NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F020246

Metagenome / Metatranscriptome Family F020246

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F020246
Family Type Metagenome / Metatranscriptome
Number of Sequences 225
Average Sequence Length 45 residues
Representative Sequence MSAMKDDILSMKEPVFAVRPRVVFALWEKYFQTKSTRWKFE
Number of Associated Samples 180
Number of Associated Scaffolds 225

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.89 %
% of genes near scaffold ends (potentially truncated) 94.67 %
% of genes from short scaffolds (< 2000 bps) 87.11 %
Associated GOLD sequencing projects 169
AlphaFold2 3D model prediction Yes
3D model pTM-score0.22

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (97.333 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(13.778 % of family members)
Environment Ontology (ENVO) Unclassified
(18.667 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(53.778 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 31.88%    β-sheet: 0.00%    Coil/Unstructured: 68.12%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.22
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 225 Family Scaffolds
PF003892-Hacid_dh 15.56
PF028262-Hacid_dh_C 6.22
PF00456Transketolase_N 5.78
PF06537DHOR 4.89
PF00109ketoacyl-synt 3.11
PF13336AcetylCoA_hyd_C 2.22
PF01243Putative_PNPOx 2.22
PF02801Ketoacyl-synt_C 1.78
PF01436NHL 0.89
PF01828Peptidase_A4 0.89
PF14559TPR_19 0.89
PF05163DinB 0.89
PF02780Transketolase_C 0.89
PF05592Bac_rhamnosid 0.89
PF00753Lactamase_B 0.89
PF030614HBT 0.89
PF17191RecG_wedge 0.44
PF13432TPR_16 0.44
PF00155Aminotran_1_2 0.44
PF01546Peptidase_M20 0.44
PF03572Peptidase_S41 0.44
PF00535Glycos_transf_2 0.44
PF04226Transgly_assoc 0.44
PF13620CarboxypepD_reg 0.44
PF01435Peptidase_M48 0.44
PF13714PEP_mutase 0.44
PF13521AAA_28 0.44
PF02954HTH_8 0.44
PF00144Beta-lactamase 0.44
PF04909Amidohydro_2 0.44
PF07676PD40 0.44
PF00574CLP_protease 0.44
PF02779Transket_pyr 0.44
PF13649Methyltransf_25 0.44
PF02518HATPase_c 0.44
PF00069Pkinase 0.44
PF04239DUF421 0.44
PF07883Cupin_2 0.44
PF07690MFS_1 0.44
PF13618Gluconate_2-dh3 0.44
PF02838Glyco_hydro_20b 0.44
PF00326Peptidase_S9 0.44
PF00561Abhydrolase_1 0.44

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 225 Family Scaffolds
COG0021TransketolaseCarbohydrate transport and metabolism [G] 5.78
COG3959Transketolase, N-terminal subunitCarbohydrate transport and metabolism [G] 5.78
COG3488Uncharacterized conserved protein with two CxxC motifs, DUF1111 familyGeneral function prediction only [R] 4.89
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 1.78
COG0616Periplasmic serine protease, ClpP classPosttranslational modification, protein turnover, chaperones [O] 0.89
COG0740ATP-dependent protease ClpP, protease subunitPosttranslational modification, protein turnover, chaperones [O] 0.89
COG2318Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB)Secondary metabolites biosynthesis, transport and catabolism [Q] 0.89
COG3408Glycogen debranching enzyme (alpha-1,6-glucosidase)Carbohydrate transport and metabolism [G] 0.89
COG0793C-terminal processing protease CtpA/Prc, contains a PDZ domainPosttranslational modification, protein turnover, chaperones [O] 0.44
COG1030Membrane-bound serine protease NfeD, ClpP classPosttranslational modification, protein turnover, chaperones [O] 0.44
COG1680CubicO group peptidase, beta-lactamase class C familyDefense mechanisms [V] 0.44
COG1686D-alanyl-D-alanine carboxypeptidaseCell wall/membrane/envelope biogenesis [M] 0.44
COG2261Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein familyGeneral function prediction only [R] 0.44
COG2323Uncharacterized membrane protein YcaP, DUF421 familyFunction unknown [S] 0.44
COG2367Beta-lactamase class ADefense mechanisms [V] 0.44
COG3525N-acetyl-beta-hexosaminidaseCarbohydrate transport and metabolism [G] 0.44


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms97.33 %
UnclassifiedrootN/A2.67 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000891|JGI10214J12806_13552817All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium510Open in IMG/M
3300003505|JGIcombinedJ51221_10266376All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium697Open in IMG/M
3300004082|Ga0062384_100349761All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium935Open in IMG/M
3300004092|Ga0062389_100384022All Organisms → cellular organisms → Bacteria1516Open in IMG/M
3300004092|Ga0062389_102732255All Organisms → cellular organisms → Bacteria → Acidobacteria658Open in IMG/M
3300004152|Ga0062386_101513899All Organisms → cellular organisms → Bacteria → Acidobacteria559Open in IMG/M
3300005093|Ga0062594_101723032All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium656Open in IMG/M
3300005167|Ga0066672_10580535All Organisms → cellular organisms → Bacteria726Open in IMG/M
3300005176|Ga0066679_10745789All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium630Open in IMG/M
3300005177|Ga0066690_10788552All Organisms → cellular organisms → Bacteria → Acidobacteria619Open in IMG/M
3300005355|Ga0070671_100422855All Organisms → cellular organisms → Bacteria1141Open in IMG/M
3300005437|Ga0070710_11059142All Organisms → cellular organisms → Bacteria → Acidobacteria594Open in IMG/M
3300005444|Ga0070694_100481783All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium984Open in IMG/M
3300005459|Ga0068867_101947923All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium555Open in IMG/M
3300005530|Ga0070679_100375066All Organisms → cellular organisms → Bacteria1369Open in IMG/M
3300005530|Ga0070679_101509021All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium619Open in IMG/M
3300005537|Ga0070730_10877094All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium563Open in IMG/M
3300005538|Ga0070731_11056794All Organisms → cellular organisms → Bacteria → Acidobacteria537Open in IMG/M
3300005541|Ga0070733_10309128All Organisms → cellular organisms → Bacteria → Atribacterota → unclassified Atribacterota → Candidatus Atribacteria bacterium HGW-Atribacteria-11045Open in IMG/M
3300005542|Ga0070732_10176494All Organisms → cellular organisms → Bacteria1274Open in IMG/M
3300005542|Ga0070732_10477095All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium755Open in IMG/M
3300005542|Ga0070732_10859257Not Available554Open in IMG/M
3300005546|Ga0070696_100033711All Organisms → cellular organisms → Bacteria3520Open in IMG/M
3300005546|Ga0070696_101061397All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium679Open in IMG/M
3300005563|Ga0068855_101335307All Organisms → cellular organisms → Bacteria → Acidobacteria741Open in IMG/M
3300005575|Ga0066702_10162615All Organisms → cellular organisms → Bacteria1329Open in IMG/M
3300005575|Ga0066702_10190777All Organisms → cellular organisms → Bacteria → Acidobacteria1236Open in IMG/M
3300005712|Ga0070764_10118419All Organisms → cellular organisms → Bacteria → Acidobacteria1431Open in IMG/M
3300005921|Ga0070766_10370893All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium933Open in IMG/M
