Basic Information | |
---|---|
Family ID | F020314 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 224 |
Average Sequence Length | 44 residues |
Representative Sequence | GEVAARVTRLLQPARPLPAAAVMAVCLAAALLVAAPVTLLIV |
Number of Associated Samples | 196 |
Number of Associated Scaffolds | 223 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 1.79 % |
% of genes near scaffold ends (potentially truncated) | 96.88 % |
% of genes from short scaffolds (< 2000 bps) | 94.64 % |
Associated GOLD sequencing projects | 187 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.53 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (58.482 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (22.321 % of family members) |
Environment Ontology (ENVO) | Unclassified (20.982 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (56.696 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 47.14% β-sheet: 0.00% Coil/Unstructured: 52.86% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.53 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 223 Family Scaffolds |
---|---|---|
PF10724 | DUF2516 | 81.17 |
PF01381 | HTH_3 | 11.66 |
PF05853 | BKACE | 3.14 |
PF01261 | AP_endonuc_2 | 1.35 |
PF13481 | AAA_25 | 0.45 |
PF01522 | Polysacc_deac_1 | 0.45 |
COG ID | Name | Functional Category | % Frequency in 223 Family Scaffolds |
---|---|---|---|
COG3246 | Uncharacterized conserved protein, DUF849 family | Function unknown [S] | 3.14 |
COG0726 | Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 family | Cell wall/membrane/envelope biogenesis [M] | 0.45 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 59.38 % |
Unclassified | root | N/A | 40.62 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2170459023|GZGNO2B01E2MJM | Not Available | 544 | Open in IMG/M |
3300001593|JGI12635J15846_10670174 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 599 | Open in IMG/M |
3300004152|Ga0062386_100470666 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1018 | Open in IMG/M |
3300004471|Ga0068965_1274369 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 701 | Open in IMG/M |
3300004478|Ga0068972_1585224 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 737 | Open in IMG/M |
3300004616|Ga0068930_1413441 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1025 | Open in IMG/M |
3300004617|Ga0068955_1415090 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1163 | Open in IMG/M |
3300004971|Ga0072324_1016005 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1152 | Open in IMG/M |
3300004973|Ga0072322_1016727 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1177 | Open in IMG/M |
3300004977|Ga0072329_1020905 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 910 | Open in IMG/M |
3300005168|Ga0066809_10012135 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1642 | Open in IMG/M |
3300005335|Ga0070666_11027546 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 612 | Open in IMG/M |
3300005337|Ga0070682_101636679 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 557 | Open in IMG/M |
3300005347|Ga0070668_101460008 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 624 | Open in IMG/M |
3300005434|Ga0070709_10707210 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 784 | Open in IMG/M |
3300005435|Ga0070714_102211938 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Blastococcus → Blastococcus endophyticus | 535 | Open in IMG/M |
3300005439|Ga0070711_100483301 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1018 | Open in IMG/M |
3300005439|Ga0070711_100842596 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 780 | Open in IMG/M |
3300005440|Ga0070705_100015906 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 3898 | Open in IMG/M |
3300005530|Ga0070679_101751116 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 569 | Open in IMG/M |
3300005591|Ga0070761_10574492 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
3300005602|Ga0070762_10087062 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1786 | Open in IMG/M |
3300005614|Ga0068856_101853212 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 614 | Open in IMG/M |
3300005841|Ga0068863_101690162 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 642 | Open in IMG/M |
3300005921|Ga0070766_10918769 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 600 | Open in IMG/M |
3300006028|Ga0070717_10112126 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 2327 | Open in IMG/M |
3300006914|Ga0075436_100600817 | All Organisms → cellular organisms → Bacteria | 810 | Open in IMG/M |
3300009036|Ga0105244_10199564 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 943 | Open in IMG/M |
3300009093|Ga0105240_10542256 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Thermomonospora → Thermomonospora curvata | 1288 | Open in IMG/M |
3300009525|Ga0116220_10141457 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1031 | Open in IMG/M |
3300009672|Ga0116215_1199849 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 881 | Open in IMG/M |
3300009672|Ga0116215_1478737 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 538 | Open in IMG/M |
3300009698|Ga0116216_10347589 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 902 | Open in IMG/M |
3300009700|Ga0116217_10185169 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 1375 | Open in IMG/M |
3300009824|Ga0116219_10328583 | Not Available | 859 | Open in IMG/M |
3300010123|Ga0127479_1122774 | Not Available | 541 | Open in IMG/M |
3300010146|Ga0126320_1190418 | Not Available | 649 | Open in IMG/M |
3300010321|Ga0134067_10101091 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Thermomonospora → Thermomonospora curvata | 986 | Open in IMG/M |
3300010322|Ga0134084_10282002 | Not Available | 611 | Open in IMG/M |
3300010341|Ga0074045_11075306 | Not Available | 502 | Open in IMG/M |
3300010379|Ga0136449_103368075 | Not Available | 613 | Open in IMG/M |
3300010399|Ga0134127_12203911 | Not Available | 630 | Open in IMG/M |
3300010859|Ga0126352_1064001 | Not Available | 580 | Open in IMG/M |
3300010859|Ga0126352_1164663 | Not Available | 655 | Open in IMG/M |
3300010860|Ga0126351_1126979 | Not Available | 522 | Open in IMG/M |
3300010861|Ga0126349_1026784 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Thermomonospora → Thermomonospora curvata | 1039 | Open in IMG/M |
3300010869|Ga0126359_1586259 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 1178 | Open in IMG/M |
3300010876|Ga0126361_10264362 | Not Available | 531 | Open in IMG/M |
3300010877|Ga0126356_10456638 | Not Available | 601 | Open in IMG/M |
3300011030|Ga0138603_144045 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 872 | Open in IMG/M |
3300011042|Ga0138586_147303 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 924 | Open in IMG/M |
3300011048|Ga0138556_155622 | Not Available | 802 | Open in IMG/M |
3300011059|Ga0138597_1114818 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Thermococci → Thermococcales | 859 | Open in IMG/M |
