMNFGIILVMVVVLFGVNWLAVQREHQAKAAAATSL |
Ga0099830_102348413 | 3300009088 | Vadose Zone Soil | MTIGKKLYLAFGAVLAMVVVLFAVNLWSVHREHSA |
Ga0099830_117072811 | 3300009088 | Vadose Zone Soil | MTIGKKLYVNFGIILIMVLALFLANWLAVRREHDAKKAAQQ |
Ga0066709_1005562171 | 3300009137 | Grasslands Soil | MSIRKNLYLNFGAILVMVIVLLLVNLIAVQREHSAKTAAAQALE |
Ga0105241_113288661 | 3300009174 | Corn Rhizosphere | MTLGKRLYLNFGFILGMVLLLYVVNYLAVRREHAAKDA |
Ga0116222_11623463 | 3300009521 | Peatlands Soil | MTIERKLYTNFGIILIMVLVLFLVNWTAVQREHSAK |
Ga0116221_15119282 | 3300009523 | Peatlands Soil | MTIGKKLYTNFGIILTMVVVLFLVNWFAVQREHAAKAAAA |
Ga0116220_104253292 | 3300009525 | Peatlands Soil | MTIGKKLYMNFGVILTMVLVLFLVNWSAVQREHEAKKAAQQSLDLA |
Ga0105237_104993681 | 3300009545 | Corn Rhizosphere | MSLSKKLYLNFGFVLAMVIVLFLVIVVAVQREHSAKAAAAQALQVT |
Ga0105237_124319711 | 3300009545 | Corn Rhizosphere | MTIRNKLYRSFGIVLAMVLVLFLVNYFAVQREHSAKTAYTQA |
Ga0116113_10461662 | 3300009638 | Peatland | MTIGKKLYLNFGAVLAMVVVLFLINLIAVQREHSAKAAASQALQMAATTDK |
Ga0126380_111121151 | 3300010043 | Tropical Forest Soil | MTIGKKLYMNFGFILLMVVALFLVTYVAVQREHDAKEAAKKS |
Ga0126373_111006691 | 3300010048 | Tropical Forest Soil | MTISKKLYVNFGAVLAMVVVLFLVNMIAVQREHAAKQ |
Ga0074046_100578023 | 3300010339 | Bog Forest Soil | MTIGKKLYLNFGAVLAMVVVLFLINLIAVQREHNAKAAASQAMQMAE |
Ga0126370_105404823 | 3300010358 | Tropical Forest Soil | MTIRRKLYFNFGAILLMVVVLFLVNYLAVRREHGAKA |
Ga0126372_113867473 | 3300010360 | Tropical Forest Soil | MSMSKKLYLNFGIILAMVVILFVVTWVTVQREQRA |
Ga0126378_127066771 | 3300010361 | Tropical Forest Soil | MTIGRKLYVNFGAILLMVVVLFLVNFVAVQREHGAKTSASQALELADA |
Ga0105239_103313781 | 3300010375 | Corn Rhizosphere | MSLSKKLYLNFGFVLAMVIVLFLVIVVAVQREHSAKAAAAQALQV |
Ga0126381_1004029741 | 3300010376 | Tropical Forest Soil | MTIGRKLYVNFGAILLMVVVLFLVNFVAVQREHGAKTSA |
Ga0126381_1005281323 | 3300010376 | Tropical Forest Soil | MSMSKKLYVNFGCILAMVLILFLVNYFAVQREQTAKSTAAQ |
Ga0126383_125461702 | 3300010398 | Tropical Forest Soil | MTIGKKLYVNFGIILTMVLVLFLVNWSAVQREHAAKAAAQSSLELADT |
Ga0134123_129821792 | 3300010403 | Terrestrial Soil | MSMSKKLYLNFGIILAMVIVLFLVIVVAVQREHSAKAAAA |
Ga0137776_10448122 | 3300010937 | Sediment | MTISKRLYINFGIILAGLVVLCLVNILAVEREHSARNST |
