Basic Information | |
---|---|
Family ID | F020289 |
Family Type | Metagenome |
Number of Sequences | 224 |
Average Sequence Length | 49 residues |
Representative Sequence | MTEDEMVGWHHRLNGHEFEQAPGVGDGQGGLVCCSPWGHKESDTTEQLN |
Number of Associated Samples | 17 |
Number of Associated Scaffolds | 224 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Eukaryota |
% of genes with valid RBS motifs | 69.85 % |
% of genes near scaffold ends (potentially truncated) | 36.16 % |
% of genes from short scaffolds (< 2000 bps) | 87.95 % |
Associated GOLD sequencing projects | 11 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.20 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Eukaryota (62.946 % of family members) |
NCBI Taxonomy ID | 2759 |
Taxonomy | All Organisms → cellular organisms → Eukaryota |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Marine → Unclassified → Unclassified → Continental Margin Sediment (85.268 % of family members) |
Environment Ontology (ENVO) | Unclassified (85.268 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Sediment (saline) (85.268 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.20 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 224 Family Scaffolds |
---|---|---|
PF00078 | RVT_1 | 0.89 |
PF08333 | DUF1725 | 0.45 |
PF02994 | Transposase_22 | 0.45 |
PF00544 | Pectate_lyase_4 | 0.45 |
COG ID | Name | Functional Category | % Frequency in 224 Family Scaffolds |
---|---|---|---|
COG3866 | Pectate lyase | Carbohydrate transport and metabolism [G] | 0.45 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 66.07 % |
Unclassified | root | N/A | 33.93 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300013868|Ga0181469_103288 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 4761 | Open in IMG/M |
3300016461|Ga0126362_10016403 | Not Available | 1704 | Open in IMG/M |
3300016461|Ga0126362_10027013 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla | 1444 | Open in IMG/M |
3300016461|Ga0126362_10032892 | Not Available | 1353 | Open in IMG/M |
3300016461|Ga0126362_10035091 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora → Bovidae → Bovinae → Bos | 1323 | Open in IMG/M |
3300016461|Ga0126362_10036232 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 1309 | Open in IMG/M |
3300016461|Ga0126362_10038218 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 1286 | Open in IMG/M |
3300016461|Ga0126362_10040129 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla | 1264 | Open in IMG/M |
3300016461|Ga0126362_10044268 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora | 1224 | Open in IMG/M |
3300016461|Ga0126362_10046679 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 1202 | Open in IMG/M |
3300016461|Ga0126362_10047514 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 1194 | Open in IMG/M |
3300016461|Ga0126362_10050653 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 1168 | Open in IMG/M |
3300016461|Ga0126362_10057102 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 1120 | Open in IMG/M |
3300016461|Ga0126362_10059922 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 1101 | Open in IMG/M |
3300016461|Ga0126362_10060159 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria | 1100 | Open in IMG/M |
3300016461|Ga0126362_10066114 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora → Bovidae → Bovinae → Bos | 1064 | Open in IMG/M |
3300016461|Ga0126362_10068099 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla | 1054 | Open in IMG/M |
3300016461|Ga0126362_10069325 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 1047 | Open in IMG/M |
3300016461|Ga0126362_10073483 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 1027 | Open in IMG/M |
3300016461|Ga0126362_10074295 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 1023 | Open in IMG/M |
3300016461|Ga0126362_10074614 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 1021 | Open in IMG/M |
3300016461|Ga0126362_10074992 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora → Bovidae → Bovinae → Bos → Bos indicus x Bos taurus | 1019 | Open in IMG/M |
3300016461|Ga0126362_10079398 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 999 | Open in IMG/M |
3300016461|Ga0126362_10080738 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 993 | Open in IMG/M |
3300016461|Ga0126362_10088843 | Not Available | 960 | Open in IMG/M |
3300016461|Ga0126362_10088936 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora → Cervidae → Cervinae → Cervus → Cervus elaphus → Cervus elaphus hippelaphus | 959 | Open in IMG/M |
3300016461|Ga0126362_10089993 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 956 | Open in IMG/M |
3300016461|Ga0126362_10093247 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria | 944 | Open in IMG/M |
3300016461|Ga0126362_10095555 | Not Available | 936 | Open in IMG/M |
3300016461|Ga0126362_10113351 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora → Bovidae → Bovinae → Bos → Bos grunniens | 881 | Open in IMG/M |
3300016461|Ga0126362_10116872 | Not Available | 872 | Open in IMG/M |
3300016461|Ga0126362_10118537 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 867 | Open in IMG/M |
3300016461|Ga0126362_10121947 | Not Available | 859 | Open in IMG/M |
3300016461|Ga0126362_10125007 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 851 | Open in IMG/M |
3300016461|Ga0126362_10127880 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 844 | Open in IMG/M |
3300016461|Ga0126362_10138295 | Not Available | 821 | Open in IMG/M |
3300016461|Ga0126362_10138751 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora → Cervidae → Muntiacinae → Muntiacus → Muntiacus muntjak | 820 | Open in IMG/M |
3300016461|Ga0126362_10141461 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora | 814 | Open in IMG/M |
3300016461|Ga0126362_10142176 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 812 | Open in IMG/M |
3300016461|Ga0126362_10142275 | Not Available | 812 | Open in IMG/M |
3300016461|Ga0126362_10144914 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora | 807 | Open in IMG/M |
3300016461|Ga0126362_10145244 | Not Available | 806 | Open in IMG/M |
3300016461|Ga0126362_10145469 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 806 | Open in IMG/M |
3300016461|Ga0126362_10147042 | Not Available | 803 | Open in IMG/M |
3300016461|Ga0126362_10147701 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla | 801 | Open in IMG/M |