3300011061|Ga0138534_1082780 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1073 | Open in IMG/M |
3300011063|Ga0138537_1070599 | Not Available | 731 | Open in IMG/M |
3300011066|Ga0138524_1099366 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 852 | Open in IMG/M |
3300011071|Ga0138595_1061562 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 1182 | Open in IMG/M |
3300011073|Ga0138584_1051962 | Not Available | 737 | Open in IMG/M |
3300011077|Ga0138572_1093859 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 920 | Open in IMG/M |
3300011077|Ga0138572_1145393 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 1027 | Open in IMG/M |
3300011087|Ga0138570_1149779 | Not Available | 720 | Open in IMG/M |
3300011090|Ga0138579_1092161 | Not Available | 893 | Open in IMG/M |
3300011090|Ga0138579_1204059 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 699 | Open in IMG/M |
3300011109|Ga0138539_1067245 | Not Available | 596 | Open in IMG/M |
3300011120|Ga0150983_10763126 | Not Available | 587 | Open in IMG/M |
3300011120|Ga0150983_11180940 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 1040 | Open in IMG/M |
3300011120|Ga0150983_12302932 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 958 | Open in IMG/M |
3300011120|Ga0150983_14276339 | Not Available | 879 | Open in IMG/M |
3300011120|Ga0150983_14538846 | Not Available | 700 | Open in IMG/M |
3300012202|Ga0137363_10665269 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 881 | Open in IMG/M |
3300012208|Ga0137376_10938392 | Not Available | 742 | Open in IMG/M |
3300012211|Ga0137377_10496657 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 1158 | Open in IMG/M |
3300012212|Ga0150985_104250974 | Not Available | 568 | Open in IMG/M |
3300012212|Ga0150985_104992485 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Thermomonospora → Thermomonospora curvata | 1059 | Open in IMG/M |
3300012224|Ga0134028_1178453 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Thermomonospora → Thermomonospora curvata | 1017 | Open in IMG/M |
3300012357|Ga0137384_11273965 | Not Available | 581 | Open in IMG/M |
3300012363|Ga0137390_10704920 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 972 | Open in IMG/M |
3300012395|Ga0134044_1184417 | Not Available | 523 | Open in IMG/M |
3300012398|Ga0134051_1049943 | Not Available | 634 | Open in IMG/M |
3300012400|Ga0134048_1375562 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 805 | Open in IMG/M |
3300012984|Ga0164309_10389841 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Thermomonospora → Thermomonospora curvata | 1035 | Open in IMG/M |
3300012988|Ga0164306_11055194 | Not Available | 673 | Open in IMG/M |
3300013104|Ga0157370_10544663 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1064 | Open in IMG/M |
3300013296|Ga0157374_10975972 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 866 | Open in IMG/M |
3300013308|Ga0157375_11554789 | Not Available | 781 | Open in IMG/M |
3300014493|Ga0182016_10405524 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 806 | Open in IMG/M |
3300014499|Ga0182012_10532857 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 760 | Open in IMG/M |
3300015241|Ga0137418_10272603 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 1426 | Open in IMG/M |
3300015264|Ga0137403_10088517 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 3118 | Open in IMG/M |
3300016341|Ga0182035_12175922 | Not Available | 503 | Open in IMG/M |
3300017823|Ga0187818_10018344 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 2993 | Open in IMG/M |
3300017823|Ga0187818_10018344 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 2993 | Open in IMG/M |
3300017924|Ga0187820_1157241 | Not Available | 688 | Open in IMG/M |
3300017927|Ga0187824_10082229 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Thermomonospora → Thermomonospora curvata | 1022 | Open in IMG/M |
3300017932|Ga0187814_10370076 | Not Available | 555 | Open in IMG/M |
3300017934|Ga0187803_10441751 | Not Available | 530 | Open in IMG/M |
3300017942|Ga0187808_10154563 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1011 | Open in IMG/M |
3300017955|Ga0187817_10457056 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 815 | Open in IMG/M |
3300017959|Ga0187779_11261064 | Not Available | 522 | Open in IMG/M |
3300017961|Ga0187778_10119044 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1650 | Open in IMG/M |
3300017966|Ga0187776_11130747 | Not Available | 583 | Open in IMG/M |
3300018047|Ga0187859_10036309 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 2647 | Open in IMG/M |
3300018085|Ga0187772_10274600 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1149 | Open in IMG/M |
3300018085|Ga0187772_10460887 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 892 | Open in IMG/M |
3300018482|Ga0066669_10990808 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 758 | Open in IMG/M |
3300019185|Ga0184587_135375 | Not Available | 613 | Open in IMG/M |
3300019268|Ga0181514_1213481 | Not Available | 619 | Open in IMG/M |
3300019787|Ga0182031_1295626 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1819 | Open in IMG/M |
3300019888|Ga0193751_1079860 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1310 | Open in IMG/M |
3300020002|Ga0193730_1048073 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1232 | Open in IMG/M |
3300020580|Ga0210403_10933136 | Not Available | 683 | Open in IMG/M |
3300020582|Ga0210395_10853514 | Not Available | 678 | Open in IMG/M |
3300021403|Ga0210397_10245844 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1296 | Open in IMG/M |
3300021405|Ga0210387_11427510 | Not Available | 594 | Open in IMG/M |
3300021420|Ga0210394_11178194 | Not Available | 658 | Open in IMG/M |
3300021432|Ga0210384_10112402 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Thermomonospora | 2441 | Open in IMG/M |
3300021432|Ga0210384_10660895 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Thermomonospora → Thermomonospora curvata | 936 | Open in IMG/M |
3300021433|Ga0210391_11202792 | Not Available | 587 | Open in IMG/M |
3300021860|Ga0213851_1080972 | Not Available | 535 | Open in IMG/M |
3300022467|Ga0224712_10334574 | Not Available | 713 | Open in IMG/M |
3300022467|Ga0224712_10438465 | Not Available | 626 | Open in IMG/M |
3300022512|Ga0242676_1054787 | Not Available | 505 | Open in IMG/M |
3300022527|Ga0242664_1089424 | Not Available | 619 | Open in IMG/M |
3300022530|Ga0242658_1052867 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 865 | Open in IMG/M |
3300022530|Ga0242658_1248343 | Not Available | 502 | Open in IMG/M |
3300022533|Ga0242662_10058018 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1017 | Open in IMG/M |
3300022533|Ga0242662_10059595 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1007 | Open in IMG/M |
3300022708|Ga0242670_1082238 | Not Available | 507 | Open in IMG/M |
3300022711|Ga0242674_1028652 | Not Available | 689 | Open in IMG/M |
3300022712|Ga0242653_1089261 | Not Available | 552 | Open in IMG/M |
