Basic Information | |
---|---|
Family ID | F020510 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 223 |
Average Sequence Length | 42 residues |
Representative Sequence | VSLQDLLTMFSARVIGTYTPEQYANCVREARANRMRWGMGQW |
Number of Associated Samples | 94 |
Number of Associated Scaffolds | 223 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 77.13 % |
% of genes near scaffold ends (potentially truncated) | 18.83 % |
% of genes from short scaffolds (< 2000 bps) | 56.05 % |
Associated GOLD sequencing projects | 78 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.40 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (75.336 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (44.843 % of family members) |
Environment Ontology (ENVO) | Unclassified (81.166 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (84.753 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 27.14% β-sheet: 0.00% Coil/Unstructured: 72.86% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 223 Family Scaffolds |
---|---|---|
PF08279 | HTH_11 | 22.42 |
PF13481 | AAA_25 | 16.59 |
PF12705 | PDDEXK_1 | 9.42 |
PF08708 | PriCT_1 | 8.52 |
PF00145 | DNA_methylase | 2.24 |
PF04480 | DUF559 | 1.79 |
PF01844 | HNH | 1.79 |
PF00356 | LacI | 1.35 |
PF10926 | DUF2800 | 0.90 |
PF04851 | ResIII | 0.90 |
PF05136 | Phage_portal_2 | 0.90 |
PF02557 | VanY | 0.90 |
PF05876 | GpA_ATPase | 0.90 |
PF04545 | Sigma70_r4 | 0.90 |
PF04055 | Radical_SAM | 0.45 |
PF11645 | PDDEXK_5 | 0.45 |
PF00535 | Glycos_transf_2 | 0.45 |
PF00676 | E1_dh | 0.45 |
PF02195 | ParBc | 0.45 |
PF14216 | DUF4326 | 0.45 |
PF05869 | Dam | 0.45 |
COG ID | Name | Functional Category | % Frequency in 223 Family Scaffolds |
---|---|---|---|
COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 2.24 |
COG1876 | LD-carboxypeptidase LdcB, LAS superfamily | Cell wall/membrane/envelope biogenesis [M] | 0.90 |
COG2173 | D-alanyl-D-alanine dipeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.90 |
COG5511 | Phage capsid protein | Mobilome: prophages, transposons [X] | 0.90 |
COG5525 | Phage terminase, large subunit GpA | Mobilome: prophages, transposons [X] | 0.90 |
COG0567 | 2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, and related enzymes | Energy production and conversion [C] | 0.45 |
COG1071 | TPP-dependent pyruvate or acetoin dehydrogenase subunit alpha | Energy production and conversion [C] | 0.45 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 76.23 % |
Unclassified | root | N/A | 23.77 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300003490|JGI25926J51410_1078542 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
3300003493|JGI25923J51411_1024883 | All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerota bacterium | 1187 | Open in IMG/M |
3300004125|Ga0066182_10063904 | Not Available | 844 | Open in IMG/M |
3300004448|Ga0065861_1076340 | All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerota bacterium | 1096 | Open in IMG/M |
3300004461|Ga0066223_1116891 | All Organisms → cellular organisms → Bacteria → PVC group | 2303 | Open in IMG/M |
3300004461|Ga0066223_1130908 | All Organisms → cellular organisms → Bacteria → PVC group | 974 | Open in IMG/M |
3300004804|Ga0007796_10135602 | Not Available | 744 | Open in IMG/M |
3300005581|Ga0049081_10001474 | All Organisms → cellular organisms → Bacteria | 8885 | Open in IMG/M |
3300005581|Ga0049081_10009228 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 3742 | Open in IMG/M |
3300005581|Ga0049081_10040554 | All Organisms → cellular organisms → Bacteria | 1768 | Open in IMG/M |
3300005581|Ga0049081_10065913 | All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerota bacterium | 1363 | Open in IMG/M |
3300005581|Ga0049081_10156945 | All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerota bacterium | 831 | Open in IMG/M |
3300005940|Ga0073913_10041918 | Not Available | 712 | Open in IMG/M |
3300005992|Ga0073924_1051214 | All Organisms → cellular organisms → Bacteria → PVC group | 601 | Open in IMG/M |
3300006029|Ga0075466_1156018 | All Organisms → cellular organisms → Bacteria → PVC group | 585 | Open in IMG/M |