Ga0138592_10058451 | 3300011069 | Peatlands Soil | MTIGKKLYLNFGAVLAMVVVLFLINLIAVQREHSAKASASQALQMAETT |
Ga0105246_104661511 | 3300011119 | Miscanthus Rhizosphere | MTIGKKLYVNFGSVLAMVVVLFLVNLVAVQREHAA |
Ga0137388_108751322 | 3300012189 | Vadose Zone Soil | MSFGAVLVMVVVLFAVNLAAVYREHSAKASASQALQLADAT |
Ga0137388_111097792 | 3300012189 | Vadose Zone Soil | MSISKQLYKNFGYVLSTVIVLLAVNLIAVQREHSAKAAAAQALEMAAT |
Ga0137365_112307071 | 3300012201 | Vadose Zone Soil | MTIGKKLYVNFGAILAMVLVLFLINLVAVQREHSAKAAASQA |
Ga0137399_102348141 | 3300012203 | Vadose Zone Soil | MTIGKKLYLAFGAVLAMVVVLFAVNLWSVHREHSAKT |
Ga0137380_102876693 | 3300012206 | Vadose Zone Soil | MSISKQLYKNFGYVLFMVLVLLGVNLIAVQREHSAKSAAAQALQMADNT |
Ga0137381_107587822 | 3300012207 | Vadose Zone Soil | MTIGKKLYTNCGIILTMVLVLFLVNWSAVQREHAAKAAAAQSLEL |
Ga0137376_105026273 | 3300012208 | Vadose Zone Soil | MSIRNKLYINFGAVLAMVIVLFLVNLIAVQREHSAKASAAQALQMA |
Ga0137378_107581853 | 3300012210 | Vadose Zone Soil | MTIGKKLYTNFGIILTMVLVLFLVNWSAVQREHAAK |
Ga0137377_106109491 | 3300012211 | Vadose Zone Soil | MSISKQLYKNFGYVLSTVIVLLAVNLIAVQREHSAKAAAAQALE |
Ga0137370_100445912 | 3300012285 | Vadose Zone Soil | MTIGKKLYVNFGAILAMVLVLFLINLVAVQREHSAKAAA |
Ga0137387_110801942 | 3300012349 | Vadose Zone Soil | MSISKQLYKNFGYVLCMVLVLLGVNLIAVQREHSAKSAA |
Ga0137385_102506981 | 3300012359 | Vadose Zone Soil | MTIGKKLYTNFGIILTMVVVLFLVNWSAVRRERAAKELAD |
Ga0137390_107522262 | 3300012363 | Vadose Zone Soil | MTISKKLYVNFGAVLAMVIVLFLVNLIVVQREHSAKAAASQAL |
Ga0137390_109290522 | 3300012363 | Vadose Zone Soil | MSIGKKLYMNFGAVLAMVIVLFLVNLVAVNREHNAKAAAAQA |
Ga0150984_1063089553 | 3300012469 | Avena Fatua Rhizosphere | MTIGKKLYVNFGAVLAMVVVLFLVNLIAVQREHSAK |
Ga0137396_103117201 | 3300012918 | Vadose Zone Soil | MTIGKKLYLNFGAVLAMVVVLFLVNLTAVQREHSAKA |
Ga0137416_105550471 | 3300012927 | Vadose Zone Soil | MTIGKKLYVNFGIILTMVVVLFMVNWFAVQREHSAKAAAAASV |
Ga0137416_107389492 | 3300012927 | Vadose Zone Soil | MSISKKLYMNFGAVLAMVIVLFLVNLVAVQREHSAKA |
Ga0137404_120970311 | 3300012929 | Vadose Zone Soil | MTIGKKLYVNFGAILTMVLVLFLINLVAVQREHSAKAA |
Ga0137407_103691143 | 3300012930 | Vadose Zone Soil | MTIGKKLYMNFGIILVMVVVLFGVNWLAVQREHTAKAAAAT |