3300022715|Ga0242678_1010285 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 990 | Open in IMG/M |
3300022716|Ga0242673_1035083 | Not Available | 788 | Open in IMG/M |
3300022720|Ga0242672_1121338 | Not Available | 535 | Open in IMG/M |
3300022722|Ga0242657_1144028 | Not Available | 623 | Open in IMG/M |
3300022724|Ga0242665_10066651 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 998 | Open in IMG/M |
3300022726|Ga0242654_10079064 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 994 | Open in IMG/M |
3300024249|Ga0247676_1065158 | Not Available | 599 | Open in IMG/M |
3300024279|Ga0247692_1062206 | Not Available | 582 | Open in IMG/M |
3300025320|Ga0209171_10586349 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 539 | Open in IMG/M |
3300025527|Ga0208714_1048387 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 929 | Open in IMG/M |
3300025899|Ga0207642_10848428 | Not Available | 583 | Open in IMG/M |
3300025909|Ga0207705_10305630 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1220 | Open in IMG/M |
3300025916|Ga0207663_11381441 | Not Available | 567 | Open in IMG/M |
3300025928|Ga0207700_10589049 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 989 | Open in IMG/M |
3300025929|Ga0207664_10520370 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1066 | Open in IMG/M |
3300026118|Ga0207675_101478864 | Not Available | 700 | Open in IMG/M |
3300026214|Ga0209838_1015675 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1049 | Open in IMG/M |
3300026551|Ga0209648_10068044 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 3004 | Open in IMG/M |
3300026911|Ga0209620_1023659 | Not Available | 554 | Open in IMG/M |
3300027030|Ga0208240_1012015 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 908 | Open in IMG/M |
3300027076|Ga0208860_1028762 | Not Available | 581 | Open in IMG/M |
3300027090|Ga0208604_1004365 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1328 | Open in IMG/M |
3300027181|Ga0208997_1041879 | All Organisms → cellular organisms → Archaea | 676 | Open in IMG/M |
3300027497|Ga0208199_1009750 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 2270 | Open in IMG/M |
3300027567|Ga0209115_1021854 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1424 | Open in IMG/M |
3300027609|Ga0209221_1060580 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 996 | Open in IMG/M |
3300027609|Ga0209221_1180459 | Not Available | 514 | Open in IMG/M |
3300027635|Ga0209625_1106832 | Not Available | 628 | Open in IMG/M |
3300027662|Ga0208565_1218008 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 538 | Open in IMG/M |
3300027812|Ga0209656_10244960 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 850 | Open in IMG/M |
3300027854|Ga0209517_10131057 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1634 | Open in IMG/M |
3300027882|Ga0209590_10378302 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 914 | Open in IMG/M |
3300027898|Ga0209067_10318959 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 857 | Open in IMG/M |
3300028138|Ga0247684_1084223 | Not Available | 528 | Open in IMG/M |
3300028716|Ga0307311_10078995 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 902 | Open in IMG/M |
3300028742|Ga0302220_10136128 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 943 | Open in IMG/M |
3300028801|Ga0302226_10101227 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 1283 | Open in IMG/M |
3300028877|Ga0302235_10320022 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 669 | Open in IMG/M |
3300028906|Ga0308309_11337825 | Not Available | 615 | Open in IMG/M |
3300029701|Ga0222748_1117875 | Not Available | 533 | Open in IMG/M |
3300029910|Ga0311369_10636787 | Not Available | 884 | Open in IMG/M |
3300029943|Ga0311340_11574425 | Not Available | 511 | Open in IMG/M |
3300029951|Ga0311371_12065668 | Not Available | 601 | Open in IMG/M |
3300029999|Ga0311339_10695386 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 995 | Open in IMG/M |
3300030007|Ga0311338_10164876 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 2612 | Open in IMG/M |
3300030057|Ga0302176_10195557 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
3300030529|Ga0210284_1749766 | Not Available | 721 | Open in IMG/M |
3300030594|Ga0210280_1159390 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 548 | Open in IMG/M |
3300030598|Ga0210287_1138012 | Not Available | 627 | Open in IMG/M |
3300030603|Ga0210253_10633677 | Not Available | 559 | Open in IMG/M |
3300030624|Ga0210251_10613905 | Not Available | 522 | Open in IMG/M |
3300030730|Ga0307482_1198627 | Not Available | 608 | Open in IMG/M |
3300030739|Ga0302311_10597992 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 743 | Open in IMG/M |
3300030740|Ga0265460_10189621 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 1190 | Open in IMG/M |
3300030740|Ga0265460_11731945 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 637 | Open in IMG/M |
3300030740|Ga0265460_11890250 | Not Available | 616 | Open in IMG/M |
3300030743|Ga0265461_11432886 | Not Available | 740 | Open in IMG/M |
3300030743|Ga0265461_12491817 | Not Available | 609 | Open in IMG/M |
3300030743|Ga0265461_13322768 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 543 | Open in IMG/M |
3300030980|Ga0074027_11259069 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 1014 | Open in IMG/M |
3300030993|Ga0308190_1159098 | Not Available | 543 | Open in IMG/M |
3300031017|Ga0265744_107005 | Not Available | 645 | Open in IMG/M |
3300031017|Ga0265744_115756 | Not Available | 508 | Open in IMG/M |
3300031090|Ga0265760_10221734 | Not Available | 645 | Open in IMG/M |
3300031233|Ga0302307_10426197 | Not Available | 674 | Open in IMG/M |
3300031474|Ga0170818_102271364 | Not Available | 623 | Open in IMG/M |
3300031474|Ga0170818_105993565 | Not Available | 544 | Open in IMG/M |
3300031561|Ga0318528_10124801 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 1363 | Open in IMG/M |
3300031572|Ga0318515_10618103 | Not Available | 575 | Open in IMG/M |
3300031680|Ga0318574_10256064 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 1013 | Open in IMG/M |
3300031708|Ga0310686_110064197 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1618 | Open in IMG/M |
3300031770|Ga0318521_10278951 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 980 | Open in IMG/M |
3300031846|Ga0318512_10020112 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 2740 | Open in IMG/M |
3300031947|Ga0310909_11066910 | Not Available | 658 | Open in IMG/M |
3300032010|Ga0318569_10146729 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 1084 | Open in IMG/M |
3300032043|Ga0318556_10387264 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 731 | Open in IMG/M |
3300032044|Ga0318558_10116049 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 1266 | Open in IMG/M |
3300032044|Ga0318558_10352424 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 730 | Open in IMG/M |