3300006805|Ga0075464_10004477 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 6543 | Open in IMG/M |
3300006805|Ga0075464_10023275 | All Organisms → cellular organisms → Bacteria | 3230 | Open in IMG/M |
3300006805|Ga0075464_10069749 | All Organisms → Viruses → Predicted Viral | 1978 | Open in IMG/M |
3300006805|Ga0075464_10236857 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 1089 | Open in IMG/M |
3300006805|Ga0075464_10280895 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 1000 | Open in IMG/M |
3300006805|Ga0075464_10371668 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
3300006805|Ga0075464_10421984 | All Organisms → cellular organisms → Bacteria → PVC group | 812 | Open in IMG/M |
3300006805|Ga0075464_10668740 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
3300006805|Ga0075464_10691754 | Not Available | 630 | Open in IMG/M |
3300007735|Ga0104988_10203 | All Organisms → cellular organisms → Bacteria | 11902 | Open in IMG/M |
3300008450|Ga0114880_1021912 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 2962 | Open in IMG/M |
3300009026|Ga0102829_1078511 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 1014 | Open in IMG/M |
3300009068|Ga0114973_10000471 | All Organisms → cellular organisms → Bacteria | 30394 | Open in IMG/M |
3300009068|Ga0114973_10007885 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 7051 | Open in IMG/M |
3300009068|Ga0114973_10016465 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Puniceicoccales → Puniceicoccaceae → Ruficoccus | 4651 | Open in IMG/M |
3300009068|Ga0114973_10018165 | All Organisms → cellular organisms → Bacteria | 4408 | Open in IMG/M |
3300009068|Ga0114973_10023057 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 3840 | Open in IMG/M |
3300009068|Ga0114973_10029160 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 3351 | Open in IMG/M |
3300009068|Ga0114973_10050825 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 2447 | Open in IMG/M |
3300009068|Ga0114973_10054396 | All Organisms → cellular organisms → Bacteria | 2355 | Open in IMG/M |
3300009068|Ga0114973_10056095 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 2312 | Open in IMG/M |
3300009068|Ga0114973_10061007 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 2201 | Open in IMG/M |
3300009068|Ga0114973_10106411 | Not Available | 1590 | Open in IMG/M |
3300009068|Ga0114973_10138065 | Not Available | 1362 | Open in IMG/M |
3300009068|Ga0114973_10163086 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 1234 | Open in IMG/M |
3300009068|Ga0114973_10165990 | All Organisms → cellular organisms → Bacteria → PVC group | 1221 | Open in IMG/M |
3300009068|Ga0114973_10235129 | Not Available | 992 | Open in IMG/M |
3300009068|Ga0114973_10528075 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
3300009152|Ga0114980_10020262 | All Organisms → cellular organisms → Bacteria | 4160 | Open in IMG/M |
3300009152|Ga0114980_10067122 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 2162 | Open in IMG/M |
3300009152|Ga0114980_10080106 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium ADurb.Bin157 | 1959 | Open in IMG/M |
3300009152|Ga0114980_10479074 | All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerota bacterium | 710 | Open in IMG/M |
3300009154|Ga0114963_10004510 | All Organisms → cellular organisms → Bacteria | 9573 | Open in IMG/M |
3300009154|Ga0114963_10018057 | All Organisms → cellular organisms → Bacteria | 4718 | Open in IMG/M |
3300009154|Ga0114963_10027537 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Puniceicoccales → Puniceicoccaceae → Ruficoccus | 3759 | Open in IMG/M |
3300009154|Ga0114963_10047286 | All Organisms → cellular organisms → Bacteria → PVC group | 2766 | Open in IMG/M |
3300009154|Ga0114963_10054571 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Puniceicoccales → Puniceicoccaceae → Ruficoccus | 2540 | Open in IMG/M |
3300009154|Ga0114963_10157588 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1342 | Open in IMG/M |