3300016461|Ga0126362_10149467 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora | 798 | Open in IMG/M |
3300016461|Ga0126362_10150583 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora | 796 | Open in IMG/M |
3300016461|Ga0126362_10154199 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora | 789 | Open in IMG/M |
3300016461|Ga0126362_10155054 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 787 | Open in IMG/M |
3300016461|Ga0126362_10158790 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora → Bovidae → Bovinae → Bos | 781 | Open in IMG/M |
3300016461|Ga0126362_10159172 | Not Available | 780 | Open in IMG/M |
3300016461|Ga0126362_10161571 | Not Available | 776 | Open in IMG/M |
3300016461|Ga0126362_10162029 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 775 | Open in IMG/M |
3300016461|Ga0126362_10167501 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora → Bovidae → Bovinae → Bos → Bos grunniens | 766 | Open in IMG/M |
3300016461|Ga0126362_10169847 | Not Available | 762 | Open in IMG/M |
3300016461|Ga0126362_10173161 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora | 757 | Open in IMG/M |
3300016461|Ga0126362_10174316 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 755 | Open in IMG/M |
3300016461|Ga0126362_10174676 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora → Cervidae → Cervinae → Cervus → Cervus elaphus | 754 | Open in IMG/M |
3300016461|Ga0126362_10178522 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 748 | Open in IMG/M |
3300016461|Ga0126362_10186036 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 737 | Open in IMG/M |
3300016461|Ga0126362_10194807 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora | 724 | Open in IMG/M |
3300016461|Ga0126362_10196288 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Erysipelotrichia → Erysipelotrichales → Erysipelotrichaceae → Holdemanella → unclassified Holdemanella → Holdemanella sp. DFI.5.21 | 722 | Open in IMG/M |
3300016461|Ga0126362_10197056 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora | 721 | Open in IMG/M |
3300016461|Ga0126362_10198439 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora → Bovidae → Bovinae → Bos | 719 | Open in IMG/M |
3300016461|Ga0126362_10199551 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora | 718 | Open in IMG/M |
3300016461|Ga0126362_10200584 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora → Bovidae → Bovinae → Bos → Bos grunniens | 716 | Open in IMG/M |
3300016461|Ga0126362_10201754 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 715 | Open in IMG/M |
3300016461|Ga0126362_10202232 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 714 | Open in IMG/M |
3300016461|Ga0126362_10205313 | Not Available | 710 | Open in IMG/M |
3300016461|Ga0126362_10214413 | Not Available | 699 | Open in IMG/M |
3300016461|Ga0126362_10216148 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora | 697 | Open in IMG/M |
3300016461|Ga0126362_10221197 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora → Bovidae → Bovinae → Bos | 691 | Open in IMG/M |
3300016461|Ga0126362_10221891 | Not Available | 690 | Open in IMG/M |
3300016461|Ga0126362_10223422 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 688 | Open in IMG/M |
3300016461|Ga0126362_10224506 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla | 687 | Open in IMG/M |
3300016461|Ga0126362_10228598 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora | 682 | Open in IMG/M |
3300016461|Ga0126362_10229927 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora → Bovidae → Bovinae → Bos | 681 | Open in IMG/M |
3300016461|Ga0126362_10236076 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora | 674 | Open in IMG/M |
3300016461|Ga0126362_10239931 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria | 670 | Open in IMG/M |
3300016461|Ga0126362_10242627 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 667 | Open in IMG/M |
3300016461|Ga0126362_10243977 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora | 666 | Open in IMG/M |
3300016461|Ga0126362_10247249 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 663 | Open in IMG/M |
3300016461|Ga0126362_10257495 | Not Available | 653 | Open in IMG/M |
3300016461|Ga0126362_10262528 | Not Available | 648 | Open in IMG/M |
3300016461|Ga0126362_10265465 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 645 | Open in IMG/M |
3300016461|Ga0126362_10265773 | Not Available | 645 | Open in IMG/M |
3300016461|Ga0126362_10265853 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 645 | Open in IMG/M |
3300016461|Ga0126362_10279009 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 632 | Open in IMG/M |
3300016461|Ga0126362_10286774 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 625 | Open in IMG/M |
3300016461|Ga0126362_10288295 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora | 624 | Open in IMG/M |
3300016461|Ga0126362_10294102 | Not Available | 618 | Open in IMG/M |
3300016461|Ga0126362_10296529 | Not Available | 616 | Open in IMG/M |
3300016461|Ga0126362_10296881 | Not Available | 616 | Open in IMG/M |
3300016461|Ga0126362_10299946 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 613 | Open in IMG/M |
3300016461|Ga0126362_10300949 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 612 | Open in IMG/M |
3300016461|Ga0126362_10302716 | Not Available | 611 | Open in IMG/M |
3300016461|Ga0126362_10307116 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora → Bovidae → Bovinae → Bos | 607 | Open in IMG/M |
3300016461|Ga0126362_10308048 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora | 606 | Open in IMG/M |
3300016461|Ga0126362_10308571 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 606 | Open in IMG/M |
3300016461|Ga0126362_10313504 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 602 | Open in IMG/M |
3300016461|Ga0126362_10314828 | Not Available | 601 | Open in IMG/M |
3300016461|Ga0126362_10322040 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 595 | Open in IMG/M |
3300016461|Ga0126362_10323650 | Not Available | 594 | Open in IMG/M |
3300016461|Ga0126362_10324779 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 593 | Open in IMG/M |
3300016461|Ga0126362_10325097 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 592 | Open in IMG/M |
3300016461|Ga0126362_10326132 | Not Available | 592 | Open in IMG/M |