Ga0137407_120930721 | 3300012930 | Vadose Zone Soil | MTIGKKLYMNFGAILAMVLVLFLINLVAVQREHSAKAAASQA |
Ga0126369_104568251 | 3300012971 | Tropical Forest Soil | MTIGRKLYVNFGAILLMVVVLFLVNFVAVQREHGAKTSASQALE |
Ga0164306_108632872 | 3300012988 | Soil | MTIGKKLYLAFGAVLAMVVVLFAVNLWSVHREHSAKAAASQALELADAT |
Ga0163162_124387972 | 3300013306 | Switchgrass Rhizosphere | MTIGKKLYLAFGAVLAMVVVLFAVNLWSVHREHSAKASASQAL* |
Ga0163162_133034661 | 3300013306 | Switchgrass Rhizosphere | MTIAKKLYISFGAVLAMVLVLFLVNYLAVRREHSAKAAASQAL |
Ga0120158_104874991 | 3300013772 | Permafrost | MSISKKLYLNFGIVLSMVVVLFLVTVVAVQREHSAKAASLQALEMADNTANI |
Ga0134079_101297151 | 3300014166 | Grasslands Soil | MTIGKKLYVNFGAILAMVLVLFLINLVAVQREHSAKAAASQ |
Ga0181534_104026751 | 3300014168 | Bog | MTIGKKLYTNFGIILSMVVVLFLVNWSAVQREHAAKAAASASL |
Ga0182016_103891892 | 3300014493 | Bog | MNFGAILAMVVVLFLINVTAMYRERTTKAAAAQAL |
Ga0181525_106301551 | 3300014654 | Bog | MTIGRRLYKNFGIILSMAVVLFVVNLVAVQREHAAKDAARA |
Ga0157379_115030612 | 3300014968 | Switchgrass Rhizosphere | MTIGKKLYINFGAVLAMVVVLFLVNMIAVQREHAAKSSAQQSME |
Ga0132257_1014698801 | 3300015373 | Arabidopsis Rhizosphere | MSMSKKLYLNFGIILAMVIVLFLVIVVAVQREHSA |
Ga0132257_1016564192 | 3300015373 | Arabidopsis Rhizosphere | MTIGKKLYVNFGIILTMVLALFLANWLAVRREHDAKKAA |
Ga0132255_1001004073 | 3300015374 | Arabidopsis Rhizosphere | MTIGKKLYMNFGFILLMVVALFLVPYVAVQREHDAKEAAKKSL |
Ga0182032_117628701 | 3300016357 | Soil | MTIGKKLYVNFGIILTMVLVLFLVNWSAVQREHAAKAAAQ |
Ga0182037_102802633 | 3300016404 | Soil | MTIGKKLYVNFGIILSMVVVLFLVNWSAVNREHSAKKAAQKSQDLDEA |
Ga0187802_100444073 | 3300017822 | Freshwater Sediment | MTIGKKLYLNFGAVLAMVVVLFLINLIAVQREHSAKAAASQALQ |
Ga0187801_103497202 | 3300017933 | Freshwater Sediment | MTIGKKLYLNFGAILAMVVVLFLINLIAVQREHSAKAAASQALQMA |
Ga0187819_100194373 | 3300017943 | Freshwater Sediment | MTLGKKLYTNFGILLTMVVVLFLVNWSAVQREHTAK |
Ga0187819_102051263 | 3300017943 | Freshwater Sediment | MTIGKKLYLNFGVILTMVLVLFLVNWSAVQREHDAKKAAQQSLDLA |
Ga0187819_102742522 | 3300017943 | Freshwater Sediment | MTIGKKLYVNFGAVLAMVVVLFLINLIVVQREHSAKAAASQALQMAE |