3300009155|Ga0114968_10006194 | All Organisms → cellular organisms → Bacteria | 8829 | Open in IMG/M |
3300009155|Ga0114968_10010628 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 6606 | Open in IMG/M |
3300009155|Ga0114968_10030022 | All Organisms → cellular organisms → Bacteria | 3652 | Open in IMG/M |
3300009155|Ga0114968_10052773 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 2613 | Open in IMG/M |
3300009158|Ga0114977_10214102 | Not Available | 1125 | Open in IMG/M |
3300009159|Ga0114978_10007155 | All Organisms → cellular organisms → Bacteria | 8815 | Open in IMG/M |
3300009159|Ga0114978_10010760 | All Organisms → cellular organisms → Bacteria | 7048 | Open in IMG/M |
3300009160|Ga0114981_10013918 | All Organisms → cellular organisms → Bacteria → PVC group | 4729 | Open in IMG/M |
3300009160|Ga0114981_10039166 | All Organisms → cellular organisms → Bacteria | 2686 | Open in IMG/M |
3300009160|Ga0114981_10053449 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 2262 | Open in IMG/M |
3300009160|Ga0114981_10078381 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 1835 | Open in IMG/M |
3300009160|Ga0114981_10346290 | All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerota bacterium | 804 | Open in IMG/M |
3300009160|Ga0114981_10589153 | Not Available | 591 | Open in IMG/M |
3300009161|Ga0114966_10370513 | Not Available | 846 | Open in IMG/M |
3300009163|Ga0114970_10092393 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 1882 | Open in IMG/M |
3300009180|Ga0114979_10345694 | Not Available | 877 | Open in IMG/M |
3300009180|Ga0114979_10447467 | All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerota bacterium | 751 | Open in IMG/M |
3300009183|Ga0114974_10009393 | All Organisms → cellular organisms → Bacteria | 7119 | Open in IMG/M |
3300009183|Ga0114974_10028094 | All Organisms → cellular organisms → Bacteria | 3912 | Open in IMG/M |
3300009184|Ga0114976_10334692 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 803 | Open in IMG/M |
3300009187|Ga0114972_10425631 | Not Available | 762 | Open in IMG/M |
3300010158|Ga0114960_10361471 | All Organisms → cellular organisms → Bacteria → PVC group | 716 | Open in IMG/M |
3300010334|Ga0136644_10037636 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 3178 | Open in IMG/M |
3300010334|Ga0136644_10466486 | Not Available | 708 | Open in IMG/M |
3300010885|Ga0133913_10214837 | All Organisms → cellular organisms → Bacteria | 5121 | Open in IMG/M |
3300010885|Ga0133913_10722376 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 2604 | Open in IMG/M |
3300010885|Ga0133913_10909777 | All Organisms → cellular organisms → Bacteria | 2283 | Open in IMG/M |
3300010885|Ga0133913_11091234 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 2056 | Open in IMG/M |
3300010885|Ga0133913_11111311 | Not Available | 2034 | Open in IMG/M |
3300011114|Ga0151515_10872 | All Organisms → cellular organisms → Bacteria | 12122 | Open in IMG/M |
3300012012|Ga0153799_1014806 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 1644 | Open in IMG/M |
3300012012|Ga0153799_1021760 | All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerota bacterium | 1285 | Open in IMG/M |
3300012013|Ga0153805_1076597 | All Organisms → cellular organisms → Bacteria → PVC group | 567 | Open in IMG/M |
3300012710|Ga0157550_1231068 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 846 | Open in IMG/M |
3300013004|Ga0164293_10290824 | All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerota bacterium | 1136 | Open in IMG/M |
3300013005|Ga0164292_10266440 | Not Available | 1185 | Open in IMG/M |
3300013372|Ga0177922_10727713 | Not Available | 1167 | Open in IMG/M |
3300013372|Ga0177922_11297393 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Brucellaceae → Brucella/Ochrobactrum group → Brucella | 2224 | Open in IMG/M |
3300013372|Ga0177922_11330661 | All Organisms → cellular organisms → Bacteria → PVC group | 841 | Open in IMG/M |
3300017701|Ga0181364_1009313 | All Organisms → cellular organisms → Bacteria → PVC group | 1662 | Open in IMG/M |
3300017701|Ga0181364_1017162 | Not Available | 1202 | Open in IMG/M |