3300016461|Ga0126362_10326639 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora | 591 | Open in IMG/M |
3300016461|Ga0126362_10334648 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla | 585 | Open in IMG/M |
3300016461|Ga0126362_10338710 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 582 | Open in IMG/M |
3300016461|Ga0126362_10341341 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 580 | Open in IMG/M |
3300016461|Ga0126362_10350740 | Not Available | 573 | Open in IMG/M |
3300016461|Ga0126362_10354257 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 571 | Open in IMG/M |
3300016461|Ga0126362_10354561 | Not Available | 571 | Open in IMG/M |
3300016461|Ga0126362_10359150 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora | 567 | Open in IMG/M |
3300016461|Ga0126362_10361795 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora | 566 | Open in IMG/M |
3300016461|Ga0126362_10370101 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Erysipelotrichia → Erysipelotrichales → Erysipelotrichaceae → Holdemanella → unclassified Holdemanella → Holdemanella sp. DFI.5.21 | 560 | Open in IMG/M |
3300016461|Ga0126362_10371912 | Not Available | 559 | Open in IMG/M |
3300016461|Ga0126362_10373707 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria | 558 | Open in IMG/M |
3300016461|Ga0126362_10374348 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 557 | Open in IMG/M |
3300016461|Ga0126362_10377379 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 555 | Open in IMG/M |
3300016461|Ga0126362_10377391 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 555 | Open in IMG/M |
3300016461|Ga0126362_10379148 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora → Bovidae | 554 | Open in IMG/M |
3300016461|Ga0126362_10384783 | Not Available | 551 | Open in IMG/M |
3300016461|Ga0126362_10385570 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 550 | Open in IMG/M |
3300016461|Ga0126362_10387502 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 549 | Open in IMG/M |
3300016461|Ga0126362_10389168 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 548 | Open in IMG/M |
3300016461|Ga0126362_10394101 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 545 | Open in IMG/M |
3300016461|Ga0126362_10394697 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 544 | Open in IMG/M |
3300016461|Ga0126362_10399568 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Erysipelotrichia → Erysipelotrichales → Erysipelotrichaceae → Holdemanella → unclassified Holdemanella → Holdemanella sp. DFI.5.21 | 541 | Open in IMG/M |
3300016461|Ga0126362_10404149 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 539 | Open in IMG/M |
3300016461|Ga0126362_10404552 | Not Available | 538 | Open in IMG/M |
3300016461|Ga0126362_10408385 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora → Cervidae | 536 | Open in IMG/M |
3300016461|Ga0126362_10409346 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria | 536 | Open in IMG/M |
3300016461|Ga0126362_10414272 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora | 533 | Open in IMG/M |
3300016461|Ga0126362_10414647 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 533 | Open in IMG/M |
3300016461|Ga0126362_10414792 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 532 | Open in IMG/M |
3300016461|Ga0126362_10416372 | Not Available | 532 | Open in IMG/M |
3300016461|Ga0126362_10422044 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora | 528 | Open in IMG/M |
3300016461|Ga0126362_10422129 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 528 | Open in IMG/M |
3300016461|Ga0126362_10422613 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora → Bovidae → Bovinae → Bos | 528 | Open in IMG/M |
3300016461|Ga0126362_10422801 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora | 528 | Open in IMG/M |
3300016461|Ga0126362_10423190 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 528 | Open in IMG/M |
3300016461|Ga0126362_10424213 | Not Available | 527 | Open in IMG/M |
3300016461|Ga0126362_10424394 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 527 | Open in IMG/M |
3300016461|Ga0126362_10427029 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 526 | Open in IMG/M |
3300016461|Ga0126362_10430331 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora | 524 | Open in IMG/M |
3300016461|Ga0126362_10430412 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 524 | Open in IMG/M |
3300016461|Ga0126362_10432231 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
3300016461|Ga0126362_10433323 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 522 | Open in IMG/M |
3300016461|Ga0126362_10438968 | Not Available | 519 | Open in IMG/M |
3300016461|Ga0126362_10441127 | Not Available | 518 | Open in IMG/M |
3300016461|Ga0126362_10442310 | Not Available | 517 | Open in IMG/M |
3300016461|Ga0126362_10444796 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 516 | Open in IMG/M |
3300016461|Ga0126362_10446754 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla | 515 | Open in IMG/M |
3300016461|Ga0126362_10448893 | Not Available | 514 | Open in IMG/M |
3300016461|Ga0126362_10451041 | Not Available | 513 | Open in IMG/M |
3300016461|Ga0126362_10451544 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora | 513 | Open in IMG/M |
3300016461|Ga0126362_10454278 | Not Available | 511 | Open in IMG/M |
3300016461|Ga0126362_10456601 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora → Bovidae → Bovinae → Bos → Bos grunniens | 510 | Open in IMG/M |
3300016461|Ga0126362_10457874 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 509 | Open in IMG/M |
3300016461|Ga0126362_10459322 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora | 509 | Open in IMG/M |
3300016461|Ga0126362_10461422 | Not Available | 507 | Open in IMG/M |
3300016461|Ga0126362_10462178 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 507 | Open in IMG/M |
3300016461|Ga0126362_10463608 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 506 | Open in IMG/M |
3300016461|Ga0126362_10464505 | Not Available | 506 | Open in IMG/M |
3300016461|Ga0126362_10469747 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 503 | Open in IMG/M |
3300016461|Ga0126362_10476270 | Not Available | 500 | Open in IMG/M |
3300018493|Ga0187909_11366500 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla | 656 | Open in IMG/M |