Ga0187779_104359803 | 3300017959 | Tropical Peatland | MTIGKKLYVNFGIILTMVVALFLASWFAVRREHDAKNSAQQSQNLAKAN |
Ga0187778_112615041 | 3300017961 | Tropical Peatland | MTIGKKLYVRFGAVLATVVVLFLVNYFAVEREHSAKAAASQALKMAET |
Ga0187783_109788122 | 3300017970 | Tropical Peatland | MTIGKKLYVNFGAVLAMVVVLFLVNILAVQREHSAKAAASQALEMAETTD |
Ga0187781_101589992 | 3300017972 | Tropical Peatland | MTIGKKLYVRFGAVLATVVVLFLVNYFAVEREHSA |
Ga0187782_100860122 | 3300017975 | Tropical Peatland | MTIGKKLYVRFGAVLATVVVLFLVNYFAVEREHSAKSAASQ |
Ga0187874_104289142 | 3300018019 | Peatland | MTIGKKLYTNFGIILAMVLVLFLVNFSAVQREHAAK |
Ga0187857_100737613 | 3300018026 | Peatland | MTIGKKLYKNFGYILSLVVVLFIVNLLAVQREHAAKAAA |
Ga0187869_100530641 | 3300018030 | Peatland | MTIGKKLYVNFGIILSMVVVLFLVNLLAVQREHAAKAAATA |
Ga0187855_100940014 | 3300018038 | Peatland | MTIGKKLYTNFGIILAMVLVLFLVNFSAVQREHAAKAAAAASKDL |
Ga0187887_106023322 | 3300018043 | Peatland | MTIGKKLYLNFGAVLAMVVVLFLINLIAVQREHSAKAAAS |
Ga0187890_100382383 | 3300018044 | Peatland | MTIGKKLYMNFGIILAMVVVLFLVNLLAVQREHSAK |
Ga0187772_101274963 | 3300018085 | Tropical Peatland | MTIGKKLYVNFGIILSMVVVLFLVNLLAVQREHAAKAAAA |
Ga0187769_115512431 | 3300018086 | Tropical Peatland | MSIGKKLYLNFGAILAIVIVLLVINFAAIQREHSGRAATSKALEMA |
Ga0187771_111632751 | 3300018088 | Tropical Peatland | MTIGKKLYVNFGAVLAMVVVLFLVNLVAVQREHSAKA |
Ga0187770_102819783 | 3300018090 | Tropical Peatland | MTIRQKLYVNFGAVLAMVVVLLLVNLVAVQREHSAKA |
Ga0066662_112834472 | 3300018468 | Grasslands Soil | MTISKKLYINFGAVLAMVVVLFLINIVAVEREHSAKASAQQSLEMAEATDAL |
Ga0137408_10830491 | 3300019789 | Vadose Zone Soil | MTIGRKLYSSFGAVLAMVLVLFLVNMTAVYREHSA |
Ga0193746_10317061 | 3300019870 | Soil | MTIGKKLYINFGAVLAMVVVLFLVNMIAVQREHAAKSSAQQS |
Ga0193707_11475482 | 3300019881 | Soil | MTISKKLYMNFGAVLAMVIVLFLINMIAVEREHAAKTAASLALK |
Ga0193729_10942361 | 3300019887 | Soil | VTIGKKLYLAFGTVLAMVVVLFAVNLWSVHREHSAKAAASQALELADAT |
Ga0193692_10492483 | 3300020000 | Soil | MSIRKKLYVSFGAVLAMVIVLLLVNLVAVQREHSAKSAAE |
Ga0193726_13002662 | 3300020021 | Soil | MTISKKLYMNFGAVLAMVIVLFLVNLIAMEREHAANAAA |
Ga0210403_110736702 | 3300020580 | Soil | MTIGKKLYLNFGAVLAMVVVLFLINLIAVQREHSAKA |
Ga0210395_106774511 | 3300020582 | Soil | MTIGKKLYKNFGIILSTVVVLFIVNLLAVQREHAAKAAATASLQ |