3300017701|Ga0181364_1029746 | All Organisms → cellular organisms → Bacteria → PVC group | 884 | Open in IMG/M |
3300017701|Ga0181364_1073881 | Not Available | 521 | Open in IMG/M |
3300017701|Ga0181364_1076334 | Not Available | 512 | Open in IMG/M |
3300017761|Ga0181356_1104917 | Not Available | 917 | Open in IMG/M |
3300017761|Ga0181356_1127080 | Not Available | 808 | Open in IMG/M |
3300017761|Ga0181356_1185658 | Not Available | 624 | Open in IMG/M |
3300017761|Ga0181356_1199054 | All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerota bacterium | 594 | Open in IMG/M |
3300017774|Ga0181358_1042752 | All Organisms → cellular organisms → Bacteria → PVC group | 1736 | Open in IMG/M |
3300017774|Ga0181358_1097246 | All Organisms → cellular organisms → Bacteria → PVC group | 1059 | Open in IMG/M |
3300017778|Ga0181349_1290368 | Not Available | 533 | Open in IMG/M |
3300017784|Ga0181348_1297873 | Not Available | 541 | Open in IMG/M |
3300017785|Ga0181355_1315264 | Not Available | 583 | Open in IMG/M |
3300018790|Ga0187842_1034100 | All Organisms → cellular organisms → Bacteria → PVC group | 1638 | Open in IMG/M |
3300018790|Ga0187842_1087381 | Not Available | 952 | Open in IMG/M |
3300018815|Ga0187845_1004740 | All Organisms → cellular organisms → Bacteria | 6489 | Open in IMG/M |
3300018868|Ga0187844_10022058 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Puniceicoccales → Puniceicoccaceae → Ruficoccus | 3249 | Open in IMG/M |
3300018868|Ga0187844_10077337 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 1527 | Open in IMG/M |
3300018868|Ga0187844_10158281 | Not Available | 991 | Open in IMG/M |
3300018868|Ga0187844_10223069 | All Organisms → cellular organisms → Bacteria → PVC group | 804 | Open in IMG/M |
3300019784|Ga0181359_1002735 | All Organisms → cellular organisms → Bacteria | 5214 | Open in IMG/M |
3300019784|Ga0181359_1006398 | All Organisms → cellular organisms → Bacteria → PVC group | 3928 | Open in IMG/M |
3300019784|Ga0181359_1011542 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 3177 | Open in IMG/M |
3300019784|Ga0181359_1011997 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Puniceicoccales → Puniceicoccaceae → Ruficoccus | 3123 | Open in IMG/M |
3300019784|Ga0181359_1020530 | All Organisms → cellular organisms → Bacteria | 2499 | Open in IMG/M |
3300019784|Ga0181359_1039588 | All Organisms → cellular organisms → Bacteria → PVC group | 1825 | Open in IMG/M |
3300019784|Ga0181359_1098042 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1078 | Open in IMG/M |
3300019784|Ga0181359_1100598 | All Organisms → cellular organisms → Bacteria | 1060 | Open in IMG/M |
3300019784|Ga0181359_1128381 | Not Available | 897 | Open in IMG/M |
3300019784|Ga0181359_1146929 | Not Available | 813 | Open in IMG/M |
3300019784|Ga0181359_1174348 | Not Available | 716 | Open in IMG/M |
3300019784|Ga0181359_1187047 | Not Available | 678 | Open in IMG/M |
3300019784|Ga0181359_1228287 | All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerota bacterium | 580 | Open in IMG/M |
3300019784|Ga0181359_1256391 | All Organisms → cellular organisms → Bacteria → PVC group | 527 | Open in IMG/M |
3300020533|Ga0208364_1014553 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 1150 | Open in IMG/M |
3300021962|Ga0222713_10011280 | All Organisms → cellular organisms → Bacteria | 7990 | Open in IMG/M |
3300021963|Ga0222712_10001491 | All Organisms → cellular organisms → Bacteria | 28867 | Open in IMG/M |
3300021963|Ga0222712_10133571 | All Organisms → Viruses → Predicted Viral | 1695 | Open in IMG/M |
3300022190|Ga0181354_1012898 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 2515 | Open in IMG/M |
3300022190|Ga0181354_1014890 | All Organisms → cellular organisms → Bacteria → PVC group | 2378 | Open in IMG/M |
3300022190|Ga0181354_1044113 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1480 | Open in IMG/M |
3300022190|Ga0181354_1044604 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 1472 | Open in IMG/M |