3300005921|Ga0070766_11217543All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium521Open in IMG/M
3300005995|Ga0066790_10025066All Organisms → cellular organisms → Bacteria → Acidobacteria2609Open in IMG/M
3300006028|Ga0070717_10870751All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium820Open in IMG/M
3300006050|Ga0075028_100687668All Organisms → cellular organisms → Bacteria → Acidobacteria615Open in IMG/M
3300006052|Ga0075029_100243771All Organisms → cellular organisms → Bacteria1133Open in IMG/M
3300006052|Ga0075029_100763454All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium656Open in IMG/M
3300006059|Ga0075017_100087705All Organisms → cellular organisms → Bacteria2151Open in IMG/M
3300006059|Ga0075017_100170446All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1560Open in IMG/M
3300006059|Ga0075017_100869053All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium699Open in IMG/M
3300006172|Ga0075018_10609660All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium581Open in IMG/M
3300006176|Ga0070765_101360945All Organisms → cellular organisms → Bacteria669Open in IMG/M
3300006797|Ga0066659_10292594All Organisms → cellular organisms → Bacteria1239Open in IMG/M
3300007982|Ga0102924_1031458All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3490Open in IMG/M
3300009038|Ga0099829_11369057All Organisms → cellular organisms → Bacteria → Acidobacteria585Open in IMG/M
3300009143|Ga0099792_11072266All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium541Open in IMG/M
3300009176|Ga0105242_11239234All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium767Open in IMG/M
3300009624|Ga0116105_1003721Not Available3194Open in IMG/M
3300009665|Ga0116135_1109754All Organisms → cellular organisms → Bacteria → Acidobacteria1004Open in IMG/M
3300009759|Ga0116101_1072684All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium769Open in IMG/M
3300009824|Ga0116219_10414797All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium750Open in IMG/M
3300009839|Ga0116223_10306425All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium947Open in IMG/M
3300010043|Ga0126380_10349862All Organisms → cellular organisms → Bacteria → Acidobacteria1075Open in IMG/M
3300010048|Ga0126373_11132096All Organisms → cellular organisms → Bacteria → Acidobacteria849Open in IMG/M
3300010343|Ga0074044_10006197All Organisms → cellular organisms → Bacteria → Acidobacteria9619Open in IMG/M
3300010343|Ga0074044_10028559All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3953Open in IMG/M
3300010359|Ga0126376_10077733All Organisms → cellular organisms → Bacteria → Acidobacteria2454Open in IMG/M
3300010360|Ga0126372_11629721All Organisms → cellular organisms → Bacteria → Acidobacteria685Open in IMG/M
3300010376|Ga0126381_100879911All Organisms → cellular organisms → Bacteria1289Open in IMG/M
3300010376|Ga0126381_103988643All Organisms → cellular organisms → Bacteria → Acidobacteria575Open in IMG/M
3300010379|Ga0136449_103793133All Organisms → cellular organisms → Bacteria → Acidobacteria569Open in IMG/M
3300011120|Ga0150983_13247432All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium843Open in IMG/M
3300011120|Ga0150983_15337939All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium720Open in IMG/M
3300011269|Ga0137392_10260116All Organisms → cellular organisms → Bacteria1429Open in IMG/M
3300012096|Ga0137389_11076678All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium689Open in IMG/M
3300012096|Ga0137389_11814240All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium506Open in IMG/M
3300012199|Ga0137383_10873484All Organisms → cellular organisms → Bacteria → Acidobacteria657Open in IMG/M
3300012203|Ga0137399_10275344All Organisms → cellular organisms → Bacteria1385Open in IMG/M
3300012203|Ga0137399_11348165All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium599Open in IMG/M
3300012205|Ga0137362_10461996All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1099Open in IMG/M
3300012917|Ga0137395_10706125All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium730Open in IMG/M
3300012918|Ga0137396_10951352All Organisms → cellular organisms → Bacteria → Acidobacteria626Open in IMG/M
3300012960|Ga0164301_10939093All Organisms → cellular organisms → Bacteria → Acidobacteria674Open in IMG/M
3300012971|Ga0126369_10408724All Organisms → cellular organisms → Bacteria → Acidobacteria1397Open in IMG/M
3300012986|Ga0164304_10160375All Organisms → cellular organisms → Bacteria1427Open in IMG/M
3300012989|Ga0164305_11817599All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium551Open in IMG/M
3300013100|Ga0157373_10189283All Organisms → cellular organisms → Bacteria1450Open in IMG/M
3300014169|Ga0181531_10160868All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1359Open in IMG/M
3300014169|Ga0181531_10599381All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium683Open in IMG/M
3300014489|Ga0182018_10283984All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium903Open in IMG/M
3300014495|Ga0182015_10442436All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium835Open in IMG/M
3300014501|Ga0182024_10166864All Organisms → cellular organisms → Bacteria3064Open in IMG/M
3300014658|Ga0181519_10291967All Organisms → cellular organisms → Bacteria → Acidobacteria1013Open in IMG/M
3300015242|Ga0137412_10686509All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium764Open in IMG/M
3300015264|Ga0137403_11089220All Organisms → cellular organisms → Bacteria → Acidobacteria645Open in IMG/M
3300015373|Ga0132257_103554720All Organisms → cellular organisms → Bacteria567Open in IMG/M
3300016422|Ga0182039_10457492All Organisms → cellular organisms → Bacteria1094Open in IMG/M
3300016445|Ga0182038_11789308All Organisms → cellular organisms → Bacteria → Acidobacteria554Open in IMG/M
3300016702|Ga0181511_1529530All Organisms → cellular organisms → Bacteria → Acidobacteria854Open in IMG/M
3300017822|Ga0187802_10334047All Organisms → cellular organisms → Bacteria → Acidobacteria594Open in IMG/M
3300017823|Ga0187818_10061341All Organisms → cellular organisms → Bacteria → Acidobacteria1618Open in IMG/M
3300017823|Ga0187818_10383188All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium623Open in IMG/M
3300017933|Ga0187801_10155009All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium894Open in IMG/M
3300017936|Ga0187821_10072742All Organisms → cellular organisms → Bacteria1248Open in IMG/M
3300017940|Ga0187853_10154505Not Available1096Open in IMG/M
3300017940|Ga0187853_10479255All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium544Open in IMG/M
3300017943|Ga0187819_10244537All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium1051Open in IMG/M
3300017943|Ga0187819_10536105All Organisms → cellular organisms → Bacteria → Acidobacteria666Open in IMG/M
3300017943|Ga0187819_10594597All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium627Open in IMG/M
3300017946|Ga0187879_10711290All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium559Open in IMG/M