3300032064|Ga0318510_10122537 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1007 | Open in IMG/M |
3300032119|Ga0316051_1015358 | Not Available | 669 | Open in IMG/M |
3300032205|Ga0307472_100162524 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1648 | Open in IMG/M |
3300032261|Ga0306920_102206610 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 765 | Open in IMG/M |
3300032515|Ga0348332_10385554 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 859 | Open in IMG/M |
3300032515|Ga0348332_10669565 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 1117 | Open in IMG/M |
3300032515|Ga0348332_13636721 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 1193 | Open in IMG/M |
3300032515|Ga0348332_14271295 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 1026 | Open in IMG/M |
3300032756|Ga0315742_13009531 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 543 | Open in IMG/M |
3300032770|Ga0335085_12020307 | Not Available | 584 | Open in IMG/M |
3300032783|Ga0335079_12290563 | Not Available | 513 | Open in IMG/M |
3300032805|Ga0335078_10361113 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1924 | Open in IMG/M |
3300032805|Ga0335078_11699360 | Not Available | 692 | Open in IMG/M |
3300032893|Ga0335069_10648543 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1206 | Open in IMG/M |
3300032895|Ga0335074_10120953 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Thermomonospora | 3391 | Open in IMG/M |
3300034163|Ga0370515_0463920 | Not Available | 534 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 22.32% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 14.29% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 6.70% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.36% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 4.91% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.57% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.57% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.12% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.12% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 3.12% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.68% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.23% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.79% |
Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 1.79% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.34% |
Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 1.34% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.89% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.89% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.89% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.89% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.89% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.89% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.89% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.89% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.89% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.89% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.89% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.89% |
Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.45% |
Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.45% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.45% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.45% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.45% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.45% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.45% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.45% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.45% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.45% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.45% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.45% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.45% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.45% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.45% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.45% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.45% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.45% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459023 | Grass soil microbial communities from Rothamsted Park, UK - FA3 (control condition) | Environmental | Open in IMG/M |
3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
3300004471 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 57 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004478 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 69 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004616 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 15 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004617 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 47 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004971 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 41 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004973 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 19 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004977 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 67 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005168 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPC | Environmental | Open in IMG/M |
3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Host-Associated | Open in IMG/M |
3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
3300010123 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010146 | Soil microbial communities from California, USA to study soil gas exchange rates - JR-CA-SND metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300010859 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300010860 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300010861 | Boreal forest soil eukaryotic communities from Alaska, USA - C4-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300010869 | Boreal forest soil eukaryotic communities from Alaska, USA - W4-4 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300010877 | Boreal forest soil eukaryotic communities from Alaska, USA - W3-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300011030 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 83 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011042 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 76 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011048 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 37 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011059 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 44 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011061 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 12 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011063 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 15 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011066 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 3 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011071 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 42 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011073 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 74 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011077 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 57 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011087 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 55 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011090 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 69 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011109 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 18 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012224 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012395 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012398 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012400 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300014493 | Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaG | Environmental | Open in IMG/M |