3300022190|Ga0181354_1072544 | All Organisms → cellular organisms → Bacteria → PVC group | 1140 | Open in IMG/M |
3300022190|Ga0181354_1132373 | All Organisms → cellular organisms → Bacteria → PVC group | 793 | Open in IMG/M |
3300022407|Ga0181351_1216347 | Not Available | 626 | Open in IMG/M |
3300022748|Ga0228702_1004576 | All Organisms → cellular organisms → Bacteria | 6687 | Open in IMG/M |
3300022752|Ga0214917_10013227 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 7392 | Open in IMG/M |
3300022752|Ga0214917_10019608 | All Organisms → cellular organisms → Bacteria | 5609 | Open in IMG/M |
3300022752|Ga0214917_10022272 | All Organisms → cellular organisms → Bacteria | 5124 | Open in IMG/M |
3300022752|Ga0214917_10027107 | All Organisms → cellular organisms → Bacteria | 4433 | Open in IMG/M |
3300022752|Ga0214917_10055590 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 2629 | Open in IMG/M |
3300022752|Ga0214917_10063391 | All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerota bacterium | 2385 | Open in IMG/M |
3300022752|Ga0214917_10115760 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 1512 | Open in IMG/M |
3300023174|Ga0214921_10002465 | Not Available | 29971 | Open in IMG/M |
3300023174|Ga0214921_10010146 | All Organisms → cellular organisms → Bacteria | 11721 | Open in IMG/M |
3300023174|Ga0214921_10018134 | All Organisms → cellular organisms → Bacteria | 7739 | Open in IMG/M |
3300023174|Ga0214921_10078730 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 2624 | Open in IMG/M |
3300023174|Ga0214921_10086028 | All Organisms → cellular organisms → Bacteria | 2450 | Open in IMG/M |
3300023179|Ga0214923_10098332 | All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerota bacterium | 1984 | Open in IMG/M |
3300027547|Ga0209864_1031889 | Not Available | 651 | Open in IMG/M |
3300027608|Ga0208974_1000140 | All Organisms → cellular organisms → Bacteria | 31372 | Open in IMG/M |
3300027608|Ga0208974_1012344 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 2750 | Open in IMG/M |
3300027608|Ga0208974_1066279 | All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerota bacterium | 1009 | Open in IMG/M |
3300027656|Ga0209357_1189142 | Not Available | 529 | Open in IMG/M |
3300027659|Ga0208975_1030070 | All Organisms → cellular organisms → Bacteria | 1740 | Open in IMG/M |
(restricted) 3300027728|Ga0247836_1175017 | Not Available | 890 | Open in IMG/M |
(restricted) 3300027730|Ga0247833_1027940 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 3739 | Open in IMG/M |
3300027734|Ga0209087_1003113 | All Organisms → cellular organisms → Bacteria | 9171 | Open in IMG/M |
3300027734|Ga0209087_1050149 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 1910 | Open in IMG/M |
3300027734|Ga0209087_1060497 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 1698 | Open in IMG/M |
3300027736|Ga0209190_1001882 | All Organisms → cellular organisms → Bacteria | 14494 | Open in IMG/M |
3300027736|Ga0209190_1010229 | All Organisms → cellular organisms → Bacteria | 5625 | Open in IMG/M |
3300027736|Ga0209190_1015498 | All Organisms → cellular organisms → Bacteria | 4390 | Open in IMG/M |
3300027736|Ga0209190_1231098 | Not Available | 743 | Open in IMG/M |
3300027741|Ga0209085_1000900 | All Organisms → cellular organisms → Bacteria | 19797 | Open in IMG/M |
3300027741|Ga0209085_1003207 | All Organisms → cellular organisms → Bacteria | 9036 | Open in IMG/M |
3300027741|Ga0209085_1011051 | All Organisms → cellular organisms → Bacteria | 4521 | Open in IMG/M |
3300027741|Ga0209085_1020914 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 3149 | Open in IMG/M |
3300027741|Ga0209085_1032554 | All Organisms → cellular organisms → Bacteria | 2466 | Open in IMG/M |
3300027741|Ga0209085_1290241 | All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerota bacterium | 627 | Open in IMG/M |
3300027747|Ga0209189_1064569 | Not Available | 1726 | Open in IMG/M |
3300027747|Ga0209189_1122518 | Not Available | 1138 | Open in IMG/M |
3300027747|Ga0209189_1265447 | Not Available | 680 | Open in IMG/M |
3300027749|Ga0209084_1250658 | Not Available | 688 | Open in IMG/M |