3300017955|Ga0187817_10427008All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli845Open in IMG/M
3300017955|Ga0187817_10854658All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium581Open in IMG/M
3300017959|Ga0187779_10694066All Organisms → cellular organisms → Bacteria → Acidobacteria688Open in IMG/M
3300017972|Ga0187781_11394212All Organisms → cellular organisms → Bacteria → Acidobacteria518Open in IMG/M
3300017975|Ga0187782_10516615All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium914Open in IMG/M
3300017988|Ga0181520_10878841All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter599Open in IMG/M
3300017995|Ga0187816_10211973All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae843Open in IMG/M
3300018006|Ga0187804_10438871All Organisms → cellular organisms → Bacteria → Acidobacteria582Open in IMG/M
3300018019|Ga0187874_10344343All Organisms → cellular organisms → Bacteria → Acidobacteria604Open in IMG/M
3300018047|Ga0187859_10445483All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium715Open in IMG/M
3300018085|Ga0187772_10046524All Organisms → cellular organisms → Bacteria → Acidobacteria2649Open in IMG/M
3300018085|Ga0187772_10592202All Organisms → cellular organisms → Bacteria → Acidobacteria788Open in IMG/M
3300018085|Ga0187772_11390863All Organisms → cellular organisms → Bacteria → Acidobacteria521Open in IMG/M
3300018090|Ga0187770_10005287All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae7723Open in IMG/M
3300019278|Ga0187800_1479682All Organisms → cellular organisms → Bacteria → Acidobacteria515Open in IMG/M
3300020022|Ga0193733_1002360All Organisms → cellular organisms → Bacteria5498Open in IMG/M
3300020579|Ga0210407_10016218All Organisms → cellular organisms → Bacteria5528Open in IMG/M
3300020580|Ga0210403_10364322All Organisms → cellular organisms → Bacteria1182Open in IMG/M
3300020580|Ga0210403_11497459All Organisms → cellular organisms → Bacteria → Acidobacteria508Open in IMG/M
3300020582|Ga0210395_10992281All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium622Open in IMG/M
3300020583|Ga0210401_11008754All Organisms → cellular organisms → Bacteria → Acidobacteria691Open in IMG/M
3300021168|Ga0210406_10761697All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium740Open in IMG/M
3300021170|Ga0210400_11212884All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium607Open in IMG/M
3300021171|Ga0210405_10990650All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium634Open in IMG/M
3300021178|Ga0210408_11230493All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium571Open in IMG/M
3300021178|Ga0210408_11255073All Organisms → cellular organisms → Bacteria → Acidobacteria564Open in IMG/M
3300021180|Ga0210396_10551886All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1005Open in IMG/M
3300021180|Ga0210396_10833602All Organisms → cellular organisms → Bacteria → Acidobacteria789Open in IMG/M
3300021401|Ga0210393_10337861All Organisms → cellular organisms → Bacteria1225Open in IMG/M
3300021401|Ga0210393_11680794All Organisms → cellular organisms → Bacteria → Acidobacteria502Open in IMG/M
3300021402|Ga0210385_10274493All Organisms → cellular organisms → Bacteria → Acidobacteria1244Open in IMG/M
3300021403|Ga0210397_11078984All Organisms → cellular organisms → Bacteria → Acidobacteria624Open in IMG/M
3300021406|Ga0210386_10123475All Organisms → cellular organisms → Bacteria2144Open in IMG/M
3300021406|Ga0210386_11065698All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Neorhizobium → unclassified Neorhizobium → Neorhizobium sp. SHOUNA12A687Open in IMG/M
3300021420|Ga0210394_10108519All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2402Open in IMG/M
3300021420|Ga0210394_10632553All Organisms → cellular organisms → Bacteria → Acidobacteria940Open in IMG/M
3300021420|Ga0210394_11400338All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium594Open in IMG/M
3300021432|Ga0210384_10113128All Organisms → cellular organisms → Bacteria2433Open in IMG/M
3300021432|Ga0210384_10293233Not Available1464Open in IMG/M
3300021433|Ga0210391_10068907All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2800Open in IMG/M
3300021476|Ga0187846_10425283All Organisms → cellular organisms → Bacteria → Acidobacteria545Open in IMG/M
3300021478|Ga0210402_11970424All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium510Open in IMG/M
3300021559|Ga0210409_11151343All Organisms → cellular organisms → Bacteria → Acidobacteria651Open in IMG/M
3300021560|Ga0126371_12043377All Organisms → cellular organisms → Bacteria → Acidobacteria690Open in IMG/M
3300021858|Ga0213852_1483815All Organisms → cellular organisms → Bacteria → Acidobacteria628Open in IMG/M
3300021861|Ga0213853_11341565All Organisms → cellular organisms → Bacteria → Acidobacteria557Open in IMG/M
3300022522|Ga0242659_1014077All Organisms → cellular organisms → Bacteria1158Open in IMG/M
3300022522|Ga0242659_1039673All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium801Open in IMG/M
3300022522|Ga0242659_1062254All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium681Open in IMG/M
3300022722|Ga0242657_1156597All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium604Open in IMG/M
3300023090|Ga0224558_1120165All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium885Open in IMG/M
3300024295|Ga0224556_1128912All Organisms → cellular organisms → Bacteria → Acidobacteria619Open in IMG/M
3300025134|Ga0207416_1131625Not Available855Open in IMG/M
3300025414|Ga0208935_1023503All Organisms → cellular organisms → Bacteria → Acidobacteria816Open in IMG/M
3300025473|Ga0208190_1065386All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium741Open in IMG/M
3300025906|Ga0207699_10128095All Organisms → cellular organisms → Bacteria1652Open in IMG/M
3300025920|Ga0207649_10146285All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1622Open in IMG/M
3300025929|Ga0207664_11418471All Organisms → cellular organisms → Bacteria → Acidobacteria615Open in IMG/M
3300025929|Ga0207664_11538681All Organisms → cellular organisms → Bacteria → Acidobacteria587Open in IMG/M
3300025934|Ga0207686_10413845All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1030Open in IMG/M
3300025941|Ga0207711_10395982All Organisms → cellular organisms → Bacteria → Acidobacteria1283Open in IMG/M
3300025949|Ga0207667_11174604All Organisms → cellular organisms → Bacteria → Acidobacteria748Open in IMG/M
3300026078|Ga0207702_10581751All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1097Open in IMG/M
3300026078|Ga0207702_11900054All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium587Open in IMG/M
3300026089|Ga0207648_11776294All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium578Open in IMG/M
3300026959|Ga0207852_1030978All Organisms → cellular organisms → Bacteria → Acidobacteria547Open in IMG/M
3300027080|Ga0208237_1010360All Organisms → cellular organisms → Bacteria1374Open in IMG/M
3300027109|Ga0208603_1004768All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2251Open in IMG/M