3300014499 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2S metaG | Environmental | Open in IMG/M |
3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019185 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSE2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019268 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019787 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction) | Environmental | Open in IMG/M |
3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
3300020002 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1 | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300021860 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2014 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022512 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022527 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022530 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022708 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022711 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022712 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-32-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022715 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022716 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022720 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022722 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300024249 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK17 | Environmental | Open in IMG/M |
3300024279 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK33 | Environmental | Open in IMG/M |
3300025320 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025527 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026214 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-047 (SPAdes) | Environmental | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300026911 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027030 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF041 (SPAdes) | Environmental | Open in IMG/M |
3300027076 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF012 (SPAdes) | Environmental | Open in IMG/M |
3300027090 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF016 (SPAdes) | Environmental | Open in IMG/M |
3300027181 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027497 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes) | Environmental | Open in IMG/M |
3300027567 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027609 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027635 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027662 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG (SPAdes) | Environmental | Open in IMG/M |
3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
3300028138 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK25 | Environmental | Open in IMG/M |
3300028716 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198 | Environmental | Open in IMG/M |
3300028742 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_3 | Environmental | Open in IMG/M |
3300028801 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_3 | Environmental | Open in IMG/M |
3300028877 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_3 | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300029701 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300029910 | III_Palsa_E2 coassembly | Environmental | Open in IMG/M |
3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300030057 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1 | Environmental | Open in IMG/M |
3300030529 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO740-VDE013SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030594 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO141-VCO089SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030598 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO747-VDE048SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030603 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO133-ANR017SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030624 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO132-ANR005SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030730 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030739 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_3 | Environmental | Open in IMG/M |
3300030740 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ARE Co-assembly | Environmental | Open in IMG/M |
3300030743 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assembly | Environmental | Open in IMG/M |
3300030980 | Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Humus N2 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030993 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_185 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031017 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSI6 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031233 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2 | Environmental | Open in IMG/M |
3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
3300032119 | Metatranscriptome of soil microbial communities from Bohemian Forest, Czech Republic ? CSE5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
3300032756 | Forest Soil Metatranscriptomics Site 2 Humus Litter Mineral Combined Assembly | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
FA3_11256180 | 2170459023 | Grass Soil | EVAARVTRLLQPARPLPAAAVMAVCLAAALLVAAPVTLLIV |
JGI12635J15846_106701742 | 3300001593 | Forest Soil | GDMTARVARLLQPVRPLPATASAAICLASGLLVAATIALLIV* |
Ga0062386_1004706663 | 3300004152 | Bog Forest Soil | GTAGTCPAPAGALSVGGAVGEGEVTARVTRLLQPVRPLPLPAAAAICFAAVLLIAAPITLLII* |
Ga0068965_12743691 | 3300004471 | Peatlands Soil | AARVTRLLPPVRPLPTAIVLAICLASAVLVAVPITLLVV* |
Ga0068972_15852243 | 3300004478 | Peatlands Soil | AGALAAGEGEVAARVTRLLPPVRPLPTAIVLAICLASAVLVAVPITLLVV* |
Ga0068930_14134411 | 3300004616 | Peatlands Soil | ADTCPVPAGALAAGEGEVAARVTRLLPPVRPLPTAIVLAICLASAVLVAVPITLLVV* |