3300027754|Ga0209596_1269164 | All Organisms → cellular organisms → Bacteria → PVC group | 690 | Open in IMG/M |
3300027759|Ga0209296_1007108 | All Organisms → cellular organisms → Bacteria | 7004 | Open in IMG/M |
3300027759|Ga0209296_1019813 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Candidatus Magnetobacterium → Candidatus Magnetobacterium casensis | 3847 | Open in IMG/M |
3300027759|Ga0209296_1153761 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 1032 | Open in IMG/M |
3300027760|Ga0209598_10105397 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 1317 | Open in IMG/M |
3300027763|Ga0209088_10004298 | All Organisms → cellular organisms → Bacteria | 8324 | Open in IMG/M |
3300027763|Ga0209088_10054789 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 1925 | Open in IMG/M |
3300027763|Ga0209088_10161288 | Not Available | 983 | Open in IMG/M |
3300027770|Ga0209086_10068146 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 1918 | Open in IMG/M |
3300027782|Ga0209500_10005889 | All Organisms → cellular organisms → Bacteria | 7926 | Open in IMG/M |
3300027782|Ga0209500_10015809 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Puniceicoccales → Puniceicoccaceae → Ruficoccus | 4502 | Open in IMG/M |
3300027782|Ga0209500_10190163 | All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerota bacterium | 934 | Open in IMG/M |
3300027963|Ga0209400_1001416 | All Organisms → cellular organisms → Bacteria | 19283 | Open in IMG/M |
3300027963|Ga0209400_1001734 | All Organisms → cellular organisms → Bacteria | 17175 | Open in IMG/M |
3300027963|Ga0209400_1008647 | All Organisms → cellular organisms → Bacteria | 6651 | Open in IMG/M |
3300027963|Ga0209400_1111748 | Not Available | 1251 | Open in IMG/M |
3300027969|Ga0209191_1004753 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 7829 | Open in IMG/M |
3300027969|Ga0209191_1210365 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 760 | Open in IMG/M |
(restricted) 3300027970|Ga0247837_1159242 | Not Available | 989 | Open in IMG/M |
3300027971|Ga0209401_1000344 | All Organisms → cellular organisms → Bacteria | 32011 | Open in IMG/M |
3300027971|Ga0209401_1003935 | All Organisms → cellular organisms → Bacteria | 9268 | Open in IMG/M |
3300027971|Ga0209401_1007627 | All Organisms → cellular organisms → Bacteria | 6278 | Open in IMG/M |
3300027971|Ga0209401_1007884 | All Organisms → cellular organisms → Bacteria | 6144 | Open in IMG/M |
3300027971|Ga0209401_1011554 | All Organisms → cellular organisms → Bacteria | 4857 | Open in IMG/M |
3300027971|Ga0209401_1036400 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 2338 | Open in IMG/M |
3300027971|Ga0209401_1054364 | Not Available | 1798 | Open in IMG/M |
3300027971|Ga0209401_1086133 | All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerota bacterium | 1325 | Open in IMG/M |
3300027973|Ga0209298_10022411 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 3146 | Open in IMG/M |
3300027974|Ga0209299_1014061 | All Organisms → cellular organisms → Bacteria | 3748 | Open in IMG/M |
(restricted) 3300028553|Ga0247839_1108534 | All Organisms → cellular organisms → Bacteria | 1301 | Open in IMG/M |
(restricted) 3300028581|Ga0247840_10287732 | Not Available | 856 | Open in IMG/M |
(restricted) 3300029268|Ga0247842_10376695 | Not Available | 743 | Open in IMG/M |
3300031578|Ga0307376_10098028 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 2067 | Open in IMG/M |
3300031578|Ga0307376_10310409 | All Organisms → cellular organisms → Bacteria → PVC group | 1052 | Open in IMG/M |
3300031673|Ga0307377_11107490 | Not Available | 524 | Open in IMG/M |
3300031707|Ga0315291_10404710 | Not Available | 1297 | Open in IMG/M |
3300031707|Ga0315291_10684747 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 913 | Open in IMG/M |
3300031873|Ga0315297_10481107 | Not Available | 1044 | Open in IMG/M |
3300031952|Ga0315294_10940554 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 727 | Open in IMG/M |
3300032018|Ga0315272_10667386 | Not Available | 527 | Open in IMG/M |