Ga0210401_100241485 | 3300020583 | Soil | MTIGRKLYVSFGAVLAMVVVLFAVNLAAVYREHSAKAAASQALQLAD |
Ga0210401_101281493 | 3300020583 | Soil | MTIGKKLYVNFGAVLAMVVVLFLVNLVAVQREHSAK |
Ga0210401_103624521 | 3300020583 | Soil | MTIGKKLYLNFGAVLAMVVVLFLINLIAVQREHSAKAAASQALQMAA |
Ga0210400_111745522 | 3300021170 | Soil | MTIGKKLYTNFGIILAMVLVLFLVNFSAVQREHAAKA |
Ga0210388_103708163 | 3300021181 | Soil | MTIGKKLYLNFGAVLAMVVVLFLINLIAVEREHNAKAAASQALQMASTTDK |
Ga0210388_111373302 | 3300021181 | Soil | MTIGKKLYVNFGIILSMVVVLFLVNLLAVQREHAAKAAATSSLQLAET |
Ga0210393_100724381 | 3300021401 | Soil | MTIGKKLYLNFGAVLAMVVVLFLINLIAVQREHSA |
Ga0210385_100896721 | 3300021402 | Soil | MTIGKKLYTNFGIILSMVVVLFLVNWFAVQREHSAKAAAASS |
Ga0210397_104072051 | 3300021403 | Soil | MTIGKKLYLNFGAVLAMVVVLFLINLIAVQREHSAK |
Ga0210387_109800972 | 3300021405 | Soil | MTIGKKLYKNFGIILIMVVMLFIVNLVAVLREHAAKDA |
Ga0210386_112744501 | 3300021406 | Soil | MTIGKKLYRGFAYVLSMVLVLFIVNLLAVQREHAAKAAATA |
Ga0210386_113424882 | 3300021406 | Soil | MTIGKKLYMNFGIILAMVVVLFLVNIIAVQREHAAKAAATASLELEDAT |
Ga0210394_106113201 | 3300021420 | Soil | MTIGKKLYVNFGIILIMVLALFLANWLAVRREHDAK |
Ga0210384_100018421 | 3300021432 | Soil | MTIGKKLYLNFGAVLAMVVVLFLINLTAVQREHSAKAAASQALQMAAT |
Ga0210384_104634813 | 3300021432 | Soil | MTIGKKLYVNFGIILSMVVVLFLVNLLAVQREHAAKAAATASLELAD |
Ga0210384_118333692 | 3300021432 | Soil | MTIGRKLYWNFGAILLMVVVLFFVNIVAMYRERSAKA |
Ga0210391_106050542 | 3300021433 | Soil | MTIGKKLYLNFGAVLAMVVVLFLINLIAVQREHSAKAAA |
Ga0210402_108990411 | 3300021478 | Soil | MTIGRKLYMNFGIILTMVVILFLVNWFAVQREHAAK |
Ga0210402_120038222 | 3300021478 | Soil | MTIGKKLYLNFGAVLAMVVVLFLVNLIAVQREHSAKAAASQAM |
Ga0210409_103104193 | 3300021559 | Soil | MKIGKKLYVNFGAVLAMVLVLFLVNLIAVRREHSAKAAASQALGLADATD |
Ga0126371_118110651 | 3300021560 | Tropical Forest Soil | MTIGKKLYVNFGIILTMVVVLFLVNWSAVRREHAAKELA |
Ga0224570_1007313 | 3300022730 | Rhizosphere | MTIGKKLYMNFGIILTMVVVLFLVNLLAVQREHSAKAAAA |
Ga0247688_10826362 | 3300024186 | Soil | MTIGKKLYVNFGIILTMVLALFLANWLAVRREHDAKKAAQQSQELA |
Ga0207672_10024671 | 3300025223 | Corn, Switchgrass And Miscanthus Rhizosphere | MTIGKKLYVNFGAVLAMVVVLFLVNFFAVQREHVAKAAAAASLDMAEA |