3300027313|Ga0207780_1059353All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella650Open in IMG/M
3300027537|Ga0209419_1071982All Organisms → cellular organisms → Bacteria → Acidobacteria681Open in IMG/M
3300027567|Ga0209115_1145916All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium530Open in IMG/M
3300027591|Ga0209733_1046914All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1148Open in IMG/M
3300027633|Ga0208988_1035255All Organisms → cellular organisms → Bacteria1287Open in IMG/M
3300027641|Ga0208827_1161673All Organisms → cellular organisms → Bacteria616Open in IMG/M
3300027645|Ga0209117_1188402All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium524Open in IMG/M
3300027826|Ga0209060_10569835All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium512Open in IMG/M
3300027842|Ga0209580_10508948Not Available599Open in IMG/M
3300027884|Ga0209275_10451468All Organisms → cellular organisms → Bacteria729Open in IMG/M
3300027889|Ga0209380_10471659All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium733Open in IMG/M
3300027908|Ga0209006_10096716All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria2620Open in IMG/M
3300028013|Ga0265350_103724All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium717Open in IMG/M
3300028572|Ga0302152_10235406All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium596Open in IMG/M
3300028795|Ga0302227_10237497All Organisms → cellular organisms → Bacteria → Acidobacteria698Open in IMG/M
3300028871|Ga0302230_10210072All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium755Open in IMG/M
3300028871|Ga0302230_10371377All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium556Open in IMG/M
3300028906|Ga0308309_10066517All Organisms → cellular organisms → Bacteria → Acidobacteria2668Open in IMG/M
3300028906|Ga0308309_11740177All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium528Open in IMG/M
3300029911|Ga0311361_10941746All Organisms → cellular organisms → Bacteria734Open in IMG/M
3300029914|Ga0311359_10566521All Organisms → cellular organisms → Bacteria847Open in IMG/M
3300029917|Ga0311326_10035490All Organisms → cellular organisms → Bacteria2961Open in IMG/M
3300029945|Ga0311330_10060301All Organisms → cellular organisms → Bacteria → Acidobacteria4034Open in IMG/M
3300029945|Ga0311330_10097736All Organisms → cellular organisms → Bacteria2949Open in IMG/M
3300030007|Ga0311338_10017485All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae10493Open in IMG/M
3300030020|Ga0311344_10623237All Organisms → cellular organisms → Bacteria → Acidobacteria919Open in IMG/M
3300030049|Ga0302191_10269893All Organisms → cellular organisms → Bacteria628Open in IMG/M
3300030503|Ga0311370_10127075All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis3552Open in IMG/M
3300030524|Ga0311357_11159697All Organisms → cellular organisms → Bacteria → Acidobacteria670Open in IMG/M
3300030617|Ga0311356_11574360All Organisms → cellular organisms → Bacteria → Acidobacteria592Open in IMG/M
3300030737|Ga0302310_10318773All Organisms → cellular organisms → Bacteria → Acidobacteria869Open in IMG/M
3300030746|Ga0302312_10105124All Organisms → cellular organisms → Bacteria → Acidobacteria1153Open in IMG/M
3300030879|Ga0265765_1039705All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium622Open in IMG/M
3300031231|Ga0170824_103409837All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium767Open in IMG/M
3300031238|Ga0265332_10260845All Organisms → cellular organisms → Bacteria → Acidobacteria717Open in IMG/M
3300031247|Ga0265340_10305664All Organisms → cellular organisms → Bacteria → Acidobacteria705Open in IMG/M
3300031258|Ga0302318_10558367All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium580Open in IMG/M
3300031525|Ga0302326_10043698All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis8681Open in IMG/M
3300031708|Ga0310686_102917950All Organisms → cellular organisms → Bacteria → Acidobacteria932Open in IMG/M
3300031708|Ga0310686_103533034All Organisms → cellular organisms → Bacteria → Acidobacteria538Open in IMG/M
3300031708|Ga0310686_105444310All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium576Open in IMG/M
3300031708|Ga0310686_107380476All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1976Open in IMG/M
3300031708|Ga0310686_108642043All Organisms → cellular organisms → Bacteria → Acidobacteria2006Open in IMG/M
3300031708|Ga0310686_113562618All Organisms → cellular organisms → Bacteria562Open in IMG/M
3300031715|Ga0307476_10211929All Organisms → cellular organisms → Bacteria → Acidobacteria1409Open in IMG/M
3300031720|Ga0307469_12028916All Organisms → cellular organisms → Bacteria559Open in IMG/M
3300031753|Ga0307477_10286401All Organisms → cellular organisms → Bacteria → Acidobacteria1139Open in IMG/M
3300031890|Ga0306925_10607488All Organisms → cellular organisms → Bacteria → Acidobacteria1154Open in IMG/M
3300031996|Ga0308176_10807209All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WOR-3 → candidate division WOR-3 bacterium981Open in IMG/M
3300032174|Ga0307470_10357636All Organisms → cellular organisms → Bacteria1015Open in IMG/M
3300032770|Ga0335085_10801719All Organisms → cellular organisms → Bacteria → Acidobacteria1036Open in IMG/M
3300032783|Ga0335079_10450375All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium AB601380Open in IMG/M
3300032783|Ga0335079_11685834All Organisms → cellular organisms → Bacteria → Acidobacteria620Open in IMG/M
3300032892|Ga0335081_10026637All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis9319Open in IMG/M
3300032892|Ga0335081_12141180All Organisms → cellular organisms → Bacteria → Acidobacteria591Open in IMG/M
3300032955|Ga0335076_10045863All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4349Open in IMG/M
3300033158|Ga0335077_10558140All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella aggregans1202Open in IMG/M
3300033290|Ga0318519_10964912All Organisms → cellular organisms → Bacteria → Acidobacteria528Open in IMG/M
3300034163|Ga0370515_0071766All Organisms → cellular organisms → Bacteria → Acidobacteria1507Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil13.78%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil5.78%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment5.33%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil5.33%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil4.89%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa4.44%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog4.00%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.56%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil3.56%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil3.56%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds3.11%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.11%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.11%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland3.11%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland2.67%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.67%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland2.22%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.78%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog1.78%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil1.78%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.78%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.78%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.33%
WatershedsEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds0.89%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.89%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.89%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa0.89%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.89%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.89%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.89%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.89%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.89%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.89%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.44%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.44%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.44%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.44%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.44%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.44%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.44%
BiofilmEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm0.44%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.44%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.44%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.44%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.44%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.44%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000891Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soilEnvironmentalOpen in IMG/M
3300003505Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924)EnvironmentalOpen in IMG/M
3300004082Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004152Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005167Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121EnvironmentalOpen in IMG/M
3300005176Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128EnvironmentalOpen in IMG/M
3300005177Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139EnvironmentalOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300005537Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1EnvironmentalOpen in IMG/M
3300005538Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1EnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005575Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151EnvironmentalOpen in IMG/M
3300005712Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4EnvironmentalOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300005995Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006172Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014EnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300007982Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaGEnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009624Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10EnvironmentalOpen in IMG/M
3300009665Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10EnvironmentalOpen in IMG/M
3300009759Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_10EnvironmentalOpen in IMG/M
3300009824Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaGEnvironmentalOpen in IMG/M
3300009839Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaGEnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300014169Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaGEnvironmentalOpen in IMG/M
3300014489Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaGEnvironmentalOpen in IMG/M
3300014495Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014658Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaGEnvironmentalOpen in IMG/M
3300015242Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300016702Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017822Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2EnvironmentalOpen in IMG/M
3300017823Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3EnvironmentalOpen in IMG/M
3300017933Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1EnvironmentalOpen in IMG/M
3300017936Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1EnvironmentalOpen in IMG/M
3300017940Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100EnvironmentalOpen in IMG/M
3300017943Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300017988Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaGEnvironmentalOpen in IMG/M
3300017995Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1EnvironmentalOpen in IMG/M
3300018006Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4EnvironmentalOpen in IMG/M
3300018019Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150EnvironmentalOpen in IMG/M
3300018047Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10EnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300019278Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020022Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021476Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2)EnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300021858Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021861Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022522Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022722Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300023090Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 20-24EnvironmentalOpen in IMG/M
3300024295Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 1-5EnvironmentalOpen in IMG/M
3300025134Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025414Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025473Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026959Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027080Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF009 (SPAdes)EnvironmentalOpen in IMG/M
3300027109Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF008 (SPAdes)EnvironmentalOpen in IMG/M
3300027313Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 45 (SPAdes)EnvironmentalOpen in IMG/M
3300027537Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027567Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027591Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027633Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027641Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027645Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027826Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027842Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300027908Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300028013Soil microbial communities from Maridalen valley, Oslo, Norway - NSE2EnvironmentalOpen in IMG/M