3300018495|Ga0187908_11591841 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 623 | Open in IMG/M |
3300018495|Ga0187908_12122726 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 514 | Open in IMG/M |
3300018495|Ga0187908_12185453 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora → Bovidae → Bovinae → Bos | 504 | Open in IMG/M |
3300018878|Ga0187910_12437757 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora → Bovidae → Bovinae → Bos | 523 | Open in IMG/M |
3300020815|Ga0214108_11142661 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 749 | Open in IMG/M |
3300020816|Ga0214090_10570194 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria | 580 | Open in IMG/M |
3300020816|Ga0214090_10803852 | Not Available | 515 | Open in IMG/M |
3300020817|Ga0214258_10343469 | Not Available | 501 | Open in IMG/M |
3300020817|Ga0214258_11194586 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora | 595 | Open in IMG/M |
3300020817|Ga0214258_11229321 | Not Available | 1303 | Open in IMG/M |
3300020818|Ga0214277_10090160 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora → Bovidae → Bovinae → Bos → Bos grunniens | 596 | Open in IMG/M |
3300020818|Ga0214277_11055959 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 540 | Open in IMG/M |
3300023205|Ga0255814_12918215 | Not Available | 546 | Open in IMG/M |
3300023280|Ga0255813_10621752 | Not Available | 590 | Open in IMG/M |
3300023280|Ga0255813_10764569 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
3300023280|Ga0255813_11597337 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora → Bovidae → Bovinae → Bos → Bos grunniens | 791 | Open in IMG/M |
3300023280|Ga0255813_12007850 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora → Bovidae → Bovinae → Bos | 551 | Open in IMG/M |
3300023291|Ga0256703_10287142 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 512 | Open in IMG/M |
3300023291|Ga0256703_11133134 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 576 | Open in IMG/M |
3300023291|Ga0256703_11348616 | Not Available | 1315 | Open in IMG/M |
3300023291|Ga0256703_11376045 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 518 | Open in IMG/M |
3300023300|Ga0256702_12332515 | Not Available | 546 | Open in IMG/M |
3300023300|Ga0256702_12671826 | Not Available | 584 | Open in IMG/M |
3300024268|Ga0257090_12237735 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora → Cervidae → Muntiacinae → Muntiacus → Muntiacus reevesi | 504 | Open in IMG/M |
3300029305|Ga0307249_13478871 | Not Available | 553 | Open in IMG/M |
3300029799|Ga0311022_11269059 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 666 | Open in IMG/M |
3300029799|Ga0311022_12005864 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora → Bovidae → Bovinae → Bos | 2872 | Open in IMG/M |
3300029799|Ga0311022_12376297 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 632 | Open in IMG/M |
3300029799|Ga0311022_12418900 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 592 | Open in IMG/M |
3300029799|Ga0311022_14274586 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla | 520 | Open in IMG/M |
3300031555|Ga0318466_13066424 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 554 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Continental Margin Sediment | Environmental → Aquatic → Marine → Unclassified → Unclassified → Continental Margin Sediment | 85.27% |
Food Waste | Engineered → Bioreactor → Aerobic → Unclassified → Unclassified → Food Waste | 6.70% |
Goat Feces | Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Goat Feces | 3.57% |
Anaerobic Digester Digestate | Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Digester Digestate | 2.23% |
Food Waste | Engineered → Solid Waste → Landfill → Unclassified → Unclassified → Food Waste | 0.89% |
Food Waste | Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Food Waste | 0.89% |
Clean Room | Engineered → Built Environment → Unclassified → Unclassified → Unclassified → Clean Room | 0.45% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300013868 | Clean room microbial communities from NASA Spacecraft Assembly Facility at Jet Propulsion Laboratory, Pasadena, California, USA - InSight In2 SAF170 SPAdes reassembly | Engineered | Open in IMG/M |
3300016461 | Continental margin sediment microbial communities from China - ANME2c_DSS_Sorted metaG | Environmental | Open in IMG/M |
3300018493 | Goat fecal pellet fungal communities from Santa Barbara, California, USA ? pellet 3 | Host-Associated | Open in IMG/M |
3300018495 | Goat fecal pellet fungal communities from Santa Barbara, California, USA ? pellet 2 | Host-Associated | Open in IMG/M |
3300018878 | Goat fecal pellet fungal communities from Santa Barbara, California, USA ? diluted pellet 1 | Host-Associated | Open in IMG/M |
3300020815 | Food waste microbial community from Durham, Ontario, Canada - FW2 megahit | Engineered | Open in IMG/M |
3300020816 | Food waste microbial community from Durham, Ontario, Canada - FW1 megahit | Engineered | Open in IMG/M |
3300020817 | Food waste and fibre mixture microbial community, University of Toronto, Ontario, Canada - LBfeed1 megahit | Engineered | Open in IMG/M |
3300020818 | Food waste and fibre mixture microbial community, University of Toronto, Ontario, Canada - LBfeed2 | Engineered | Open in IMG/M |
3300023205 | Combined Assembly of Gp0242100, Gp0242119 | Engineered | Open in IMG/M |
3300023280 | Combined Assembly of Gp0238881, Gp0242115 | Engineered | Open in IMG/M |
3300023291 | Food waste and fibre mixture microbial community, University of Toronto, Ontario, Canada. Combined Assembly of Gp0242115, Gp0242119 | Engineered | Open in IMG/M |
3300023300 | Food waste microbial community from Durham, Ontario, Canada. Combined Assembly of Gp0238881, Gp0242100 | Engineered | Open in IMG/M |
3300024268 | Goat fecal pellet fungal communities from Santa Barbara, California, USA ? pellet 2 Spades (v3) | Host-Associated | Open in IMG/M |
3300029305 | Goal Fecal Pellet Co-assembly of all three pellet samples and three diluted pellet samples. | Host-Associated | Open in IMG/M |
3300029799 | Metagenomes from anaerobic digester of solid waste, Toronto, Canda. Combined Assembly of Gp0238878, Gp0238879, Gp0242100, Gp0242119 | Engineered | Open in IMG/M |
3300031555 | Goal Fecal Pellet Co-assembly of all three pellet samples and three diluted pellet samples.(v2) | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0181469_1032882 | 3300013868 | Clean Room | MTEDEMVGWHHQLDGHEFEQALGVGDGQGGLACCSPWSCKESHTTERLNRT* |