Ga0207699_111035102 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MTIGKKLYMNFGIILLMVVALFVANWFAVRREHDAKKAAQQSQDL |
Ga0207684_105477493 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MTIGKKLYVNFGAVLAMVLVLFLVNLIAVQREHSAKAAASQA |
Ga0207660_107009861 | 3300025917 | Corn Rhizosphere | MSMSKKLYLNFGIILAMVIVLFLVIVVAVQREHSAKAAAAQALQV |
Ga0207652_113762331 | 3300025921 | Corn Rhizosphere | MTIGRRLYTNFGAILAMVVMLFLVNMIAVQREHAAKTAAAQSLA |
Ga0207700_104917003 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MTIGKKLYLNFGIILTMVVVLFLVNWSAVRREHAATDLADT |
Ga0207664_114824311 | 3300025929 | Agricultural Soil | VSIGKKLYMNFGAVLAMVVLLLLINMAVVRREHLAKAAAANSLA |
Ga0207664_116158491 | 3300025929 | Agricultural Soil | MTIGKKLYLNFGFILGMVLLLFIVNWLAVRREHAAK |
Ga0207665_111951462 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MTIGKKLYMNFGAVLAMVVVLFLVNMVAVQREHAAKAAAAGSLAM |
Ga0207667_106268302 | 3300025949 | Corn Rhizosphere | MSMSKKLYLNFGIILAMVGVLFFVTLFAVQREHSAKTAASQALQMAD |
Ga0208533_1032491 | 3300026006 | Rice Paddy Soil | MTLGKRLYLNFGFILGMVLLLFVVNYLAVRREHAAKDAAAASLK |
Ga0207683_102052093 | 3300026121 | Miscanthus Rhizosphere | MSMSKRLYLNFSFILGMVIVLFVVTWAAVQREHSAKAAATQ |
Ga0209839_100843061 | 3300026294 | Soil | MSIKKKLYMNFGAVLAMVIVLFLVNLVAVQREHSAKAAASQALDMADNTNN |
Ga0209152_100063374 | 3300026325 | Soil | MTISKKLYLNFGAVLAMVVVLLLVNLVAVEREHSAKTAAQQSMEMSDA |
Ga0257154_10028891 | 3300026467 | Soil | MTIGKKLYLNFGIILSMVVVLFLVNLLAVQREHAAKAAATAS |
Ga0209577_100217401 | 3300026552 | Soil | MTISKKLYANFGAVLAMVVVLLLVNLVAVQREHSTKAAAQQSMEMSDAT |
Ga0209220_10637771 | 3300027587 | Forest Soil | MTIGKRLYVNFGIILTMVVVLFLVNLVAVHREHAAKAAAA |
Ga0208827_10591931 | 3300027641 | Peatlands Soil | MTIGKKLYFNFGAILAMVVVLFLINLIAVQREHSAKAAASQAL |
Ga0209420_10578943 | 3300027648 | Forest Soil | MTIGKKLYGSFGIILTMVVVLFCVNWFAVQREHAAKS |
Ga0208991_10424741 | 3300027681 | Forest Soil | MTIGKKLYVSFGIILATVVFLFVVNWYAVHREHDAKSAAAA |
Ga0208696_11582991 | 3300027696 | Peatlands Soil | MTIGKKLYLNFGAVLAMVVVLFLINLIAVQREHSAKASASQAL |
Ga0209248_100162673 | 3300027729 | Bog Forest Soil | MTIGKKLYKNFGIILSMVVVLFIVNLVAVLREHAA |
Ga0209580_105137412 | 3300027842 | Surface Soil | MTIGKKLYTNFGIILSMVVVLFLVNWSAVQREHAAK |