3300028572Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_1EnvironmentalOpen in IMG/M
3300028795Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_1EnvironmentalOpen in IMG/M
3300028871Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_1EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029911III_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300029914III_Bog_E2 coassemblyEnvironmentalOpen in IMG/M
3300029917I_Bog_E1 coassemblyEnvironmentalOpen in IMG/M
3300029945I_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300030007I_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030020II_Bog_N1 coassemblyEnvironmentalOpen in IMG/M
3300030049Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E3_1EnvironmentalOpen in IMG/M
3300030503III_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030524II_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300030617II_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030737Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_2EnvironmentalOpen in IMG/M
3300030746Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_1EnvironmentalOpen in IMG/M
3300030879Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031238Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaGHost-AssociatedOpen in IMG/M
3300031247Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaGHost-AssociatedOpen in IMG/M
3300031258Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_1EnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M
3300034163Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI10214J12806_1355281713300000891SoilDMAGMEKNILAMKEPVFAVRPRVAFGLYEKNFMGSATRWMFKG*
JGIcombinedJ51221_1026637623300003505Forest SoilMSSMKDDILSLKEPVFAVRPRVVFGFWEKHFQSKSTRWKFA*
Ga0062384_10034976123300004082Bog Forest SoilDMGNMKEDILSMKEPVFAVRPRVVFGLWEKHFQSKSTRWTFE*
Ga0062389_10038402233300004092Bog Forest SoilMGKMKEDILSMKEPIFAVRPKVVFALWEKYFQSKSTRWIS*
Ga0062389_10273225513300004092Bog Forest SoilMIPAYERKYKYDLSKMKDDMLSMKEPVFFVRPKVVFALWEKHFPTKSTRWKF*
Ga0062386_10151389923300004152Bog Forest SoilGKMKDDILSMREPIFAVRPRVVFALWEKHFQGKSTRWKFR*
Ga0062594_10172303213300005093SoilKYHFDMAGMEKDILAMKEPVFAVRPRLVFGLYEKNFMGSATRWKFKS*
Ga0066672_1058053523300005167SoilMGTIVNEKDDILSMKEPVFAVRPRVVFGLYEKKFIHAASRWRFE*
Ga0066679_1074578923300005176SoilYEKKYKWDLSTMKDDMLSMKEPVFAVRPRVVFGLWEKEFMGKSTRWQFE*
Ga0066690_1078855213300005177SoilKFISPYEKKYKFDMASMKDDLLSMKEPVFAVRPRVVFGLWEKHFQTKSTRWKFK*
Ga0070671_10042285513300005355Switchgrass RhizosphereMEKDILSMKEPVFAVRPKVAFGLYEKKFMSSATRWTFKG*
Ga0070710_1105914223300005437Corn, Switchgrass And Miscanthus RhizosphereKFLAPYERKYKWDMSSMEEGILSMKEPVFAVRPKIVFALWEKYFQNRSTRWQFE*
Ga0070694_10048178313300005444Corn, Switchgrass And Miscanthus RhizosphereKYQPKYHFDMAGMEKDILAMKEPVFAVRPRLVFGLYEKNFMGSATRWKFKS*
Ga0068867_10194792313300005459Miscanthus RhizosphereDMAGMEKDILAMKEPVFAVRPRVVFGLYEKNFMGSATRWMFKG*
Ga0070679_10037506623300005530Corn RhizosphereRKYQPKYHFDMAGMEKDILAMKEPVFAVRPRLVFGLYEKNFMGSATRWKFKS*
Ga0070679_10150902123300005530Corn RhizosphereKFLAPYERKYKWDMSSMEDGILSMKEPVFAVRPRIVFALWEKYFQNRSTRWQFE*
Ga0070730_1087709423300005537Surface SoilSMKDDILSMKEPVFAVRPKVVFALWEKYFQSKSTRWKFE*
Ga0070731_1105679423300005538Surface SoilDLSKMKDDMLSMKEPVFSVRPKVVFALWEKYFQTKSTRWRFE*
Ga0070733_1030912813300005541Surface SoilYQRKYDWDLSSMQDDLLSMKEPVFAVRPKVVFALWEKYFQTKSTRWQFK*
Ga0070732_1017649423300005542Surface SoilKDDILSMKEPVFAVRPLVVFGLWEKYFQSKSTRWKFA*
Ga0070732_1047709523300005542Surface SoilKLIPVYERKYKWDLSSMKDDMLSMKEPVFAVRPRIVFALWEKHFQTKSTRWTFE*
Ga0070732_1085925713300005542Surface SoilILSMKEPVFAVRPRVVFGLWEKYFVEKSTRWTFE*
Ga0070696_10003371113300005546Corn, Switchgrass And Miscanthus RhizosphereKYQPKYHFDMAGMEKDILAMKEPVFALRPRVVFGLYEKNFMGSATRWKFKP*
Ga0070696_10106139723300005546Corn, Switchgrass And Miscanthus RhizosphereFLKKYEPKYNFDMGQMKGDILSMKEPVFAVRPQRVFGLFEKKFMSSATRWIFTK*
Ga0068855_10133530723300005563Corn RhizosphereSSMKDDILSMKEPVFAVLPRVVFALWEKHFQSKSTRWEFG*
Ga0066702_1016261513300005575SoilVYERKYKFDMSSMKADILSMKEPVFAVRPRLVFAMWEKHFQSKSTRWKFE*
Ga0066702_1019077713300005575SoilDMGKMKDDILSMKEPIFAVRPQVVFGFWEKYFQSKSTRWKFE*
Ga0070764_1011841913300005712SoilKYKYSLASMRDDILSMKEPVYAVRPTMAFALPEKSFQTKSTRWKFR*
Ga0070766_1037089323300005921SoilTYERKYKFDMKGMEQDILSMKEPVFAVRPRLAFGLWEKHFVGKSTRWKFE*
Ga0070766_1121754313300005921SoilKYNFDMSKMKPDILSMKEPIFAVRPRVVFGLWEKEFIEKSTRWTFERQ*
Ga0066790_1002506623300005995SoilMKDDILSMKEPVFAVRPRVVFGLPEKHFQSKSTRWMFV*
Ga0070717_1087075113300006028Corn, Switchgrass And Miscanthus RhizosphereLAMKEPVFTVRPRVVFGLYEKKFVSSATRWKFTG*
Ga0075028_10068766813300006050WatershedsLYDRKYKFDMGAMKDDLLAMKEPVFAVRPRVVFALPEKQFQSKSTRWKFA*
Ga0075029_10024377113300006052WatershedsKFDMSSMERDILSMKEPVFAVRPRVVFGMYEKKFMSSATRWKFEN*
Ga0075029_10076345413300006052WatershedsWDMSKMKDDILSLKEPVFAVKPRVVFALWEEHFQNRSTRWKFD*
Ga0075017_10008770533300006059WatershedsAMKADILSMKEPVFAVCPLTVFALWEEYFQEKSTRWKFE*
Ga0075017_10017044633300006059WatershedsLLSMKEPVFAIRPRVVFGLWEKHFQSKSTRWKFE*
Ga0075017_10086905313300006059WatershedsDILSKKEPVFAVRPLVVFGLYEKNFVGSATRWKFSA*
Ga0075018_1060966023300006172WatershedsDILSMKEPVFAVRPKIAFGLYEKKFLSSATRWTFTG*
Ga0070765_10136094523300006176SoilDFDMKAMEKDILAMKEPVFAVRPRLVFGLYEKKFMSSATRWNFTS*
Ga0066659_1029259423300006797SoilMKRDILSQKEPVFVVRPHVAFGLYEKKYMESATRWKFLR*
Ga0102924_103145833300007982Iron-Sulfur Acid SpringPAYERKYKFSLATMKDDILSMKEPVYSVRPRVVFGLWEKHFQDKSTRWKFES*
Ga0099829_1136905723300009038Vadose Zone SoilLSMKEPVFAVRPRLVFGLYEKKFIESATRWRFKG*
Ga0099792_1107226613300009143Vadose Zone SoilYKFDMGGMKQDILSMKEPVFAVRPRLVFGLWEKDFVGKSTRWRF*
Ga0105242_1123923413300009176Miscanthus RhizosphereILAMKEPVFAVRPRVAFGLYEKNFMGSATRWMFKG*
Ga0116105_100372113300009624PeatlandKYKFDMKAMKQDILAMKEPVFAVRPRVVFGLWEKEFVDRSTRWKFAST*
Ga0116135_110975423300009665PeatlandKFLPPYEKKYKFDMSKMKDDILSMKEPVFAVRPRVVFGLWEKHFQSKSTRWKFE*
Ga0116101_107268413300009759PeatlandMKEDVLSMKEPVFAVRPRVAFALWEKYFVGRSTRWKFE*
Ga0116219_1041479713300009824Peatlands SoilARYKPKYNFDLSSMKDDILSMKEPVFAVRPKVVFALWEKYFQTKSTRWKFN*
Ga0116223_1030642513300009839Peatlands SoilRRKFIARYKPKYNFDLSSMKDDILSMKEPVFAVRPKVVFALWEKYFQTKSTRWKFN*
Ga0126380_1034986223300010043Tropical Forest SoilKFLAQYTRKYHWDMSAMKDDILSMKEPVFAVRPRVVFALWEKYFQTKSTRWKFE*
Ga0126373_1113209623300010048Tropical Forest SoilKYKFDMSKMKDDILSMKEPVFAVRPRLVFALWEKHFQGKSTRWKFD*
Ga0074044_1000619773300010343Bog Forest SoilMKGMKQDILSMKEPVLAVRPQVVFGLWEKKFVGKSTRWKFA*
Ga0074044_1002855913300010343Bog Forest SoilDILSLKEPVFSVRPRVVFALWEKHFVGKSTRWKFE*
Ga0126376_1007773323300010359Tropical Forest SoilMSAMKDDILSMKEPVFAVRPRVVFALWEKYFQTKSTRWKFE*
Ga0126372_1162972113300010360Tropical Forest SoilFDMSTMKDDILSMKEPVFAVRPRVVFAMWEKHFQSKSTRWKF*
Ga0126381_10087991113300010376Tropical Forest SoilKYKFDMSTMKDDILSMKEPVYAVRPRVVFAMWEKHFQNKSTRWKFE*
Ga0126381_10398864323300010376Tropical Forest SoilATMKDDILSMKEPVYAVRPRVVFAMWEKHFQDKSTRWKFD*
Ga0136449_10379313313300010379Peatlands SoilILSMKEPVFAVRPKVVFALWEKHFQTKSTRWKLD*
Ga0150983_1324743223300011120Forest SoilPTYERKYKFDMKGMEQDILSMKEPVFAVRPRLAFALWEKHFVGKSTRWRFE*