Ga0126362_100072261 | 3300016461 | Continental Margin Sediment | LKAGGEGEMEDERVGWHHRHGGCEFEEAPGVGEGQGGLACCSPQGCKESDITE |
Ga0126362_100164031 | 3300016461 | Continental Margin Sediment | DEMVGWHHPLDGQEFDQAQSVGNGQGSLVCCSPWGHKESDTTEQLN |
Ga0126362_100270131 | 3300016461 | Continental Margin Sediment | EATEEKGPTEDEMVGWHHQLDVHEFEQALGVGDGQGSLACCSPWGCKESDTTE |
Ga0126362_100328923 | 3300016461 | Continental Margin Sediment | MTTKDEMVGRHHQVNGHEFEQTLGDGKGQGGLPCCSSWGLKESDTTERLN |
Ga0126362_100350911 | 3300016461 | Continental Margin Sediment | MAEDELVGWHHQLEGDEFEQVLGDGDGQGGLVCCSPWGRRESDTTERRD |
Ga0126362_100362321 | 3300016461 | Continental Margin Sediment | MTEAEMVGWHRRLDGHEFEQAPGVGDGQGSLACGSPWGRKESDMTEQLN |
Ga0126362_100382183 | 3300016461 | Continental Margin Sediment | MTEEEMGGWHHRLDGHEFEQTLGVGDGQGSLVCCSPWGHKESDMTERLNNNHRLK |
Ga0126362_100401292 | 3300016461 | Continental Margin Sediment | MTENEMVGWHHRLDGHESEQALGGGDEQEKLGCCSPWGRKESDTTEQLN |
Ga0126362_100410301 | 3300016461 | Continental Margin Sediment | MTEDETVAWHHQLDGHEFEQVPGAGEVQESLACCSSWGRKESETT |
Ga0126362_100442682 | 3300016461 | Continental Margin Sediment | MAGWHHRLDGREFEQTLGAGDGQGGLACCNSWGRKESDTTERLN |
Ga0126362_100466791 | 3300016461 | Continental Margin Sediment | MTEDKMVGWHHQLNGHEFEQAPGVIEGQGSLACCSLWGCKDSDTTE |
Ga0126362_100475141 | 3300016461 | Continental Margin Sediment | MTEDEVAGWHHRLDGREFESTLGFGDGQGGLACYDSWGHKESDTTE |
Ga0126362_100492251 | 3300016461 | Continental Margin Sediment | MVGWHHRLDEHEIDEALEVGGGQGSLACCSPWGRKESGMVE |
Ga0126362_100506531 | 3300016461 | Continental Margin Sediment | MTEDEMVGRHHLLNGHEFGLTLGVGDGQGGLVCCGPWGRRVRHD |
Ga0126362_100571021 | 3300016461 | Continental Margin Sediment | MTEDEMVGWHHRLDGHEFEQTLGAGNGQGGLVCHSPWGCKESDMTERLN |
Ga0126362_100599223 | 3300016461 | Continental Margin Sediment | MLGWHHGLDEHESEQALGVGDGQGSLVCCSPWGHKEFDTTEQLN |
Ga0126362_100601591 | 3300016461 | Continental Margin Sediment | MTEDEMVEWHHRLNRHEFELALGVGDGQGSLACCSPWGRKELDTTEQLN |
Ga0126362_100661142 | 3300016461 | Continental Margin Sediment | MWEEKGMTEDEMVGWHHQVNGYELEQAPGVDDGQRSLVCCSPSGRKESDSTE |
Ga0126362_100680992 | 3300016461 | Continental Margin Sediment | MTEDEIVGWHHRLNRNEFEQTLGDGEGQGSLVCCSLWGCRVGHK |
Ga0126362_100693252 | 3300016461 | Continental Margin Sediment | MEEEKGMTEDKEVEWHHQLDGHEFEQALGVGEGHGSLTCCISWGLKESDTTEQLN |
Ga0126362_100734833 | 3300016461 | Continental Margin Sediment | MTEDEVVGWHHRFDGHEFEQALGVGDGQVSLVCCSPWGRKESDTTERLN |
Ga0126362_100742951 | 3300016461 | Continental Margin Sediment | MTEDEMIGWHHQLDGHEFEQSPGIGDGQGSLACCSPWGRKESNPTEPLNRT |
Ga0126362_100746143 | 3300016461 | Continental Margin Sediment | MTEDEMVGWHHQLDGHVFEKALRVGDEQGSLACGRKESDTTELLN |
Ga0126362_100749922 | 3300016461 | Continental Margin Sediment | MTEDEMVGWHHRLNRHEFEQTPEDGDPQGSLACCRPWSSKESDTTERLNKNFEN |
Ga0126362_100793982 | 3300016461 | Continental Margin Sediment | MTEDEIVGWHHLLNGHECEQALGAGDGQAGLACCSPWGHSQTQLSN |
Ga0126362_100807381 | 3300016461 | Continental Margin Sediment | MTEDEVIGWHPGLNGQEFEQAPGDGEGQGSLVCCSPWGHKESDMT |
Ga0126362_100888431 | 3300016461 | Continental Margin Sediment | MVGWHHLLNGHEFEQALGVGDGHGGLECCSPRSRKESDTTERLNNKDRYSM |
Ga0126362_100889361 | 3300016461 | Continental Margin Sediment | REDEMFGWHHWLDGREFEQAQGVGEGQGGLACCSPWGLKESDVTERLT |
Ga0126362_100899932 | 3300016461 | Continental Margin Sediment | EKETTEDEMVGWHHRLNGHEFVEVLSVGDGQGSLVCCSPGFCKETDTTERLN |
Ga0126362_100932472 | 3300016461 | Continental Margin Sediment | MTEDEMFGWHHQLNGHEIELTLGVGDGPGGLVCCSPWGCKESDTTERLN |
Ga0126362_100955551 | 3300016461 | Continental Margin Sediment | MVGWHHRLNGHEFEQAPGDEGQGSLVCCSPWGRKESDTTERLNSNPFG |
Ga0126362_101133512 | 3300016461 | Continental Margin Sediment | MTEDEMVGWHHQLNGHGFEQAPGNGEGQGSLPCYSPWGCKESDLTQ |
Ga0126362_101168722 | 3300016461 | Continental Margin Sediment | ETTEDGMVGWHHRLNGHEFEQGPGDGEGQGSLACCSPWGHKEPEATERLNNNNIHLLKYYLY |
Ga0126362_101185372 | 3300016461 | Continental Margin Sediment | MTEDEMVGWQHQLDAHESEQTLEVGNGQGSLVCCSPWGCKESDTTERLN |
Ga0126362_101216171 | 3300016461 | Continental Margin Sediment | MVGWHHQLNVHEFEHTLGDGKGQGSLACCCPWGSKESDYT |
Ga0126362_101219473 | 3300016461 | Continental Margin Sediment | MTEDEMVGWYHQLDGHEFEQAPGVGDGQGSFVCCSPWGCKELDTSEQLN |
Ga0126362_101250071 | 3300016461 | Continental Margin Sediment | MTEDEMVGWHHQLNGHEFEQALAFGDGQGGLVCCSPWGHKESDTTEGVN |
Ga0126362_101278801 | 3300016461 | Continental Margin Sediment | EMVGWHHQLDGHEFEQALGVGDGQGSLVCCSPWGRKELDMTE |
Ga0126362_101376871 | 3300016461 | Continental Margin Sediment | VTEDEMVGRHHQLNGHEFKQTMGDSEVQRSLMYCSSWGHKESDMT |
Ga0126362_101382952 | 3300016461 | Continental Margin Sediment | GMTEDKMVGWHHQLNGHEFEQAPGVGDGQASLACCSPWGHKESGTSEHLN |
Ga0126362_101387511 | 3300016461 | Continental Margin Sediment | MIEDEMVGWHHQHNGHEFEQALGVGDGQGGLACCSPWGRRELERLSD |
Ga0126362_101414611 | 3300016461 | Continental Margin Sediment | MTEDEMAGWHHQLNGRESQQTPGVGDGQGGLACCDSWGCKESDMTERLI |
Ga0126362_101421761 | 3300016461 | Continental Margin Sediment | MTEDEMVGWHHLLDRHEFEHASGVGDGQGGLACCSPWGCKELDSIEQLN |
Ga0126362_101422751 | 3300016461 | Continental Margin Sediment | DEMVGWHHQLSEHESEQALGIGDGQGSLVYCSLWDHKESNTTE |
Ga0126362_101449141 | 3300016461 | Continental Margin Sediment | MTEDEMVGWHHRLDGHEFEQVPGVGDGQGILVCCSPWGGKELDRTE |
Ga0126362_101452442 | 3300016461 | Continental Margin Sediment | MVGWHHRLDGHEFEQAQGGDEGQGILVCCNAWGRKESDMTEQLN |
Ga0126362_101454692 | 3300016461 | Continental Margin Sediment | MTEDEMVGWHHRLDGHKFEQAPGVGDGQGGLACCSPWGRKESNMTEQ |
Ga0126362_101470422 | 3300016461 | Continental Margin Sediment | MVGWQHQLNKHEFEQALGDGEGQGSLESCSPWSNEELDTTE |
Ga0126362_101477011 | 3300016461 | Continental Margin Sediment | MTEDEMVGWHHQLNRLEFEQTPGDGEGQGSLAYCSPWGHKELDVTEQLNKCMML |
Ga0126362_101494671 | 3300016461 | Continental Margin Sediment | MTEDEMVGWHHRLDGHEFEQAPGVGDRQRRLACCSPWGSKESDRTE |
Ga0126362_101505831 | 3300016461 | Continental Margin Sediment | MTKNEMVGWHLRLEGHEFEQASGVGDGQGSLVYCSPWGHQESDTTE |
Ga0126362_101541992 | 3300016461 | Continental Margin Sediment | MTEDEMVGWHHQLNGHEFEQAPGVGDGQGSLVSCSPWGHKESDTTEQLN |
Ga0126362_101550542 | 3300016461 | Continental Margin Sediment | MRENEMVGWHHQLNGQEFEQALEVGDGQGCLVCCIPWGCKETRLND |
Ga0126362_101587902 | 3300016461 | Continental Margin Sediment | EKNGWHYRLSGHEFEQASGVGGGQGSLVCCSPWGRKELDTTE |
Ga0126362_101591721 | 3300016461 | Continental Margin Sediment | GGDEMAGWLHRLDGHEFEQAPGVGDGQGSLASCSLWGRKESDTTELLN |