Ga0209693_103875982 | 3300027855 | Soil | MTIGKKLYKNFGIILSTVVVLFIVNLLAVQREHAAK |
Ga0209693_105241521 | 3300027855 | Soil | MTIGKKLYMNFGIVLTMVLALFLVNWRAVQREHDAKNAA |
Ga0209167_101569333 | 3300027867 | Surface Soil | MTIGKKLYLNFGAILAMVVVLFLINLIAVQREHSAKAAASQALQMAETTDK |
Ga0209169_101898343 | 3300027879 | Soil | MTIGKKLYMNFGIVLTMVLALFLVNWRAVQREHDAK |
Ga0209068_101365451 | 3300027894 | Watersheds | MTIGKKLYLNFGAVLAMVVVLFLINLIAVQREHSAKAAASQA |
Ga0209624_100911733 | 3300027895 | Forest Soil | MTIGKKLYTNFGIILSMVVVLFLVNWSAVLREHAAKAAAS |
Ga0209067_108938351 | 3300027898 | Watersheds | MTIGKKLYVNFGIILTMVLALFLANWLAVRREHDARKASQQSQDLAE |
Ga0209168_100464143 | 3300027986 | Surface Soil | MTIGKKLYVNFGIILTMVLVLFLVNWSAVQREHRA |
Ga0209168_104151901 | 3300027986 | Surface Soil | MTIGKRLYTNFGAVLAMVVVLFLINMIAVQREHAA |
Ga0265350_1041931 | 3300028013 | Soil | MTIGKKLYMNFGIILAMVVVLFLVNLLAVQREHSAKAAAAA |
Ga0209526_103172061 | 3300028047 | Forest Soil | MSISKKLYWNFGSVLAMVIVLFLVNLIAVQREHSAKAAASQ |
Ga0209526_109793072 | 3300028047 | Forest Soil | MTIGKKLYLNFGAILAMVVVLFLINLIAVQREHSAKAAASQALQMAET |
Ga0302171_100999251 | 3300028651 | Fen | MTIGRKLYINFGAVLAMVVVLFLVNLIAVQREHSAKAAAAKSLELADATDR |
Ga0308309_101588013 | 3300028906 | Soil | MTIGKKLYLNFGAVLAMVVVLFLINLIAVQREHSAKAAASQALQM |
Ga0222749_101002933 | 3300029636 | Soil | MKIGKKLYVNFGAVLAMVLVLFLVNLIAVRREHSAKAAASQALGLADA |
Ga0302195_103363682 | 3300030051 | Bog | MTIGKKLYVNFGIILSMVGVLFLVNLLAVQREHAAKAAAT |
Ga0302179_100090584 | 3300030058 | Palsa | MTIGKKLYKNFGYILSMVVVLFLVNLLAVQREHAAKAAAT |
Ga0311356_118108361 | 3300030617 | Palsa | MTIGKKLYKNFGIILSMVAVLFIVNLVAVQREHAAK |
Ga0310039_101054011 | 3300030706 | Peatlands Soil | MTIGKKLYFNFGAVLAMVVVLFLVNLVAVQREHSAKAAA |
Ga0310039_101879822 | 3300030706 | Peatlands Soil | MTIGKKLYMNFGIILSMVVVLFLVNLLAVQREHAAKAA |
Ga0265762_10506092 | 3300030760 | Soil | MTIGKKLYLNFGAVLAMVVVLFLINLIAVQREHSAKAAASQALQMAATTD |
Ga0265753_11044451 | 3300030862 | Soil | MTIGKKLYMNFGIILAMVVVLFLVNLLAVQREHSAKAGAAA |
Ga0170834_1127406302 | 3300031057 | Forest Soil | MTIGKKLYMNFGIILLMVVVLFGVNWLAVQREHTAK |
Ga0170823_164107412 | 3300031128 | Forest Soil | MTIGKKLYVNFGIILTTVLVLFLVNWTAVQREHAAKKAAEAS |