Ga0068955_14150901 | 3300004617 | Peatlands Soil | CPAPAGALAAGEGEVAARVTRLLQPVRPLPTAIVLAICLASAVLVAVPITLLVV* |
Ga0072324_10160053 | 3300004971 | Peatlands Soil | LVRFGTADTCPAPAGALAAGEGEVAARVTRLLPPVRPLPTAIVLAICLASAVLVAVPITLLVV* |
Ga0072322_10167273 | 3300004973 | Peatlands Soil | IGADTCPVPAGALAAGEGEVAARVTRLLPPVRPLPTAIVLAICLASAVLVAVPITLLVV* |
Ga0072329_10209051 | 3300004977 | Peatlands Soil | GEGEVAARVTRLLQAVRPLPTAVVLAICLASALLVAAPITLLII* |
Ga0066809_100121351 | 3300005168 | Soil | DMAARVARLLQPVRPLPAAASAAVCLTAGLLVAATIALLVV* |
Ga0070666_110275461 | 3300005335 | Switchgrass Rhizosphere | EGEVAARVTRLLQPARPLPAAAVMAVCLAAALLVAAPVTLLIV* |
Ga0070682_1016366791 | 3300005337 | Corn Rhizosphere | EGEVAARVTRLLQPARPLPAAAVMAVCLAAALLVAAPVTLLVV* |
Ga0070668_1014600081 | 3300005347 | Switchgrass Rhizosphere | AEGEVAARVTRLLQPARPLPAAAVMAVCLAAALLVAAPVTLLIV* |
Ga0070709_107072103 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | AAGEGEVAARVTRLLKPVRPLPAVAVLAICLSAALLVAAPVTLLLV* |
Ga0070714_1022119381 | 3300005435 | Agricultural Soil | GALAAGEGEVAARVTRLLKPVRPLPAVAVLAICLSAALLVAAPVTLLLV* |
Ga0070711_1004833013 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | GEVAARVTRLLQPARPLPAAAVMAVCLAAALLVAAPVTLLIV* |
Ga0070711_1008425963 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | PAGALAAGEGEVAARVTRLLKPVRPLPAVAVLAICLSAALLVAAPVTLLLV* |
Ga0070705_1000159061 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | EVAARVTRLLQPARPLPAAAVMAVCLAAALLVAAPVTLLIV* |
Ga0070679_1017511161 | 3300005530 | Corn Rhizosphere | EVAARVTRLLQPARPLPAAAVMAVCLAAALLVAAPVTLLVV* |
Ga0070761_105744921 | 3300005591 | Soil | AAGEGEVAARVARLLQPVRPLPVAASASVYCTAALLIAATVALLVI* |
Ga0070762_100870624 | 3300005602 | Soil | GDMAARVARLLQPVRPLPAAASASVCLTAGLLVAATIALLIV* |
Ga0068856_1018532121 | 3300005614 | Corn Rhizosphere | ARVTRLLQPARPLPAAAVMAVCLAAALLVAAPVTLLVV* |
Ga0068863_1016901623 | 3300005841 | Switchgrass Rhizosphere | GEVAARVTRLLQPARPLPAAAVMAVCLAAALLVAAPVTLLVV* |
Ga0070766_109187691 | 3300005921 | Soil | FGTAAPCPVPAGALAVGQGDVAARVTRLLQPVRPLPTAVVIGICLAAALLVTVPVTVLFV |
Ga0070717_101121261 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | PAGALAAGEGEVAARVTRLLQPVRPLPPAAVLAICLAAAFLVAAPITLLVI* |
Ga0075436_1006008173 | 3300006914 | Populus Rhizosphere | EGEVAARVTRLLQPARRLPAAAVMTICLAAALLVAAPVTLLVV* |
Ga0105244_101995643 | 3300009036 | Miscanthus Rhizosphere | TRLLQPSRPLPAVAVMAICLAAALLVAAPVTLLIV* |
Ga0105240_105422561 | 3300009093 | Corn Rhizosphere | GSEGEVAARVTRLLQPARPLPAAAVMAVCLAAALLVAAPVTLLVV* |
Ga0116220_101414571 | 3300009525 | Peatlands Soil | ARVTRLLQPVRPLPTAIVLAICLASAVLVAMPITLLVA* |
Ga0116215_11998491 | 3300009672 | Peatlands Soil | ACPAPAGARAAGEGEVAARVSRLLQPVRPLPTTVVLAICLASALLVAAPITLLII* |
Ga0116215_14787372 | 3300009672 | Peatlands Soil | LVRFGTAGACPAPAGALAAGEGEVAARVTRLLQPMRPLPTAVILAICLASALLVAAPITLLVI* |
Ga0116216_103475891 | 3300009698 | Peatlands Soil | ALAAGEGEVAARVSRLLQPVRPLPTAVVLAICLASALLVAAPITLLII* |
Ga0116217_101851693 | 3300009700 | Peatlands Soil | GALAAGEGEVAARVTRLLQPVRPLPTASVLAICLASAVLVAVPITLLVA* |
Ga0116219_103285833 | 3300009824 | Peatlands Soil | RFGTADTCPAPAGALAAGEGEVAARVTRLLQPVRPLPTAIVLAICLASAVLVAVPITLLVA* |
Ga0127479_11227741 | 3300010123 | Grasslands Soil | RLLHPVRPLPAVVVLGICLAAALLVAAPITLLVV* |
Ga0126320_11904182 | 3300010146 | Soil | AVAEGEVAARVTRLLQPAKPLPAVAVMAVCLAAALLVAAPVTLLIV* |
Ga0134067_101010913 | 3300010321 | Grasslands Soil | GALAAAEGEVAARVTRLLQPVRPLPAVAVMAVCLAAGLLVAAPVTLLLV* |
Ga0134084_102820021 | 3300010322 | Grasslands Soil | AVAEGEVAARVTRLIQPVRPLPAVAVMAVCLAAALLVAAPVTLLIV* |
Ga0074045_110753062 | 3300010341 | Bog Forest Soil | FGTAGTCPAPAGALAAGEGEVAARVTRLLKPVRPLPTAVVLAICLASALLVAVPITLLVA |
Ga0136449_1033680751 | 3300010379 | Peatlands Soil | GTCPAPAGALAAGEGEVAARVTRLLKPVRPLPTAVVLAICLASALLVAVPITLLVA* |
Ga0134127_122039113 | 3300010399 | Terrestrial Soil | EVAARVTRLLQPARPLPAAAVMAICLAAALLVAAPVTLLIV* |
Ga0126352_10640012 | 3300010859 | Boreal Forest Soil | APAGTLAVGEGEVAARVTRLLQPVRPLPMAVAAAICCAAALLIAAPIVLLIV* |
Ga0126352_11646633 | 3300010859 | Boreal Forest Soil | VRVVRLLQPVRPLSAAASASVCLTAGLLVAATIALLIV* |
Ga0126351_11269791 | 3300010860 | Boreal Forest Soil | AAGEGEVAARVTRLLQPVRPLPTAVVLAICLASALLVAAPITLLIV* |
Ga0126349_10267843 | 3300010861 | Boreal Forest Soil | RVTRLLQPVRPLPAVAVMAVCLAAALLVAAPVTLLIV* |
Ga0126359_15862591 | 3300010869 | Boreal Forest Soil | ARVTRLLKPIRPIPAAAILAICLASALLVAAPITLLVV* |
Ga0126361_102643622 | 3300010876 | Boreal Forest Soil | AVGEGEVTARVTRLLHPARPLPAFAVAAIFLTAALLVTAPVTLLIV* |
Ga0126356_104566381 | 3300010877 | Boreal Forest Soil | AGEGEVAARVTRLLKPVRPLPAAAVLAICLAAALLVAAPITLLVV* |
Ga0138603_1440453 | 3300011030 | Peatlands Soil | RVTRLLPPVRPLPTAIVLAICLASAVLVAVPITLLVV* |
Ga0138586_1473033 | 3300011042 | Peatlands Soil | LVRFGTADTCPVPAGALAAGEGEVAARVTRLLPPVRPLPTAIVLAICLASAVLVAVPITLLVV* |
Ga0138556_1556223 | 3300011048 | Peatlands Soil | VRFGTAGTCPAPAGALAAGEGEIAARVTRLIQPVRPLPTAIVLAICLASAVLVAVPITLLVV* |
Ga0138597_11148181 | 3300011059 | Peatlands Soil | VPAGALAAGEGEVAARVTRLLPPVRPLPTAIVLAICLASAVLVAVPITLLVV* |
Ga0138534_10827803 | 3300011061 | Peatlands Soil | RVTRLLQPVRPLPTAIVLAICLASAVLVAAPITLLVV* |
Ga0138537_10705993 | 3300011063 | Peatlands Soil | VRFGTADTCPVPAGALAAGEGEVAARVTRLLPPVRPLPTAIVLAICLASAVLVAVPITLLVV* |
Ga0138524_10993663 | 3300011066 | Peatlands Soil | ARVARLLQPVRPLPAAASAAVCLAAGLLVAATVALLVV* |
Ga0138595_10615621 | 3300011071 | Peatlands Soil | GTAGTCPAPAGALAAGEGEIAARVTRLLQPVRPLPTAIVLAICLASAVLVAVPITLLVV* |
Ga0138584_10519623 | 3300011073 | Peatlands Soil | AAGEGEIAARVTRLLQPVRPLPTAIVLAICLASAALVAVPITLLVV* |
Ga0138572_10938591 | 3300011077 | Peatlands Soil | GALAAGEGEVAARVTRLLPPVRPLPTAIVLAICLASAVLVAVPITLLVV* |
Ga0138572_11453933 | 3300011077 | Peatlands Soil | RFGTAGTCPAPAGALAVGEGEVAARVTRLLQPVRPLPTAVVLAICLASALLVAAPITLLVI* |
Ga0138570_11497791 | 3300011087 | Peatlands Soil | RVVRLLQPVRPLPAAASAAVCLTAGLLVAATVALLIV* |
Ga0138579_10921611 | 3300011090 | Peatlands Soil | VRFGTADTCPAPAGALAAGEGEVAARVTRLLPPVRPLPTAIVLAICLASAVLVAVPITLLVV* |
Ga0138579_12040593 | 3300011090 | Peatlands Soil | ARVVRLLQPVRPLPAAASAAVCLTAGLLVAATVALLVV* |
Ga0138539_10672451 | 3300011109 | Peatlands Soil | VSRLLQPVRPLPTTVVLAICLASALLVAAPITLLII* |
Ga0150983_107631261 | 3300011120 | Forest Soil | RVTRLLQPVRPLPAVAVTAVCLAAALLVAAPVTLLLV* |
Ga0150983_111809401 | 3300011120 | Forest Soil | RLLQPVRPLPTAAAAGICLAAGVLVAVPVTLLFL* |
Ga0150983_123029321 | 3300011120 | Forest Soil | AAAEGDMAARVVRLLQPVRPLPATASVSVCLTAGLLVAATIALLII* |
Ga0150983_142763393 | 3300011120 | Forest Soil | STFSLLAARVSRLLQPVRPLPTTVVLAICLASALLVAAPVTLLVI* |
Ga0150983_145388463 | 3300011120 | Forest Soil | GDMAARVTRLLQPVRPLPAAANMAVCLTAGLLVAATLGLLIV* |
Ga0137363_106652691 | 3300012202 | Vadose Zone Soil | AAEGEVAARVTRLLQPVRPLPAVAVMAVCLAAGLLVAAPVTLLLV* |
Ga0137376_109383923 | 3300012208 | Vadose Zone Soil | AEGEVAARVTRLLQPVRPLPAVAVMTVCLAAALLVAAPVTLLIV* |
Ga0137377_104966571 | 3300012211 | Vadose Zone Soil | PAGALAAGEGEVAARVTRLLQPVRPLPTVAVMAICLAAALLVAAPIALLIV* |
Ga0150985_1042509741 | 3300012212 | Avena Fatua Rhizosphere | RLLHPVRPLPAVMVLGICLAAALLVAAPITLLVV* |