Ga0126362_101592811 | 3300016461 | Continental Margin Sediment | MVGWHHQLDGHAFQHAPGVGDGEGCLVCYSPWGHKESDTTE |
Ga0126362_101615711 | 3300016461 | Continental Margin Sediment | MTADEMVGWHHRLNGHEFEQAPGVGDGQGSLACCSPWGIKELDTTEQLN |
Ga0126362_101620291 | 3300016461 | Continental Margin Sediment | MTEDEKVGWQHRLGGHEFQQALGAGDGQGGLARCSPWGRKEWDTTERLN |
Ga0126362_101675011 | 3300016461 | Continental Margin Sediment | MTEDEMVGWHHQLNGFEFEQAPGVGDGQGSLVCCSPWDRKELDTTE |
Ga0126362_101698471 | 3300016461 | Continental Margin Sediment | MEGTTEDELVGWHHQLNGHGFEYTLGAGDGQETLVCFSPWGWKESDITE |
Ga0126362_101731611 | 3300016461 | Continental Margin Sediment | MTEDEIVEWHHQLNGHEFEQALGVGDGQGSLACCSPWGHKESDTTE |
Ga0126362_101743161 | 3300016461 | Continental Margin Sediment | MTEDEMVGWHHRLNGREFEQAVGDGDGQGILACCSPWGRKELHTTEEQ |
Ga0126362_101746762 | 3300016461 | Continental Margin Sediment | MTEDEMVGWHHQLNGREFEQTPGIGDGQGGLACCSPWDHKESDMTERLN |
Ga0126362_101785221 | 3300016461 | Continental Margin Sediment | MTDDEMVGWYHQVDGHEFEQALGVGDRQGSLACCNPWGLKESDTTERLN |
Ga0126362_101797001 | 3300016461 | Continental Margin Sediment | MTEDEMVEWHHGLDGHEFEQGLGVGDGQGSLACCNPWGHKESDMTEQLN |
Ga0126362_101815471 | 3300016461 | Continental Margin Sediment | GTTEDEMVGWHHGLNGHESEQAPSVGDGCEILARCSPWGCKELDMTE |
Ga0126362_101860361 | 3300016461 | Continental Margin Sediment | MVGWHHQPDGHEFEQALGIGDGQGTLACCSPWGLKESDIT |
Ga0126362_101905861 | 3300016461 | Continental Margin Sediment | TEDEMIGWHHKLNGHALELTPGDSERQGSLVCCSPWGCKESDTT |
Ga0126362_101948071 | 3300016461 | Continental Margin Sediment | MQEEKGTTEDEMVGWHHQLEKHEFEQAPGVGDGQGSLACCSPMCCKDSDMIEQLN |
Ga0126362_101962882 | 3300016461 | Continental Margin Sediment | GHHQHYGNEFEQALGVGDGQGSLLCCSLWGHKELDTIKQLNNNNAVMRA |
Ga0126362_101970562 | 3300016461 | Continental Margin Sediment | MTEDETVGWHHQLNGYEFEQAPGDSEGQGSLACYSPWGHKEVDIIERLNNNNKRQERRKN |
Ga0126362_101984391 | 3300016461 | Continental Margin Sediment | MTKNEMVGWHHQLDGHEFEQAPGVGDGQGGLACCNPWDRKESDTTE |
Ga0126362_101995511 | 3300016461 | Continental Margin Sediment | TGDEIVGWHHQLDEHEFEQVLGVGDGHGGLVCCSPWGHKELDTTEQLN |
Ga0126362_102005842 | 3300016461 | Continental Margin Sediment | MTEDEMVGWRHQLSGHEFEYPSGVGDGHGSLACCSPRGRKVSDTTE |
Ga0126362_102017543 | 3300016461 | Continental Margin Sediment | MTEDEMIGWHHRLDGHEFEQAPAVGDGQGSLACCGSWAHRESETIEQLK |
Ga0126362_102022322 | 3300016461 | Continental Margin Sediment | MTEDEMIVWHHELDGQEFEQASGVGDGQGSLVCCSPWGRKELDTTERLN |
Ga0126362_102053131 | 3300016461 | Continental Margin Sediment | MTEDEMAGWHHQLNGHEFEQIPGDSERQGSLACCGLCGHKEWDMTWQLNNNNNNEVNK |
Ga0126362_102144132 | 3300016461 | Continental Margin Sediment | GMTEDKMVEWHHRLNGHEFEQTPGDNEGQGSLVCCSPCGHKVSNTTERLNNNKAIYKIKSQWKFAV |
Ga0126362_102161482 | 3300016461 | Continental Margin Sediment | MTEDEMVGWHHRLDGHEFEQALGVGDGQGGLACCSPWGCKELDTPELMNLTESLPLYR |
Ga0126362_102211972 | 3300016461 | Continental Margin Sediment | MTEDEMVGWHHQLDGHEFEQAPGVGDGQGGLACCDSWGRKESDMTERLN |
Ga0126362_102218911 | 3300016461 | Continental Margin Sediment | GQEKEVTEDEMVGWHHHLNGHEFEQSPEDSEGQGSLACCSPWGCQESDRTERVNNNKMF |
Ga0126362_102230351 | 3300016461 | Continental Margin Sediment | VTENEMVGWHHRLDGYEIEQTLGGSKGQRSLACCSPWGHKESETTEQLN |
Ga0126362_102234221 | 3300016461 | Continental Margin Sediment | TEDEMVGWHHQLDGHEFEQASGVDDGQVSLTCCSPWGCKESDTTEQLN |
Ga0126362_102245061 | 3300016461 | Continental Margin Sediment | EEKGMTEDEMVGWHHRLDGHEFEQAPGVGEGQGSLACCSACGHKESDTIEQLN |
Ga0126362_102285981 | 3300016461 | Continental Margin Sediment | MTDDEMVGWHHRLDEHEFEQAPGVGDRQGGLTCWNPWGRKESDLTEQLN |
Ga0126362_102299271 | 3300016461 | Continental Margin Sediment | MTEDEMVGWHHRLNGHEFEQTPGVGDGQGGLVCCSPWGLKKSDTTERLN |
Ga0126362_102360762 | 3300016461 | Continental Margin Sediment | MTEDGMVGWHHRLNGHEFEQAPGISDGQGSMVCFSPWGRQESDTTERLN |
Ga0126362_102383811 | 3300016461 | Continental Margin Sediment | MTEDEMVGWHHQFDGHEFEQVPGVGNGQGGLGCCSPWGHKESDTTK |
Ga0126362_102399311 | 3300016461 | Continental Margin Sediment | VTEDEMTRWHPLFNGHEFEQTPGDREGQGSLACFSPCGHKESDMTERLNNDN |
Ga0126362_102426271 | 3300016461 | Continental Margin Sediment | TEDEMVGWHDRLNGLEFEQALGVGDGQGTLVCCSPWGRNELDTTK |
Ga0126362_102439771 | 3300016461 | Continental Margin Sediment | EEKRTTEDEMVRWHYPLDGHEFEWALVVGDGQGGLACCSPQGCKESDTTERLN |
Ga0126362_102472491 | 3300016461 | Continental Margin Sediment | MTEDEMVGWHHRLDGREFEQALGSGDGQGILACCSPWGRKESDTTERLN |
Ga0126362_102521971 | 3300016461 | Continental Margin Sediment | EDEMVRWHHQHDGHEFELSPGVGNGQGSLACCSPWGYKESDMTVTEMTD |
Ga0126362_102545552 | 3300016461 | Continental Margin Sediment | MTEDEMAGWHHQLDGHEFEQALGVGNGQGSLACCSPWGHKQLDMTE |
Ga0126362_102574951 | 3300016461 | Continental Margin Sediment | QEEKGMTEDEMIGWHHQLNRHEFEQAPHVSEEQGCLACCSPWGHKESDTTEQLN |
Ga0126362_102613682 | 3300016461 | Continental Margin Sediment | MTEDKMVGWHHRLNGHESEQAPGDGEGQGSLACCSPWGCKESDMTEQLN |
Ga0126362_102625281 | 3300016461 | Continental Margin Sediment | QEEKGTTEDEMVGWHHQLNGHEFEQVLGDGEGQGSPVCCSSWGCKKSDTTE |
Ga0126362_102654651 | 3300016461 | Continental Margin Sediment | MTVDEMVGWHHRLDGHEQAPGVGDGQGSLACCSPWGRKESTRLSD |
Ga0126362_102657732 | 3300016461 | Continental Margin Sediment | MTENEMVGWHHQLNGHEFEQAPGVGDGQGSLACCSPWGHKESDTTEGLSDN |
Ga0126362_102658531 | 3300016461 | Continental Margin Sediment | MTEDEMDGWHHRVHGLEFEQAPGVGDGQGGLACCSPWCLKESDTTERLN |
Ga0126362_102690031 | 3300016461 | Continental Margin Sediment | DEVVGWHHQLNGHELEQTPGVGDGQGSLACCSPWSHSESDITERLN |
Ga0126362_102762861 | 3300016461 | Continental Margin Sediment | VTEDEMVGWHHRLNGCEFEQTPGDGEGQESLACCRPWGRQESDMLSEEQQQQ |
Ga0126362_102790091 | 3300016461 | Continental Margin Sediment | EKGMTEDEMVGWHHRLDGHEFEQAPGVGDGQGGLVCCSPWGHKELDMTE |
Ga0126362_102799471 | 3300016461 | Continental Margin Sediment | MTENEMAGWHHQLDGHESEQAPAVGDGQGSLSCYSPWGHKESDKIEQLN |
Ga0126362_102867741 | 3300016461 | Continental Margin Sediment | VAEDEMVGWHHQPNGHKFEQAPGDRGGQGSLVSCSPWGHKELDTTGHLNNNNEWIKIET |
Ga0126362_102882951 | 3300016461 | Continental Margin Sediment | MTEDEMVGWHHRLDGHEFEQAPGVGDGQGGLACCSPWGRKELDTTERLN |
Ga0126362_102931152 | 3300016461 | Continental Margin Sediment | MTEDEMTEWHHQLNGHEFEQTLGDGKGQVSLACCNLWGHKKSDITE |
Ga0126362_102941022 | 3300016461 | Continental Margin Sediment | MVGWHHQLYGHEFEEALGVGDGQGGLACCSPWGRKESDM |
Ga0126362_102965291 | 3300016461 | Continental Margin Sediment | MTEDEMVEWHHRLNGHEFEQAPEDGEGQGNVAHCSSRGCRVRHD |
Ga0126362_102968811 | 3300016461 | Continental Margin Sediment | MTEDEMVGWHHRLDGREFEQTPGDGEGQGSLACFSLWCRKE |