Ga0170824_1243206052 | 3300031231 | Forest Soil | MTIGKKLYTNFGIILTMVLVLFLVNWSAVQREHSAKQLAD |
Ga0302325_102559401 | 3300031234 | Palsa | MTIGKKLYTNFGIILAMVLVLFLVNFSAVQREHAAKAAAAAS |
Ga0170820_113583392 | 3300031446 | Forest Soil | MTISKKLYMNFGAVLAMVIVLFLINMIAVEREHAAKAAASQALKMAET |
Ga0170820_157050803 | 3300031446 | Forest Soil | MSMSKKLYSNFGFVLAMVLVLFGVTWFAVQREQSAKTAAAQAL |
Ga0307477_108688752 | 3300031753 | Hardwood Forest Soil | MTIGKKLYVNFGIILIMVLALFLANWLAVRREHDAKKAA |
Ga0307475_110760592 | 3300031754 | Hardwood Forest Soil | MTIGKKLYMNFGIILVMVVVLFGVNWLAVQREHTAKAAA |
Ga0307478_104247861 | 3300031823 | Hardwood Forest Soil | MTIGKKLYINFGFILLMVVALFLVTWSAVQREHAAK |
Ga0306919_108476042 | 3300031879 | Soil | MTIGKKLYVNFGIILTMVLVLFLVNWSAVQREHAAKA |
Ga0307479_104132151 | 3300031962 | Hardwood Forest Soil | MTIGKKLYLNFGIILSMVVVLFLVNLLAVLREHAAKDAAK |
Ga0307479_116455452 | 3300031962 | Hardwood Forest Soil | MTIGKKLYVNFGIILIMVLALFLANWLAVRREHDAKK |
Ga0311301_111308491 | 3300032160 | Peatlands Soil | MTIGKKLYMNFGVILTMVLVLFLVNWSAVHREHEAKKAAQQS |
Ga0307471_1001499161 | 3300032180 | Hardwood Forest Soil | MTIGKKLYMNFGAVLAMVVVLFLVNMVAVQREHAAKAAA |
Ga0307471_1014891311 | 3300032180 | Hardwood Forest Soil | MTIGKKLYTNFGIILTMVVVLFLVNWSAVQREHAAKSA |
Ga0307471_1025316931 | 3300032180 | Hardwood Forest Soil | VTIGKKLYLAFGTVLATVVVLFAVNLWSVHREHSAKAAASQALELA |
Ga0335079_107915221 | 3300032783 | Soil | MSIGKKLYLSFGAVLAMVVVLLLVNMAVVRREHQAKAAAANSLSM |
Ga0335080_118034601 | 3300032828 | Soil | MTIGKKLYVNFGFILLMVLVLFLVNYFAVQREHSAKAS |
Ga0335070_101865503 | 3300032829 | Soil | MTIGKKLYVNFGIILTMVLVLFLVNWMAVQREHAAKKSA |
Ga0335073_101386273 | 3300033134 | Soil | MTIGKKLYLNFGIILTTVLILFLVNWFAVQREHSAKAAAA |
Ga0335077_100796895 | 3300033158 | Soil | MTIGKKLYVNFGAVLAMVVVLFLVNLVAVQREHSAKAA |
Ga0335077_109335741 | 3300033158 | Soil | MTIGKKLYLNFGAVLAMVIVLFLVNLIAMQREHAAKAAAAQSLE |
Ga0326726_118605641 | 3300033433 | Peat Soil | MTIGKKLYMNFGFILVMVLLLFLANYFAVRREHRAKDSAKQS |
Ga0334827_057212_3_119 | 3300034065 | Soil | MTIGKKLYTNFGIILTMVVVLFLVNWFAVQREHSAKAAA |
Ga0370515_0049541_1_129 | 3300034163 | Untreated Peat Soil | MTIGKRLYKNFGIILSMVVVLFIVNLVAVLREHAAKDAAKVSL |
⦗Top⦘ |