Ga0150985_1049924853 | 3300012212 | Avena Fatua Rhizosphere | GEVAARVTRLLQPAKPLPAVAVMAVCLAAALLVAAPVTLLIV* |
Ga0134028_11784533 | 3300012224 | Grasslands Soil | EVAARVTRLIQPVRPLPAVAVMAVCLAAALLVAAPVTLLLV* |
Ga0137384_112739652 | 3300012357 | Vadose Zone Soil | LAAGEGEVAARVTRLLQPVRPLPAAAVLAIRLAAALLVAAPITLLVI* |
Ga0137390_107049203 | 3300012363 | Vadose Zone Soil | EVAARVTRLLQPVRPLPCAAVLAIRLAAALLVAAPITLLVI* |
Ga0134044_11844172 | 3300012395 | Grasslands Soil | RVTRLLQPVRPLPAAAVVAVCLAAAVLVAAPVTLLIV* |
Ga0134051_10499433 | 3300012398 | Grasslands Soil | EVAARVTRLIQPVRPLPAVAVMAVCLAAALLVAAPVTLLIV* |
Ga0134048_13755621 | 3300012400 | Grasslands Soil | RVTRLLQPVRPLPAVAVMAVCLAAALLVAAPVTLLLV* |
Ga0164309_103898411 | 3300012984 | Soil | GSEGEVAARVTRLLQPARPLPAAAVMAVCLAAALLVAAPVTLLLV* |
Ga0164306_110551941 | 3300012988 | Soil | RLLQPVRPLPAAALLAICLAAGLLVAVPIALLIV* |
Ga0157370_105446631 | 3300013104 | Corn Rhizosphere | GALAAAEGEVAARVTRLLQPVRPLPAVAVMTVCLAAGLLVAAPVTLLLV* |
Ga0157374_109759721 | 3300013296 | Miscanthus Rhizosphere | VAEGEVAARVTRLLQPARPLPAAAVMAICLAAALLVAARVTLLVV* |
Ga0157375_115547893 | 3300013308 | Miscanthus Rhizosphere | EGSEGEVAARVTRLLQPARPLPAAAVMAVCLAAALLVAAPVTLLVV* |
Ga0182016_104055241 | 3300014493 | Bog | VGQGDVAARVTRLLQPVRPLPTAVVVAICLAAALLVTVPITVLFG* |
Ga0182012_105328573 | 3300014499 | Bog | ALAAGEGDVAARVTRLLQPVRPLPAAALVAICLVAALLVTVPITLLVV* |
Ga0137418_102726031 | 3300015241 | Vadose Zone Soil | TRLLQPVRPLPAAAVTAVCLAAAVLVAAPVMLLVV* |
Ga0137403_100885176 | 3300015264 | Vadose Zone Soil | TRLLKPVRPLPAAAVLAICLSSALLVAAPVTLLLV* |
Ga0182035_121759222 | 3300016341 | Soil | VAARVTRLLQPVRPLPAVASVAICLAAALLVATTIALLVL |
Ga0187818_100183441 | 3300017823 | Freshwater Sediment | MAARVARLVLPVRPLPTAASAAVCLTAGLLVAATVA |
Ga0187818_100183442 | 3300017823 | Freshwater Sediment | MAARVARLLLPVRPLPTAASAAVCLTAGLLVAATIALLIV |
Ga0187820_11572411 | 3300017924 | Freshwater Sediment | AGEGDMAARVARLLQPVRPLPAAASAAVCLTAGLLVAVTVALLVL |
Ga0187824_100822291 | 3300017927 | Freshwater Sediment | LAAAEGEVAARVTRLLQPVRPLPAVAVTAVCLAAALLVAAPVTLLLV |
Ga0187814_103700762 | 3300017932 | Freshwater Sediment | VAARVARLLQPVRPLPRPVIAAICLAAALLVAAPVTLLII |
Ga0187803_104417512 | 3300017934 | Freshwater Sediment | GALAAAEGEVVARVARLLQLVRPLPAGAVAAICLSAALLVATPITLLIV |
Ga0187808_101545633 | 3300017942 | Freshwater Sediment | AGEGDMAARVARLLQPVRPLPVAASAAVCLTAGLLVAATVALLVV |
Ga0187817_104570561 | 3300017955 | Freshwater Sediment | AARVARLLQPVRPLPAAASAAVCLTAGLLVAATVALLIV |
Ga0187779_112610642 | 3300017959 | Tropical Peatland | AGALAAGEGEVAARVTRLLQPVRPLPTAAVLAVCLSAALLVAAPITLLIV |
Ga0187778_101190444 | 3300017961 | Tropical Peatland | ARVARLLQPVRPLPAAASAAVCLAAGLLVAATVALLIV |
Ga0187776_111307472 | 3300017966 | Tropical Peatland | EGEVAARVTRLLHPARPLPAAAVLAVCLAAALLVAAPITLLIV |
Ga0187859_100363095 | 3300018047 | Peatland | GDVAARVTRLLQPVQPLPAAAVVAICLAAALLVTVPITVLFG |
Ga0187772_102746003 | 3300018085 | Tropical Peatland | EGEVAARVTRLLQPVRPLPALAVAAICLSAALLVAAPVTLLVV |
Ga0187772_104608871 | 3300018085 | Tropical Peatland | RVARLLQPVRPLPAAASVAVCLAAGLLVAATVALLIL |
Ga0066669_109908083 | 3300018482 | Grasslands Soil | VAARVTRLLQPVRPLPAVAVMAVCLAAALLVAAPVTLLLV |
Ga0184587_1353751 | 3300019185 | Soil | VVRLLQPVRPLPAVASASVCLTAGLLVAATIALLIV |
Ga0181514_12134812 | 3300019268 | Peatland | ARLLQPVRPLPATASAAICLASGLLVAATIALLIV |
Ga0182031_12956264 | 3300019787 | Bog | VTARVSRLLHPARPLPAFAVAAICLAAALLVTAPVTLLVR |
Ga0193751_10798603 | 3300019888 | Soil | VAARVTRLLQPVRPLPTVAVLAICLAAALLVAAPIALLIV |
Ga0193730_10480733 | 3300020002 | Soil | GEVAARVTRLLQPARPLPAAAVMAVCLAAALLVAAPVTLLIV |
Ga0210403_109331361 | 3300020580 | Soil | ARVARLLQPVRPLPVAASAAVCLTAGLLVAATVALLVV |
Ga0210395_108535142 | 3300020582 | Soil | EVAARVTRLMQPVRPLPTAAVLAICLAAALLVAAPITLLVI |
Ga0210397_102458443 | 3300021403 | Soil | AARVTRLLQPARPLPAAAVMAICLAAALLVAAPVTLLVV |
Ga0210387_114275101 | 3300021405 | Soil | ARVVRLLQPVRPLPAAASASVFLAAGLLVAATIALLII |
Ga0210394_111781941 | 3300021420 | Soil | EGDMAARVVRLLQPVRPLPATASVSVCLTAGLLVAATIALLII |
Ga0210384_101124021 | 3300021432 | Soil | RVTRLLQPDRALPAAAVTAICLAAALLVAAPVTLLIV |
Ga0210384_106608953 | 3300021432 | Soil | AEGEVAARVTRLLQPVRPLPAVAVMAVCLAAALLVAAPVTLLLV |
Ga0210391_112027921 | 3300021433 | Soil | VAARVTRLLQPVRPLPTAVVIGICLAAALLVTVPVTVLFV |
Ga0213851_10809721 | 3300021860 | Watersheds | VAARVTRLIQPVRPLPTAIVLAICLASAVLVAVPITLLVV |
Ga0224712_103345743 | 3300022467 | Corn, Switchgrass And Miscanthus Rhizosphere | VTRLLQPARPLPAAAVMAVCLAAALLVAAPVTLLIV |
Ga0224712_104384652 | 3300022467 | Corn, Switchgrass And Miscanthus Rhizosphere | VTRLLQPARPLPAAAVMAVCLAAALLVAAPVTLLVV |
Ga0242676_10547871 | 3300022512 | Soil | VVRLLQPVRPLPAAASASVFLTAGLLVAATIALLIV |
Ga0242664_10894243 | 3300022527 | Soil | VAARVTRLIRPLRPLPAVAVMAVCLAAALLVAAPVTLLLV |
Ga0242658_10528673 | 3300022530 | Soil | ATRVTRLIQPLRPLPAVAVMAVCLAATLLVAAPVTLLIV |
Ga0242658_12483431 | 3300022530 | Soil | LRLLQPVRPLPAAASASVCLAAGLLVAATIALLII |
Ga0242662_100580181 | 3300022533 | Soil | RVTRLLQPVRPLPAVAVMAVCLAAALLVAAPVTLLLV |
Ga0242662_100595951 | 3300022533 | Soil | RVTRLIQPLRPLSAVAVMAVCLAAALLVAAPVTLLIV |
Ga0242670_10822382 | 3300022708 | Soil | RVVRLLQPVRPLPAAASASVCLTAGLLVAATIALLIV |
Ga0242674_10286522 | 3300022711 | Soil | ARLLQPVRPLSAAASASVCLTAGLLVAATIALLIV |
Ga0242653_10892612 | 3300022712 | Soil | VAARVARLLQAVRPLPAAASASVCLTAGLLVAATIALLIV |
Ga0242678_10102853 | 3300022715 | Soil | VSRLLQPVRPLPTAAVLAICLAAALLVAAPITLLIV |
Ga0242673_10350833 | 3300022716 | Soil | AVGEGEVAARVARLMHPVRPLPPAAIAAICLAAALLVATPVTLLIL |
Ga0242672_11213382 | 3300022720 | Soil | TRLIQPLRPLPAVAVMAVCLAATLLVAAPVTLLIV |
Ga0242657_11440281 | 3300022722 | Soil | AARVARLLQPVRPLPAAASASVCLTAGLLVAATIALLII |
Ga0242665_100666511 | 3300022724 | Soil | RVTRLIRPLRPLPAVAVTAVCLAAALLVAAPVTLLIV |
Ga0242654_100790641 | 3300022726 | Soil | VAARVTRLIQPLRPLPAVAVMAVCLAAALLVAAPVTLLIV |
Ga0247676_10651581 | 3300024249 | Soil | AEGEVAARVTRLLQPARPLPAAAVMAVCLAAALLVAAPVTLLVV |
Ga0247692_10622062 | 3300024279 | Soil | VAEGEVAARVTRLLQPARPLPAVAVMAVCLAAALLVAAPVTLLIV |
Ga0209171_105863492 | 3300025320 | Iron-Sulfur Acid Spring | ARLLQPVRPLPAAASAGVCCTAALLVAATVALLII |
Ga0208714_10483873 | 3300025527 | Arctic Peat Soil | GALAAGEGEVAARVSRLLQPVRPLPTAAVLAICLAAALLMAVPIALLVI |
Ga0207642_108484281 | 3300025899 | Miscanthus Rhizosphere | TRLLQPVRPLPAVAVMTVCLAAGLLVAAPVTLLLV |
Ga0207705_103056303 | 3300025909 | Corn Rhizosphere | AEGSEGEVAARVTRLLQPARPLPAAAVMAVCLAAALLVAAPVTLLIV |
Ga0207663_113814411 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | AARVTRLLQPARPLPAAAVMAVCLAAALLVAAPVTLLVV |
Ga0207700_105890493 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | TRLLKPVRPLPAVAVLAICLSAALLVAAPVTLLLV |
Ga0207664_105203703 | 3300025929 | Agricultural Soil | VAARVTRLLQPVRPLPAVAVMAVCLAAGLLVAAPVTLLLV |
Ga0207675_1014788641 | 3300026118 | Switchgrass Rhizosphere | AVAEGEVAARVTRLLQPARPLPAVAVMAVCLAAALLVAAPVTLLIV |
Ga0209838_10156751 | 3300026214 | Soil | GQGDVAARVTRLLQPVRPLPTGVVVAICLAAALLVTVPITVLFV |
Ga0209648_100680441 | 3300026551 | Grasslands Soil | GEGDVAARVARLLQPVRPLPAAANASVCLTAGLLVAATIALLIV |