Ga0150983_1533793913300011120Forest SoilLYERKYKFDMGAMKKDILSMKEPVFTVRPRVAFGLWEKYFQGKSTRWRFV*
Ga0137392_1026011613300011269Vadose Zone SoilNYGRKYKWDMSTMKEDILSMKEPVFAVRPRVVFGLWEKEFMERSTRWKFE*
Ga0137389_1107667813300012096Vadose Zone SoilRKLLPKYERKYKFDMGTMKDDILSMKEPVFAVRPRVVFGLWEKDFIGKSTRWKFE*
Ga0137389_1181424013300012096Vadose Zone SoilRKYKFDMKDMKDDLLSMKEPVFAVRPRVVFGLWEKEFIGKSTRWQFE*
Ga0137383_1087348413300012199Vadose Zone SoilKFDLSNMKDDLLSMKEPVLAVRPRVVFGLWEKYFQSKSTRWKFE*
Ga0137399_1027534413300012203Vadose Zone SoilEFLKKCQRKYNFDMAGMEKDILSMKEPVFAVRPRVVFGLYEKKFVGSATRWKFTG*
Ga0137399_1134816513300012203Vadose Zone SoilYERKYKFDMKGMTQDILGMKEPVFAVRPRVVFGLWEKHFIGKSTRWKFK*
Ga0137362_1046199613300012205Vadose Zone SoilDILSMKEPVFAVRPRVVFGLWEKKFMEKTTRWMF*
Ga0137395_1070612523300012917Vadose Zone SoilAKYSGKYDWDMASMENDILSMKEPVFAVRPRVVFGLWEKKFMETTTRWMFP*
Ga0137396_1095135223300012918Vadose Zone SoilKKYKPKYNFDMSGMEQDILSMKEPVFAVRPRLVFGLYEKKFMESATRWRFKG*
Ga0164301_1093909313300012960SoilMKDDILSMKEPVFAVRPRVVFGMWEKYFQSKSTRWKFE*
Ga0126369_1040872413300012971Tropical Forest SoilMKDDILSMKEPVYAVRPRVVFAMWEKHFQDKSTRWKFD*
Ga0164304_1016037533300012986SoilYHFDMAGMEKNILAMKEPVFAVRPRVAFGLYEKNFMGSATRWMFKG*
Ga0164305_1181759923300012989SoilYHFDMAGMEKDILAMKEPVFAVRPRVVFGLYEKNFIGSATRWKFKA*
Ga0157373_1018928313300013100Corn RhizosphereLKKYQPKYHFDMAGMEKDILAMKEPVFALRPRVVFGLYEKNFMGSATRWKFKS*
Ga0181531_1016086813300014169BogKGILSMKEPVFAVRPRVAFGLWEKHFVGKSTRWTFD*
Ga0181531_1059938113300014169BogMLPVYERKYKFDMGAMKKDILAMKEPVFAVRPRVAFGLWEKHFVGKSTRWVFE*
Ga0182018_1028398413300014489PalsaDILSMKEPVFAVRPRVVFGLWEKDFVGKATRWSFE*
Ga0182015_1044243623300014495PalsaERKYKFDMKGMEQDILSMKEPVFAVRPRLAFGLWEKHFVGKSTRWKFE*
Ga0182024_1016686453300014501PermafrostGMEQDILSMKEPVFAVRPRLAFGLWEKHFVGKSTRWKFE*
Ga0181519_1029196713300014658BogDGILSMKEPVFSVRPRVAFALWEKYFQSKSTRWKFE*
Ga0137412_1068650913300015242Vadose Zone SoilKFLATYERKYKFDMGGMKQDILSMKEPVFAVRPRLVFGLWEKDFVGKSTRWTF*
Ga0137403_1108922013300015264Vadose Zone SoilMKDDILAMKEPVFAVRPRIAFGLWEKEFIGKTTRWKFE*
Ga0132257_10355472013300015373Arabidopsis RhizosphereDMSTMKDDILSMKEPVYAVRPYVVFAMWEKHFQSKSTRWKFE*
Ga0182039_1045749233300016422SoilMLPLYERKYNFDMASMKDDILSMKEPVFAVRPRVVFAMWEKHFQSKSTRWKFA
Ga0182038_1178930813300016445SoilMKDDILSMKEPVFAVRPRVVFAMWEKHFLSKSTRWKLE
Ga0181511_152953013300016702PeatlandEKKYKFDMSSMKDGILSMKEPVFSVRPRVAFALWEKYFQSKSTRWKF
Ga0187802_1033404723300017822Freshwater SedimentRKFLPAYEKKYKFDMSKMKDDILSVKEPVFAVRPRVVFGLWEKYFQSKSTRWKFE
Ga0187818_1006134113300017823Freshwater SedimentAYQRKYKFDLSSMKDDMLSMKEPVFAVRPRVVFGLWEKHFQNKSTRWKLE
Ga0187818_1038318813300017823Freshwater SedimentAYQRKYKFDLSSMKDDMLSMKEPVFAVRPRVVFGLWEKHFQGKSTRWKFE
Ga0187801_1015500913300017933Freshwater SedimentKYKFDMSTMKDDILSMKEPVFAVRPRVVFGFWEKHFQSKSTRWKFE
Ga0187821_1007274213300017936Freshwater SedimentILSMKEPVFSVRPRLAFGLYEKKFMASATRWKFGE
Ga0187853_1015450513300017940PeatlandMEPDILSMKEPVFAVRPRVVFGLWEKEFVGKSTRWKFE
Ga0187853_1047925523300017940PeatlandDMKAMKEDVLSMKEPVFAVRPRVAFALWEKYFVGRSTRWKFE
Ga0187819_1024453723300017943Freshwater SedimentARRKMIPTYERKYKFSLSTMKDDLLSMKEPVFAVRPRVVFGLWEKHFQGKSTRWKFD
Ga0187819_1053610523300017943Freshwater SedimentAYERKYKFDMSTMKDDILSMKEPVFAVRPRLVFGFWEKHFQSKSTRWKFE
Ga0187819_1059459713300017943Freshwater SedimentMKDDMLSMQEPVFAVRPRVVFALWEKHFQSKSTRWKFE
Ga0187879_1071129023300017946PeatlandTYERKYKFNMKGMKDDILSMKEPVFAVRPRVVFGFWEEHFAEKSTRWKFN
Ga0187817_1042700823300017955Freshwater SedimentYDRKYDWDMSKMKDDILSNKEPVFAVRPLVVFGLWEKYFQSKSTRWIFD
Ga0187817_1085465813300017955Freshwater SedimentMKDDILSMKEPVFAVRPRLVFGLWERHFQSKSTRWKFE
Ga0187779_1069406613300017959Tropical PeatlandWDMSTMKNDILSMKEPVFAVRPRVVFGLWEKYFQQKSTRWMFD
Ga0187781_1139421213300017972Tropical PeatlandWDLSKMKNDMLSMKEPVFAIRPRVVFALWEEHFQTKSTRWTFE
Ga0187782_1051661523300017975Tropical PeatlandVYEKKYEWDLSTMKDDMLSMKEPVFAVRSRVVFALWEKHFQSKSTRWKFE
Ga0181520_1087884123300017988BogERKYKFDMKGMKDDILSMKEPVFAVRPRVVFGLWEKYFQEKSTRWIF
Ga0187816_1021197313300017995Freshwater SedimentAYERKYKFDMSSMKDDILSMKEPVIAVRPRVVFAMWEKYFQSKSTRWKFE
Ga0187804_1043887123300018006Freshwater SedimentRKFMARYKPKYNFDMSSMKDDILSMKEPVFAVRPKVVFAMWEKYFQTKSTRWKFE
Ga0187874_1034434323300018019PeatlandSMKDSIMSMKEPVFAVRPKLVFGLWEKYFQSKSTRWKFE
Ga0187859_1044548323300018047PeatlandFDMGAMKKDILAMKEPVFAVRPRVAFGLWEKHFVGKSTRWVFE
Ga0187772_1004652423300018085Tropical PeatlandLSSMKDDMLSMKEPVYAVRPRVVFGLWEKHFQNKSTRWEFTS
Ga0187772_1059220213300018085Tropical PeatlandWDLSNMKEDMLSMKEPVFAVRPRVVFALWEEHFQGRSTRWKFD
Ga0187772_1139086313300018085Tropical PeatlandDDLLSMKEPVFAVRPRVVFALWEKYFQEKSTRWTFQ
Ga0187770_1000528773300018090Tropical PeatlandMKQDILSMKEPVFAVRPRTAFGRWEKEFIGKSMRWTFE
Ga0187800_147968213300019278PeatlandEKKYDWDLSNMKDDMLSMKEPVFAVRPRVVFGLWEEHFQSKSTRWKFE
Ga0193733_100236013300020022SoilDMAGLEKDILAMKEPVFAVRPSVVFGLYEKKFMSSATRWKFEG
Ga0210407_1001621813300020579SoilYKFDMKGMKNDILSMKEPVFAVLPRVVFGLWEKHFVGKSTRWKF
Ga0210403_1036432213300020580SoilYERKYKFDMKGMAQDILSMKEPVYAVSPRVVFGLWEEYFIGKSTRWEF
Ga0210403_1149745913300020580SoilYKFDMSTMKDDILSMKEPVFAVRPLVVFAMWEKHFQSMSTRWKFE
Ga0210395_1099228113300020582SoilKWDMSSMKDDILSMKEPVYTVRPRAVFGLWEKKFMGSATRWKFE
Ga0210401_1100875423300020583SoilDLSTMKDDILSMKEPVFAVRPRVVFAMWEKHFQSKSTRWKFE
Ga0210406_1076169713300021168SoilMAQDILSMKEPVYAVSPRVVFGLWEKYFIGKSTRWEF
Ga0210400_1121288413300021170SoilWDMASMENDILSMKEPVFAVRPRVVFGLWEKRFMETTTRWLFH
Ga0210405_1099065023300021171SoilFDMSKMKPDILSMKEPIFTVRPRVVFGLWEKEFVEKSTRWTFERQ
Ga0210408_1123049313300021178SoilDMSSMEKDILSMKEPVFAVHPRVAFGLSEKKFIGSATRWKFVT
Ga0210408_1125507313300021178SoilSMKVDILSMKEPVFAVRPRVVFALWEKYFQTKSTRWKFE
Ga0210396_1055188613300021180SoilLAQYERKYKFDMSSMKADILAMKEPVFAVRPQLVFGLWEKYFQSKSTRWKFE
Ga0210396_1083360213300021180SoilAHERKYKFDMSTMKDDILSMKEPVFAVRPRVVFAMWEKHFQSKSTRWKFE
Ga0210393_1033786113300021401SoilERKYKFDMSKMKQDILSMKEPIFAVRPRVVFALWEKHFAGTSTRWTFAEK
Ga0210393_1168079413300021401SoilKGDILSMKEPVFAVRPRVVFALWEKHFQNKSTRWEFL
Ga0210385_1027449313300021402SoilRKCLPACEKKYKFDLSSMRDGILSMKEPVFAVRPRVVFGLWEKYFQSKSTRWKFE
Ga0210397_1107898413300021403SoilSKMKEDMLSMKEPVFAVRPKTVFALWEKYFQSKSTRWRFE
Ga0210386_1012347513300021406SoilSRRKFLSTYQRKYKFDMSSMKDDILSLKEPVFAVRPRVVFGFWEKHFQSKSTRWKFA
Ga0210386_1106569823300021406SoilMEGMKDDILSMKEPVFSVRPRVVFGLWEKHFQSKSTRWKLE
Ga0210394_1010851913300021420SoilERKYKFDMSKMKDDILSMKEPIFTVRPRVVFGLWEKEFIGKSTRWKFA
Ga0210394_1063255323300021420SoilFLAKYKPKYNFDMSSMKDDILSMKEPVFAVRPRVVFALWEKFFQTKSTRWKFE
Ga0210394_1140033823300021420SoilLSSFDMSSMEKDILSMKEPVFAVHPRVAFGLSEKKFIGSATRWKFVT
Ga0210384_1011312833300021432SoilMSTMKDDILSMKEPVFAVRPHTVFGFWEKYFVEKSTRWVFE
Ga0210384_1029323323300021432SoilFNMDSMKQDILSMKEPVFVVRPRLAFGLYEKKFMSSATRWKFSS
Ga0210391_1006890723300021433SoilMEQDILSMKEPVFAVHPRVVFGLWEKEFVGKSTRWKFEPQQPD
Ga0187846_1042528323300021476BiofilmYKFDLSSMKDDLLSMKEPVYAVRPKVVFAFWEKYFQSKSTRWKFE
Ga0210402_1197042413300021478SoilPVYERKYKFDMGAMKADILSMKEPVFAVRPRVVFGLWEKYFVGKSTRWEF
Ga0210409_1115134323300021559SoilYQGKYSFDMSSMKQDILSMKEPVFAVRPRVVFGLWEKHFPSKSTRWKFE
Ga0126371_1204337723300021560Tropical Forest SoilMKDDILSMKEPVFAVRPRVVFALWEKYFQTKSTRWKFE