Ga0126362_102999461 | 3300016461 | Continental Margin Sediment | EEKGMTEDEMVGWHHQLDGHVFEQAPVVGDGQGGLACCSPWGHSQT |
Ga0126362_103009491 | 3300016461 | Continental Margin Sediment | MTEDEMVAWHHRLDGHEFEQALGVDDGQGSLTCCSSWGHEESDMTE |
Ga0126362_103027161 | 3300016461 | Continental Margin Sediment | MTEDEMVGCHHQLNGHESEQALGVGDGQGSLSCCSPWVAKSDTTEQLN |
Ga0126362_103071161 | 3300016461 | Continental Margin Sediment | MVEDEMVGWHQQLNGREFEQAPGVGDGQESLACCRPWGSKELDRTEQLN |
Ga0126362_103080481 | 3300016461 | Continental Margin Sediment | MTEDEMFGWHHLLNGHEFESTLGISDGQGGLACCTPWGRKELGMTERLN |
Ga0126362_103085712 | 3300016461 | Continental Margin Sediment | QEEKGMTEDEMVGWHHQLNGHEFEQALGRGEGQGSLACCSPRGRKELDMTEQLNNNNM |
Ga0126362_103135041 | 3300016461 | Continental Margin Sediment | MVEWYHQLNGHEFEQALGVGDRQGSPACCSAWGRKESEKTEQLNLTELNG |
Ga0126362_103148281 | 3300016461 | Continental Margin Sediment | MIEDEMVGWHHRLDGHEFERAPGVGVGQGSPACCSAWAHKELDTTKQLNNKYLTLLHCQY |
Ga0126362_103220401 | 3300016461 | Continental Margin Sediment | MTEEEMVGWHHRLDAHEFEQALGVGDGQGSPACGSPWGNKEWDMTEELN |
Ga0126362_103236501 | 3300016461 | Continental Margin Sediment | MTEDEMVGWHHQLKGRDFEQTPEDGEGQRSLACCSPRGHKESDTTEQLNNNR |
Ga0126362_103247791 | 3300016461 | Continental Margin Sediment | MTEDETVGWHHQLDGHEFEHTLGVGDGQGSLVCCSPWGCKELDTTERTAL |
Ga0126362_103250971 | 3300016461 | Continental Margin Sediment | QEEKGTTEDEMVGWHHRLNGHEFEQAPGVGDEQGSLPCCNPRGCKELDITEWLN |
Ga0126362_103261321 | 3300016461 | Continental Margin Sediment | LKLEEKGITEDEMVGWHHQLSGHKFEQASGDGDGQGSLACCSPSGCKDFYMTETE |
Ga0126362_103266391 | 3300016461 | Continental Margin Sediment | RLERKGMTEDEMVRQHHRLDGHEFEQAPGVGDGQGGLACCSPWGHKESDMTE |
Ga0126362_103346482 | 3300016461 | Continental Margin Sediment | GQEEKGTTEDEMVGWHYRVNGHGFGWTPGVGDGQRGLAC |
Ga0126362_103366101 | 3300016461 | Continental Margin Sediment | MTEDELVGWHHRLNGHEFEYAPGVGEGQGGLAYCSPWGHKESDTTERLN |
Ga0126362_103387101 | 3300016461 | Continental Margin Sediment | MTEDEMVGWHHRLNRHEFEQAPGVGDGQGDLACYSPLGRKESDTTEQLN |
Ga0126362_103413411 | 3300016461 | Continental Margin Sediment | RQEEKGTTEDEMFGWHHRLNGHEFGLTVGVGDGQGDLACCSPWGRKESDTTERLN |
Ga0126362_103435542 | 3300016461 | Continental Margin Sediment | EDEIVGWHHRLNEHEFEQAPEDGEVQGSLVCCSLWGCKESDTTERLKNNR |
Ga0126362_103438171 | 3300016461 | Continental Margin Sediment | VKWHHQLNGHEFEQTLGDGEGQGSLACCSPWGRKELDTT |
Ga0126362_103507401 | 3300016461 | Continental Margin Sediment | MTEDEMVAWHHRLDGHEFEQLLEVGDGQGSLVCCSPWCQEESDMTEQLNQTEKPNPHLL |
Ga0126362_103542571 | 3300016461 | Continental Margin Sediment | MTEDEVVGWHHQLNGYELEQALEDGEGQGSLTCYSTWGHKELDTTERLINTATTNIKINS |
Ga0126362_103545611 | 3300016461 | Continental Margin Sediment | MTENEMVGWYHQLSGHEFEQALGGGEGQGSLACCSPWGHKESDITEPLNNNNKTGKD |
Ga0126362_103558141 | 3300016461 | Continental Margin Sediment | MVGWHHQLDGHEFEQVPADGEGQGSPGCFSSWGHKELDTTKRLNNK |
Ga0126362_103591501 | 3300016461 | Continental Margin Sediment | MTEDEMVGWHHQLNGHEFEQALGVGDGQGNLECCSPWGHKQSDTTQ |
Ga0126362_103617951 | 3300016461 | Continental Margin Sediment | MTEDMMVGWHHRLNGCEFEQAPGVGDGQGGLACCNSWGRKESDTTE |
Ga0126362_103701011 | 3300016461 | Continental Margin Sediment | TEDEMAGWHHHLNGCEFELTPGVCDGQGGLVCCYSWGRKESDTTERLN |
Ga0126362_103719121 | 3300016461 | Continental Margin Sediment | MTEDEMVGWHRQINGHEFEQAPGDGQGSLACCSPWGGKESDTTE |
Ga0126362_103737072 | 3300016461 | Continental Margin Sediment | EKGTTEDEMVEWHHRLNGHEFRWALGVGVGQGGLACSSSWGCKESDMTERLN |
Ga0126362_103743481 | 3300016461 | Continental Margin Sediment | MTEDEMVGWHHRLNGHESEQALGVGDEQASLEWYSPWGHKESHMTE |
Ga0126362_103773791 | 3300016461 | Continental Margin Sediment | VTEDEMVGWHHQLSGHEFEQAPGDREGQGSLVCCSPWDRKESDTTQRLNNNTNIVIQHLAAGGLV |
Ga0126362_103773911 | 3300016461 | Continental Margin Sediment | MTEDEMVRWHHRLNGNEFEQASAVGDGQGSLACCSPWGHKESDTTK |
Ga0126362_103791481 | 3300016461 | Continental Margin Sediment | MTEDEMAGWHHQPDVHEFEQALGVGDGQGSLACCSPWGHKELDTTERLN |
Ga0126362_103847831 | 3300016461 | Continental Margin Sediment | EEDEMVGWHHRLDGHEFEQTLGDGEEQGSLACCSPWGCKESDMT |
Ga0126362_103855701 | 3300016461 | Continental Margin Sediment | GKDEMIRWHHRLDGHEFEQAPGVGDRQGGLACCSPWGCKESDTAELLN |
Ga0126362_103875021 | 3300016461 | Continental Margin Sediment | EEKVTTEDEMVGWHHRLNGHEFEQALGVGDGQGSLACCSPWGCQESDMTE |
Ga0126362_103891681 | 3300016461 | Continental Margin Sediment | MTEDEMVGWHHRLDGHEFEQAPGVGDEQGSLACCRAWGHQETDTTEQMN |
Ga0126362_103941011 | 3300016461 | Continental Margin Sediment | MTEDEMVGWHHRLNGHEFEQAPGVGDGQGGLVCCSPWGHKESDTTEQLN |
Ga0126362_103946971 | 3300016461 | Continental Margin Sediment | MIEDEMVGWHHRLDGREFEQALGVGDGQGGLVYCSPWGRKESDTTE |
Ga0126362_103995682 | 3300016461 | Continental Margin Sediment | VMMFEMVEWHHRLDRHEFKQAPGVGNGQGGRLACCSPWGHKESDRTE |
Ga0126362_104014301 | 3300016461 | Continental Margin Sediment | MTEDEMVGWHHRLDGHELEQTPGVGDGQGSLVCCSPWGLKESETTE |
Ga0126362_104041491 | 3300016461 | Continental Margin Sediment | KKETTEDEMVGWHHRLDGHELEQALGVGDGQGDLACCSPWGCKESDMTE |
Ga0126362_104045521 | 3300016461 | Continental Margin Sediment | MSENEMVGWYHQLDGQEFEQAPGVNDRQGNLACCSPWGHKKTDMTQQLN |
Ga0126362_104083852 | 3300016461 | Continental Margin Sediment | MTEEMVGWHHRLDGHVYEQAPGVDDGQGSLACCSPWGCKESDTTEQLN |
Ga0126362_104093461 | 3300016461 | Continental Margin Sediment | VGWHHRLNGHGFGWTTGAGDGQGGLACCDSWGRTESDTTERLSAHTHIP |
Ga0126362_104142721 | 3300016461 | Continental Margin Sediment | MVGRHHHLKGRKSEQAPGVSSDGQGGLASCSPWGCKKSDMTERLSL |
Ga0126362_104146471 | 3300016461 | Continental Margin Sediment | LGKTLMLGKMEDGRRRGMTEDEMVGWHYRLDGHESEQVPGVGDGQGRLVCCSPWGCKESDTTERLN |
Ga0126362_104147921 | 3300016461 | Continental Margin Sediment | TEDEMVVWHHQLNGHETQQTPGDEKGQGGLVCYSPWGRRESDMTEQLNNNKFQIYTQVYK |
Ga0126362_104163721 | 3300016461 | Continental Margin Sediment | MVSWHQQLNGHELEQTLGAGEGQGSLAHCSPLGRKESDTTERLKNNDHFSNSFPI |
Ga0126362_104220442 | 3300016461 | Continental Margin Sediment | MTEDEVVEWHHQLDGHEFEKALGVGDRQGSLVCCSPWGHKESDTTERLN |
Ga0126362_104221291 | 3300016461 | Continental Margin Sediment | MAEDEIVGWHHQLEGHEFEQAPGAGDGQGSLECCSPWGRKESDTTERLN |
Ga0126362_104226131 | 3300016461 | Continental Margin Sediment | MTEEDMVGWHNRLNGHEFEQALEVGDGQRSLVCCSPWGHKESDMTE |
Ga0126362_104228011 | 3300016461 | Continental Margin Sediment | GMTEDEMVGWHHRLDGHEFEQAWEAVDGQGSLACCSTLSHKELDRTEQLN |
Ga0126362_104231901 | 3300016461 | Continental Margin Sediment | GVTEDEMVGWHHQLNGHEFEQAPGDGEGQGSLVFYSLWGCKQSNMT |