Ga0209620_10236591 | 3300026911 | Forest Soil | ARVTRLLQPARPLPAAAVMAVCLAAALLVAAPVTLLIV |
Ga0208240_10120151 | 3300027030 | Forest Soil | PGALAAGEGDMAARVARLLQPVRPLPAAASASVCLTAGLLVAATIALLIV |
Ga0208860_10287622 | 3300027076 | Forest Soil | AAGEGDMAARVVRLLQPVRPLPAAASASVCLTAGLLVAATIALLIV |
Ga0208604_10043651 | 3300027090 | Forest Soil | RVARLLQPVRPLPAAASASVCLTAGLLVAATIALLIV |
Ga0208997_10418792 | 3300027181 | Forest Soil | ARVDDAPLGVAALEAEGEVAARVTRLLQPSRPLPAVAVMAVCLAAALLVAAPVTLLIV |
Ga0208199_10097501 | 3300027497 | Peatlands Soil | AARVTRLLPPVRPLPTAIVLAICLASAVLVAVPITLLVV |
Ga0209115_10218541 | 3300027567 | Forest Soil | DVAARVTRLLQPVRPLPTTVVVAICLAAAVLVTVPITVLFV |
Ga0209221_10605801 | 3300027609 | Forest Soil | VARVSRLMHPVRPLPTAAVAAICLAAALLVAAPVTLLVV |
Ga0209221_11804592 | 3300027609 | Forest Soil | GEGDMTARVARLLQPVRPLPATASAAICLASGLLVAATIALLIV |
Ga0209625_11068323 | 3300027635 | Forest Soil | AAAEGEVAARVTRLLQPVRPLPAVAVMAVCLAAALLVAAPVTLLLV |
Ga0208565_12180081 | 3300027662 | Peatlands Soil | LVRFGTAGACPAPAGALAAGEGEVAARVTRLLQPMRPLPTAVILAICLASALLVAAPITLLVI |
Ga0209656_102449601 | 3300027812 | Bog Forest Soil | VSRLLQPVRPLPTAVVLAICLASALLVAAPITLLII |
Ga0209517_101310574 | 3300027854 | Peatlands Soil | AARVSRLLQPVRPLPTTVVLAICLASALLVAAPVTLLII |
Ga0209590_103783021 | 3300027882 | Vadose Zone Soil | LAAGEGEVAARVTRLLQPVRPLPGAAVLAIRLAAALLVAAPITLLVI |
Ga0209067_103189591 | 3300027898 | Watersheds | GEGDMAARVARLLQPVRPLPVAASAAVCLTAGLLVAATVALLVV |
Ga0247684_10842231 | 3300028138 | Soil | SEGEVAARVTRLLQPARPLPAAAVMAVCLAAALLVAAPVTLLIV |
Ga0307311_100789951 | 3300028716 | Soil | VAEGEVAARVTRLLQPSRPLPAVAVMAVCLAAALLVAAPVTLLIV |
Ga0302220_101361283 | 3300028742 | Palsa | VGQGDVAARVTRLLQPVRPLPAAAVVAICLAAALLVTVPVTVLFV |
Ga0302226_101012273 | 3300028801 | Palsa | CPAPAGALAVGQGDVAARVTRLLQPVRPLPTAAIVAICLAAALLVTVPITALFG |
Ga0302235_103200221 | 3300028877 | Palsa | CPAPAGTLSAGQGDVAARVTRLLQPVRPLPPAVVLAICLAAALLVTVPITVLFV |
Ga0308309_113378251 | 3300028906 | Soil | ALADGEGDMAARVVRLLQPVRPLYAAASASVCLTAGLLVAATIALLIV |
Ga0222748_11178752 | 3300029701 | Soil | AARVTRLMLPVRPLPTAAVLAICLAAALLVAAPITLLIV |
Ga0311369_106367873 | 3300029910 | Palsa | DVAARVTRLLQPVRPLPTAVVVAICLAAALLVTVPVTVLFV |
Ga0311340_115744252 | 3300029943 | Palsa | PAGALAVGQGDVAARVTRLLQPVRPLPTAAVVAICMAAAVLVTVPITVLFV |
Ga0311371_120656681 | 3300029951 | Palsa | LAAAEGEVAARVTRLLQPVRPLPAVAVAAIRLAAALLIAAPVTLLVV |
Ga0311339_106953863 | 3300029999 | Palsa | GPCPAPAGTLAAGQGDVAARVTRLLQPVRPLPTSVVVAICLAAALLVTVPITVLFV |
Ga0311338_101648761 | 3300030007 | Palsa | CPAPAGTLAAGQGDVAARVTRLLQPVRPLPTAVVVAICLAAALLVTVPITVLFV |
Ga0302176_101955573 | 3300030057 | Palsa | PAPAGALAVGQGDVAARVTRLLQPVRPLPTAVVVAICLAAALLVTVPVTVLFV |
Ga0210284_17497663 | 3300030529 | Soil | NSGGEVTARVTRLLQPVRLLPLAAVTAICFAAVLLIAAPVTLLVI |
Ga0210280_11593901 | 3300030594 | Soil | PALVRFGTAAPCPAPAGALSAGQGDVAARVTRLLQPVRPLPPAVVLAICLAAALLVTVPITVLFV |
Ga0210287_11380122 | 3300030598 | Soil | RVVRLLQPVRPLPAAASASVFLAAGLLVAATIALLIA |
Ga0210253_106336771 | 3300030603 | Soil | AVGEGDMAARVARLLQPLRPLPAPASAAICLAAGLLVAATITLLIV |
Ga0210251_106139052 | 3300030624 | Soil | AWVARLLQPVRPLPAAVSAAVCLSAGLLVAATVALLIV |
Ga0307482_11986273 | 3300030730 | Hardwood Forest Soil | SRLLHPVRPLPATASVAICLAAGLLVAATLALLVV |
Ga0302311_105979923 | 3300030739 | Palsa | PAPAGTLSAGQGDVAARVTRLLQPVRPLPPAVVLAICLAAALLVTVPITVLFV |
Ga0265460_101896211 | 3300030740 | Soil | AGALAAAEGEVFARVSRLLQPVRPLPTAAVLAICLAAALLVAAPITLLIV |
Ga0265460_117319451 | 3300030740 | Soil | MGSLVREHGGQFAPAGTLAAGQGDVAARVTRLLQPVRPLPTTVVVAICLAAAVLVTVPIAVLFV |
Ga0265460_118902503 | 3300030740 | Soil | LLIFGQGDVAARVTRLLQPVRPLPTAVVIAICLAAALLVTVPVTVLFV |
Ga0265461_114328861 | 3300030743 | Soil | GEVVARVSRLLQPVRPLPTAAVLAICLAAALLVAAPITLLIV |
Ga0265461_124918171 | 3300030743 | Soil | RTAPGRRLLQPLRPLPAPASAAICLAAGLLVAATITLLIV |
Ga0265461_133227681 | 3300030743 | Soil | GQGDVAARVTRLLQPVRPLPTTVVVAICLAAAVLVTVPIAVLFV |
Ga0074027_112590693 | 3300030980 | Soil | VAARVARLMHPVRPLPPAAIAAICLAAALLVATPVTLLIL |
Ga0308190_11590982 | 3300030993 | Soil | VTRLLQPSRPLPAAAVMAVCLAAALLVAAPVTLLIV |
Ga0265744_1070051 | 3300031017 | Soil | AGEGDMAARVVRLLQPVRPLPAAASASVCLTAGLLVAATVALLVV |
Ga0265744_1157562 | 3300031017 | Soil | AGEGDMAARVVRLLQPVRPLPAAASASVCLTAGLLVAATIALLIV |
Ga0265760_102217341 | 3300031090 | Soil | EGEVVARVSRLLQPVRPLPTAAVLAICLAAALLVAAPITLLIV |
Ga0302307_104261971 | 3300031233 | Palsa | VAARVTRLLRPVRPLPTVAVVAICLAAALLVTVPVTVLFV |
Ga0170818_1022713641 | 3300031474 | Forest Soil | ARVARLVQPARPLPTAAVVAICLAAAVLVAAPVTLLIV |
Ga0170818_1059935652 | 3300031474 | Forest Soil | ALAAAEGEVAARVTRLIRPLRPLPAVAVMGVCLAAALLVAAPVTLLIV |
Ga0318528_101248011 | 3300031561 | Soil | GEVAARVTRLLQPVRPLPGPAVLAVCLAAAFLVAAPVTLLVI |
Ga0318515_106181031 | 3300031572 | Soil | MAARVARLLQPVRPLPAAASAAVCLAAGLLVAATMALLIL |
Ga0318574_102560641 | 3300031680 | Soil | VARLVQPVRPLPAAAVAGVCLAAAVLVAAPVTLLIV |
Ga0310686_1100641974 | 3300031708 | Soil | RFGTAAPCPVPAGALAVGQGDVAARVTRLLQPVRPLPTAVVLAICLAAALLVTVPVTVLF |
Ga0318521_102789513 | 3300031770 | Soil | ALAAAEGEVAARVVRLLQPVRPLPAAAVLAICLSAALLVAAPITLLIV |
Ga0318512_100201125 | 3300031846 | Soil | EVAARVARLLQPVRPLPRPAVAAICLAAALLVAAPVMLLII |
Ga0310909_110669103 | 3300031947 | Soil | VAARVARLVRPARPLPTAAVVGVCLAAAVLVAAPVTLLIV |
Ga0318569_101467291 | 3300032010 | Soil | VAARVARLVQPVRPLPAAAVAGVCLAAAVLVAAPVTLLIV |
Ga0318556_103872641 | 3300032043 | Soil | RVARLLQPVRPLPAAASAAICLGAGLLVAATMALLIL |
Ga0318558_101160494 | 3300032044 | Soil | GDMAARVARLLLPVRPLPAAASAAVCLTAGLLVAATVALLIV |
Ga0318558_103524241 | 3300032044 | Soil | GDMAARVARLLQPVRPLPAAASAAVCLGAGLLVAATMALLIL |
Ga0318510_101225373 | 3300032064 | Soil | ARVARLVRPARPLPATAVAAVCLAAAVLVAAPITLLVV |
Ga0316051_10153582 | 3300032119 | Soil | VRLLQPVRPLSAAASASVCLTAGLLVAATIALLIV |
Ga0307472_1001625241 | 3300032205 | Hardwood Forest Soil | ARVTRLLQPARPLPAAAVMAICLAAALLVAAPVTLLIV |
Ga0306920_1022066101 | 3300032261 | Soil | EGDMTARVVRLLQPVRPLPAAASAAVCLAAGLLVAATMALLIL |
Ga0348332_103855541 | 3300032515 | Plant Litter | ALAAAEGEVFARVSRLLQPVRPLPTAVVLAICLASALLVATPITLLII |
Ga0348332_106695653 | 3300032515 | Plant Litter | EGDMAARVVRLLQPVRPLPAVASASVCLTAGLLVAATIALLIV |
Ga0348332_136367211 | 3300032515 | Plant Litter | AGTLAAAEGEVAARVTRLLHPARPLPAVVVAAILLAAALLVTAPVTLLVV |
Ga0348332_142712951 | 3300032515 | Plant Litter | GEGDMAARVSRLLQPVRPLPAAASAAVCLASGLLVATTVALLIV |
Ga0315742_130095312 | 3300032756 | Forest Soil | VAARVTRLLQPVRPLPPAVVLAICLAAALLVTVPITVLFV |
Ga0335085_120203072 | 3300032770 | Soil | GEGEVAARVTRLLQPVRPLPAVAVLAVCLSAALLVAAPITLLIV |
Ga0335079_122905631 | 3300032783 | Soil | EGDMAARVVRLLQPVRPLPATASAAVCLAAGLLVAATVALLII |
Ga0335078_103611131 | 3300032805 | Soil | ARVTRLLQPVRPLPAAAVLAVCLAAALLVAAPITLLIV |
Ga0335078_116993601 | 3300032805 | Soil | RVTRLLQPVRPLPVAAVLAVCLAAALLVAAPITLLIV |
Ga0335069_106485433 | 3300032893 | Soil | AARVTRLLKPVRPLPAVAVLAICLSAALLVAAPVTLLVV |
Ga0335074_101209536 | 3300032895 | Soil | MAARVARLLQPVRPLPAAATAAVCLTAGLLVAATLGLLIV |
Ga0370515_0463920_1_147 | 3300034163 | Untreated Peat Soil | ALAVGQGDVAARVTRLLQPVRPLPTAVVVAICLAAALLVTVPVTVLFV |
⦗Top⦘ |