Ga0213852_148381513300021858WatershedsKEDLLSMKEPVFAIRPRMVFGLWEKHFQNKSTRWKFE
Ga0213853_1134156513300021861WatershedsRRKLIPAYEKKYTFDLSTMKDDLLSMKEPVFAIRPRVVFGLWEKHFQSKSTRWKFE
Ga0242659_101407723300022522SoilPCERKYSFDLSKMKSDILSMKEPVFAVRPRVVFGLWEKEFIGKSTRWTFEEQ
Ga0242659_103967313300022522SoilKMKPDILSMKEPIFTVRPRVVFGLWEKEFVEKSTRWTFERQ
Ga0242659_106225423300022522SoilKYKFDMGAMKKDILSMKEPVFTVRPRVAFGLWEKYFQGKSTRWRFV
Ga0242657_115659713300022722SoilNFDMSKMKPDILSMKEPIFAVRPRVVFGLWEKEFVDKSTRWTFERQ
Ga0224558_112016523300023090SoilGMEQDILSMKEPVFAVRPRVVFGLWEKEFVGKSTRWKFE
Ga0224556_112891213300024295SoilKFDMKGMEQDILSMKEPVFAVRPNTVFGLWEKHFVSKSTRWKF
Ga0207416_113162513300025134Iron-Sulfur Acid SpringYKFSLATMKDDILSMKEPVYSVRPRVVFGLWEKHFQDKSTRWKFES
Ga0208935_102350313300025414PeatlandKQDILAMKEPVFAVRPRVVFGLWEKEFVDRSTRWKFAST
Ga0208190_106538623300025473PeatlandLPKYERKYKFDMKGMEPDILSMKEPVFAVRPRVVFGLWEKEFVGKSTRWKFE
Ga0207699_1012809513300025906Corn, Switchgrass And Miscanthus RhizosphereDMAGMEKDILSMKEPVFAVRPRIVFGLYEKKFVNSATRWKFAG
Ga0207649_1014628513300025920Corn RhizosphereYHFDMAGMEKDILAMKEPVFAVRPRLVFGLYEKNFMGSATRWKFKS
Ga0207664_1141847123300025929Agricultural SoilSKMKDDLLSMKEPVFAVRPKVVFALWEKYFQTKSTRWRFE
Ga0207664_1153868113300025929Agricultural SoilGMKKDIRSMKEPVFAVRPRLVFGLWEKHFIGKSTRWTF
Ga0207686_1041384523300025934Miscanthus RhizosphereSMEKDILAMKEPVFAVRPRVVFGLYEKNFMGSATRWKFKG
Ga0207711_1039598223300025941Switchgrass RhizosphereDMSGMAQDILSMKEPVFAVRPNLVFGLYEKKFMESATRWRFKG
Ga0207667_1117460423300025949Corn RhizosphereSSMKDDILSMKEPVFAVLPRVVFALWEKHFQSKSTRWEFG
Ga0207702_1058175123300026078Corn RhizosphereDFDMSTMAKDILEMKEPVFAVRPKVVFGLYEKKFMSSATRWTFKG
Ga0207702_1190005413300026078Corn RhizosphereEFLKKYQPKYHFDMAGMEKDILAMKEPVFAVRPRVVFGLYEKNFMGSATRWKFKP
Ga0207648_1177629423300026089Miscanthus RhizosphereHFDMAGMEKDILAMKEPVFAVRPRVVFGLYEKNFMGSATRWMFKG
Ga0207852_103097823300026959Tropical Forest SoilRKYKWDLSTMKEGMLSMKEPVFAVRPKVVFGLWEEHFQSKSTRWKFE
Ga0208237_101036023300027080Forest SoilAMKDDILSMKEPVFAVRPRVVFGLWEKHFVGKTTRWVFK
Ga0208603_100476833300027109Forest SoilMKQDILSMKEPVFAVRPRVVFGLWEKDFVGKSTRWKIE
Ga0207780_105935313300027313Tropical Forest SoilKMLPLYERKYKFDMSTMKADILSMKEPVYAVRPRLVFAMWEKHFQSKSTRWKFE
Ga0209419_107198213300027537Forest SoilLNCKFLAKYTGKYKFDMSSMQDDILSMKEPVFAVRPRVVFALWVRHFQGKSTGWKFG
Ga0209115_114591623300027567Forest SoilERKYKFDMKGIEQDILSMKEPVFAVRPRVAFGLWEKEFVGKATRWKFEKVKRRRA
Ga0209733_104691423300027591Forest SoilLPTYERKYKFDMKAMKQDILSMKEPVFQVRPRAVFGLWEKYFVEKSTRWKFE
Ga0208988_103525523300027633Forest SoilKWDMSAMKEDILTLKEPVFAVRPRVVFGFWEKEFMGKSTRWRFE
Ga0208827_116167313300027641Peatlands SoilTYERKYKFDMGSMKDDILSMKEPIFAVRPRLVFGLWEKEFIGKSTRWKFD
Ga0209117_118840223300027645Forest SoilILSMKEPVFAVRPRVVFGLWEKKFMEQTTRWIFGSSDS
Ga0209060_1056983523300027826Surface SoilKLLPLYEKKYKFDMSKMKDDILSMKEPVFAVRPRVVFALWEKHFQGKSTRWIFE
Ga0209580_1050894823300027842Surface SoilFNMKGMEDDILSMKEPVFAVRPRVVFGLWEKYFVEKSTRWTFE
Ga0209275_1045146823300027884SoilGAMKKDILSMKEPVFTVRPRVAFGLWEKYFQGKSTRWRFV
Ga0209380_1047165913300027889SoilDMSTMKQDILSMKEPVFAVRPRVVFGVWEKHFMEKTTRWTFE
Ga0209006_1009671613300027908Forest SoilMSSMKDDILSMKEPVFAVRPKVVFALWEKHFQTRSTRWKFE
Ga0265350_10372423300028013SoilKYKFDMGAMKKDILSMKEPVFAVRPRVVFGLWEKHFVGKSTRWTFD
Ga0302152_1023540623300028572BogMSKMKADILSMKEPVFAVRPRVVFGLWEKEFIEKSTRWTFE
Ga0302227_1023749733300028795PalsaDMSGMKQGILSMKEPVFAVRPRAVFGLWEKYFVGKSTRWRLK
Ga0302230_1021007213300028871PalsaGMKNDILSMKEPVFAVRPRVVFGLWEKHFAGKSTRWKFE
Ga0302230_1037137723300028871PalsaTYERKYTFDMGGMKQDILSMKEPVFAVRPSVAFGLWEKHFVGKSTRWKFE
Ga0308309_1006651713300028906SoilDMGAMKKDILSMKEPVFAVRPRVAFGLWEKHFVGKSTRWRFD
Ga0308309_1174017723300028906SoilILSMKEPIFTVRPRVVFGLWEKEFVEKSTRWTFERQ
Ga0311361_1094174613300029911BogERKYKFDMKGMKHDILSMKEPVFAVRPRLVFGLWEKEFVGKSTRWKF
Ga0311359_1056652113300029914BogKFLSAYERKYKFDMKGMKQEIFSMKEPVFAVRPRLAFGLWEKYFVEKSTRWKFQPGP
Ga0311326_1003549013300029917BogPARRKFLSAYERKYKFDMKGMKQEIFSMKEPVFAVRPRLAFGLWEKYFVEKSTRWKFQPG
Ga0311330_1006030113300029945BogMKNYILSMKEPVFAVRPRVVFGLWEKHFAGKSTRWKFE
Ga0311330_1009773633300029945BogRFLSAYERKYKFDMKGMKQEIFSMKEPVFAVRPRLAFGLWEKYFVEKSTRWKFQPGP
Ga0311338_1001748553300030007PalsaMSGMKQGILSMKEPVFAVRPRAVFGLWEKYFVGKSTRWRLK
Ga0311344_1062323713300030020BogNDILSMKEPVFAVRPRVVFGLWEKHFAGKSTRWKFE
Ga0302191_1026989313300030049BogERKYKFDMKGMKQEIFSMKEPVFAVRPRLAFGLWEKYFVEKSTRWKFQPGP
Ga0311370_1012707513300030503PalsaMKGMKDDILSMNEPVFAVRPGLVFGLWEKHFQSKATRWKFESIRFPLRV
Ga0311357_1115969713300030524PalsaYKFDMKGMEQEILSMKEPVFAVRPRVVFGFWEKHFAGKSTRWKFE
Ga0311356_1157436023300030617PalsaHVKHWLLPPYEKKYKFDMSKMKDDILSMKEPVFVVRPRVVFGLWEKYFQSKSTRWTFE
Ga0302310_1031877313300030737PalsaRKFLPVYERKYKFDMSGMKNDILSMKEPVFAVRPRVVFGLWEKHFAGKSTRWKFE
Ga0302312_1010512413300030746PalsaRRKFLPVYERKYKFDMSGMKNDILSMKEPVFAVRPRVVFGLWEKHFAGKSTRWKFE
Ga0265765_103970523300030879SoilIYERKYKFSMKGMEQDILSMKEPVFAVRPRVVFGLWEKEFVGKATRWKFEKAK
Ga0170824_10340983723300031231Forest SoilEKDILAMKEPVFAIRPRVVFGLYEKKFVSSATRWKFTK
Ga0265332_1026084523300031238RhizosphereGSMKDGILSMKEPVFAVRPRVVFGLSEKHFQSKSTRWKFE
Ga0265340_1030566413300031247RhizosphereDMSSMKDDILAMKEPVFAVRPRVVFGLSEKYFQSKSTRWKFE
Ga0302318_1055836713300031258BogDMSKMKADILSMKEPVFAVRPRVVFGLWEKEFIEKSTRWTFE
Ga0302326_1004369893300031525PalsaQEILSMKEPVFAVRPRVVFGFWEKHFAGKSTRWKFE
Ga0310686_10291795023300031708SoilLSMKEPVFAVRPRVVFGLWEKEFVGKATRWKFEKAKRRRA
Ga0310686_10353303413300031708SoilMKKDILSMKEPVFTLRPRVAFGLWEKYFQGKSTRWRFV
Ga0310686_10544431023300031708SoilEDILSMKEPVFAVRPRVVFGLWEKQFIGKSTRWTFERQ
Ga0310686_10738047613300031708SoilEGMKDDILSMKEPVFAVRPRVVFGLWEKHFQSKSTRWKFEV
Ga0310686_10864204313300031708SoilLSQYQRKYKFDMSSMKLDILSMKEPVFQIRPRVVFGLWEKHFQSKSTRWKFA
Ga0310686_11356261813300031708SoilRKYSFDMSKMKADILSMKEPIFAVRPRVVFGLWEKQFIEKSTRWTFEGK
Ga0307476_1021192913300031715Hardwood Forest SoilERKYKFDMGAMKDDILSMKEPVFAVRPRLVFAMWEKHFQSKSTRWKFE
Ga0307469_1202891613300031720Hardwood Forest SoilQPKYHFDMAGMEKDILAMKEPVFAVRPRVVFGLYEKNFMGSATRWKFRR
Ga0307477_1028640113300031753Hardwood Forest SoilKHKFDMKGMKEDILSMKEPVFAVRPRLAFGLWEKHFVGKSTRWKF
Ga0306925_1060748813300031890SoilKDDILSMKEPVFAVRPRLVFAMWEKHFQSRSTRWKFE
Ga0308176_1080720913300031996SoilMQEGILSMKEPVFSVRPQVVFALWEKYFQDRSTRWQFE
Ga0307470_1035763613300032174Hardwood Forest SoilPAYERKYKFDMSTMKDDILSMKEPVIAVRPRVVFAMWEKYFQSKSTRWKFE
Ga0335085_1080171913300032770SoilDMSTMKEDILSMKEPVFAVRPRVVFAMWEKHFQTKSTRWKFN
Ga0335079_1045037513300032783SoilRKYKFDMSLMKDDILSMKEPVFTVRPRVVFALWEKHFQNKSTRWKF
Ga0335079_1168583423300032783SoilKFDLSKMKDDMLAMKEPVFAVRPRVVFAMWEKHFQSRSTRWKFE
Ga0335081_10026637123300032892SoilLASMQADLLSMKEPVFAVRPRVVFGLWEENFQSKSTRWKFE
Ga0335081_1214118023300032892SoilKFDMSSMKDGILSMKEPVFTVRPRVVFALWEKHFQKNSTRWKFEQ
Ga0335076_1004586333300032955SoilTMRADILSMKEPVFAVRPRVVFALWEKHFQGKSTRWKFE
Ga0335077_1055814023300033158SoilARKKMLPVYERKYKFDMSTMKDDILSMKEPVFSLRPQTVFAMYEKHFQTKSTRWKFE
Ga0318519_1096491213300033290SoilYERKYKFDMSKMKDDILSMKEPVFAVRPRLVFAMWEKHFQSRSTRWKFE
Ga0370515_0071766_16_1413300034163Untreated Peat SoilMSKMKNDILSMKEPVFAVRPRVVFGLWEKYFAGKSTRWKFE


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.