Ga0126362_104242131 | 3300016461 | Continental Margin Sediment | MTEVEMVGWYHQLDGHEFEQAPGVNDGQGSLACCSPWGHKDSDTTE |
Ga0126362_104243941 | 3300016461 | Continental Margin Sediment | VGWHLQISGDEFEQALGVGDGQGSLACCSPWGCKESDMIEQLN |
Ga0126362_104270292 | 3300016461 | Continental Margin Sediment | MVGWHYLLDRCEFEQAPGAGDGQGGLACCSPWDHKESDTTE |
Ga0126362_104303311 | 3300016461 | Continental Margin Sediment | MTEDEIVVWHHRLNGHEFEYTPGVGDGQGGLVCCNPWGHKESDTTERLN |
Ga0126362_104304122 | 3300016461 | Continental Margin Sediment | EKGTTEDEMAGWHHRLDGRECEGTLGAGDGQGGLACCDSWGHKESDTTE |
Ga0126362_104322312 | 3300016461 | Continental Margin Sediment | MTEDEMVGLHHQCNGYEFEFEVLGVGDGQGSLTCCSQWSHKESDTTEQLN |
Ga0126362_104333232 | 3300016461 | Continental Margin Sediment | MTEDEMVGWHHRRDRHEFEQAPGVGDGQGGLACCSPLDRKELDTTERLN |
Ga0126362_104362621 | 3300016461 | Continental Margin Sediment | MTEDEMAGWHHGLDGHEFEQAPGVGDGQGSLACCSPWGCKSQTQPSDLTELTEFNS |
Ga0126362_104389681 | 3300016461 | Continental Margin Sediment | MTEDEMVGWRHQLDGYEFEQAPGVGDGHGGLACCSPWGHKESDMTE |
Ga0126362_104389871 | 3300016461 | Continental Margin Sediment | LDGREFEQILGDSEGEGNLVCCSPWGHKESDTIEQLNNNKVLL |
Ga0126362_104411271 | 3300016461 | Continental Margin Sediment | MTEDEMAGWHHQLNGHEFEQALGVSDGQESLACCGPWGRKELDTTE |
Ga0126362_104423101 | 3300016461 | Continental Margin Sediment | RQEEKVMTEDKMVGWHHQFNGHEFEQALALSEGQGRLACFSLWGYKELDTTK |
Ga0126362_104447961 | 3300016461 | Continental Margin Sediment | MTEDEMVGWHHRLNGHEFEQTQGDSEGQGSLVCCSPWGRRESETTEQLNNSAESQSQQEKQE |
Ga0126362_104467541 | 3300016461 | Continental Margin Sediment | EDEMVGWHHRLDGHESEQAVEDGEGIGSLACCSPWGHKESDTTE |
Ga0126362_104488931 | 3300016461 | Continental Margin Sediment | MVRYHHQLNGYEFEQTPGNSEGQRSLVCCSPWGCKESDTTERLNP |
Ga0126362_104510411 | 3300016461 | Continental Margin Sediment | GEGTTEDEMVGWHHQLIGQEFQQILGASEGQRSLACCSHGVTELDTTE |
Ga0126362_104515441 | 3300016461 | Continental Margin Sediment | MVGWYHRLDGHEFEQAPEVGDGQGGLVCFSQWGGKESDTIERLN |
Ga0126362_104542781 | 3300016461 | Continental Margin Sediment | MVGWHHQLSGHDFEQVTGDGEGQGSLVCSSPWDCKESNMTERLNN |
Ga0126362_104566011 | 3300016461 | Continental Margin Sediment | MTEDEIVGWHHPSNGHEFEQAPGVGDGQGGLVCCSPWGRKKWTSS |
Ga0126362_104578741 | 3300016461 | Continental Margin Sediment | MAEDEMVGWHQLLDGCEFEQASEVGDRKGSLACCSPWGHKESDTTE |
Ga0126362_104593221 | 3300016461 | Continental Margin Sediment | MTEDEMVGWHHRLDGCAFGQVPGVGDGQGSLVCCSPWGHKESDMTEQLNNNKKLL |
Ga0126362_104614222 | 3300016461 | Continental Margin Sediment | MTEDEMVGWHLRLDGHEFEQAPGVGDGQGSLECYSPWGLKELDTTEQLN |
Ga0126362_104621782 | 3300016461 | Continental Margin Sediment | KGMTEDEMVGWHHQLDGHEFEQVLGVGDGQGGLACCSLWDCKKSDTTKRLSNRFIKNL |
Ga0126362_104636081 | 3300016461 | Continental Margin Sediment | EKGTTEDEMVGWHHRLNGHEFEQAPGVGDGQGGLVYCSSWGRKESDTTELN |
Ga0126362_104645052 | 3300016461 | Continental Margin Sediment | KGMTEDQMVGWYHRLNGQESEQALGVGDGQGSLASFSPWGGKKSDMTERLN |
Ga0126362_104697472 | 3300016461 | Continental Margin Sediment | MTEDEMVGWHHQLNGHEFEQAPAVGDGQESLACCSPWDHKELDTTERLN |
Ga0126362_104762701 | 3300016461 | Continental Margin Sediment | MTADEMVGWHHQLDGQEFEQAPGVGDGEGRLACCTPWGHKELDITEQLN |
Ga0187909_113665001 | 3300018493 | Goat Feces | MTEEEMIGWYHQLDGYDFEQAPGVGDGQGRLSRYSPWGRREPDTTKCLN |
Ga0187908_115918411 | 3300018495 | Goat Feces | MVGWRHGLDGQEFEQAPEVGDGQGGLACCNSWGRKESDTTERLN |
Ga0187908_121227261 | 3300018495 | Goat Feces | EQEEKGTTDDEVVGWHHQLNGHDSEQALGNGDLQRGLACCSSWGCKESATTEQLN |
Ga0187908_121854531 | 3300018495 | Goat Feces | MTEDEMVGWHHQLNGHEFEQTPEDGEGQGSLVCCSSWGFKESDTTEQLNNNIRI |
Ga0187910_124377572 | 3300018878 | Goat Feces | MTEGEMVGWHHRLNRHEFEQALGDGEGQGSLVCCSPWGRKELNVNEQLNNNTGIVPKRI |
Ga0214108_111426612 | 3300020815 | Food Waste | MTEDQMGGWHHLLNGHEFEQALRDGEGQGSLMCCSPWGRKESEMTEQLNRTELN |
Ga0214090_105701942 | 3300020816 | Food Waste | MVGWHHQLYVHEFEQAPGVGDGQGSLVCSPWGLKESNATERLN |
Ga0214090_108038521 | 3300020816 | Food Waste | MVGWHHLLNEHEFEQALGDGEGQGSLACCSPRGLKESDMTERQNNKVGASMATAD |
Ga0214258_103434691 | 3300020817 | Food Waste | MVGWHHRLNRHECEQALGVGDGQGSLASMGRKELDTTEQLN |
Ga0214258_111945861 | 3300020817 | Food Waste | EDEVAGWHHRVDGHEFEQAPGLGDGQGNLACCSPWGHKELDMTE |
Ga0214258_112293212 | 3300020817 | Food Waste | MVGWHHRLNGQKFEQPLAVGDGQGGLACYSPWGRSELDTAEQLT |
Ga0214277_100901601 | 3300020818 | Food Waste | MTEDEMVGWHHQLDGREFEQALGVGDGQGILACCSPWGCKESDPTERLN |
Ga0214277_110559591 | 3300020818 | Food Waste | MLGKLKAGEKGMTEDEMVGWHHRLDGHKFGEASGVGDGQGGLMCCSPWVCKELDTTE |
Ga0255814_129182152 | 3300023205 | Food Waste | MTEDEMVGWHHQLNGHEFEQALGYGEGQGSLECCSLWGHKGLDMTEILTTKILNAQKVLAKSE |
Ga0255813_106217521 | 3300023280 | Food Waste | IDKGPTEDEMVEWHHQLDGHEFEQAPGDGEGQESLGCCSPWDRKESDTTK |
Ga0255813_107645691 | 3300023280 | Food Waste | MLGWHHQLYGHEFEQALGVGDGQGSLACCSPWGGKELDTTE |
Ga0255813_115973371 | 3300023280 | Food Waste | MTEDEMVGWHHRVNGREFEQAPGYGDGQGSRTCCSPYSHKEL |
Ga0255813_120078501 | 3300023280 | Food Waste | MTEDEMVGGHHRLNGHEFEQAPGDGEGQGSLACYSPWGLKDSGTTERLDNSCMFDPEGSQPLPR |
Ga0256703_102871421 | 3300023291 | Food Waste | VVVWHHQLNGHEFEEAPGVGDGQGGLVCYSLGGHKELDATELNRT |
Ga0256703_111331341 | 3300023291 | Food Waste | MTKDEMVGRHHQLNGHEFEQAPGDGEGQGSLACCSPRGCKESATTERLNNSRIN |
Ga0256703_113486162 | 3300023291 | Food Waste | MTEDEMVGWHHQLIGHEFEQSLGDDEGWGSLAYCSPWGHKESDTTERLNWTDVA |
Ga0256703_113760451 | 3300023291 | Food Waste | MVGWHHRLDGHEFEQAPGVGDGLGSLVCCSPWDGKDLDKTE |
Ga0256702_123325151 | 3300023300 | Food Waste | MTKDEMVAWHHRLNGHEIEQAPGVGDGQRSLACCSPWGHRESDTTA |
Ga0256702_126718261 | 3300023300 | Food Waste | MTEDETVGWHHQLNGHEFGETLGAGDGQGGLACYRPWGCKESDSME |
Ga0257090_122377351 | 3300024268 | Goat Feces | EMDGWHHGLNGHECEQTPGDSGRQGSLACCSPWGSQELDTTE |
Ga0307249_134788711 | 3300029305 | Goat Feces | LKAGGERDDREKMVGWHHQFNGPGFEQVLGIDDGQGSLVYCSPWGHKESDTTERLN |
Ga0311022_112690592 | 3300029799 | Anaerobic Digester Digestate | MTEDEMVGWHHRLDGHGFGWTPAVGDGQGGLACCGSWGHK |
Ga0311022_120058642 | 3300029799 | Anaerobic Digester Digestate | MTEDEMVGWHHRLDGHELEQAPGVGDGQGSLACCSPWGCNGSDMERLN |
Ga0311022_123762971 | 3300029799 | Anaerobic Digester Digestate | MVGWHHQLNGQEFEQAPGDGERQGGLARCSPWGHRESDTTEPLNSNNHPD |
Ga0311022_124189001 | 3300029799 | Anaerobic Digester Digestate | MTEDEIVGWHHRLDGREFEQAPGVGDGQGGLACCGPWGRKESE |
Ga0311022_142745861 | 3300029799 | Anaerobic Digester Digestate | MTEDEMVGWHHQLDGLEFEQAPEAGDGQGSLVRPSPWGHKELDMTEQLSRLPKWSEW |
Ga0318466_130664242 | 3300031555 | Goat Feces | MTDGEMVGWHHQLNGHEFEQALGVGDGQGSLVCCKELDMTEQLK |
⦗Top⦘ |