3300032092|Ga0315905_10026558 | All Organisms → cellular organisms → Bacteria | 5875 | Open in IMG/M |
3300032118|Ga0315277_11290804 | Not Available | 641 | Open in IMG/M |
3300032156|Ga0315295_10417445 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 1365 | Open in IMG/M |
3300032256|Ga0315271_10956748 | Not Available | 739 | Open in IMG/M |
3300033981|Ga0334982_0077653 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 1784 | Open in IMG/M |
3300034020|Ga0335002_0056469 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 2807 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 44.84% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 17.49% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 10.76% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 6.28% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 4.48% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 4.04% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 3.59% |
Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 1.35% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.35% |
Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 1.35% |
Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 1.35% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 0.45% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.45% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.45% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.45% |
Surface Ice | Environmental → Aquatic → Freshwater → Ice → Unclassified → Surface Ice | 0.45% |
Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.45% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.45% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300003490 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN | Environmental | Open in IMG/M |
3300003493 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN | Environmental | Open in IMG/M |
3300004125 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (version 2) | Environmental | Open in IMG/M |
3300004448 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
3300004461 | Marine viral communities from Newfoundland, Canada BC-2 | Environmental | Open in IMG/M |
3300004804 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA0M | Environmental | Open in IMG/M |
3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
3300005940 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_25-Nov-14 | Environmental | Open in IMG/M |
3300005992 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_14-Oct-14 | Environmental | Open in IMG/M |
3300006029 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA | Environmental | Open in IMG/M |
3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
3300007735 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea ? 2014Oct | Environmental | Open in IMG/M |
3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
3300009187 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG | Environmental | Open in IMG/M |
3300010158 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG | Environmental | Open in IMG/M |
3300010334 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2) | Environmental | Open in IMG/M |
3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
3300011114 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2016Feb | Environmental | Open in IMG/M |
3300012012 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m | Environmental | Open in IMG/M |
3300012013 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 67 - Surface Ice | Environmental | Open in IMG/M |
3300012710 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES041 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300018790 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - SP09_SKY_41 | Environmental | Open in IMG/M |
3300018815 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - SP09_SKY_68 | Environmental | Open in IMG/M |
3300018868 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - SP09_SKY_50 | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020533 | Freshwater microbial communities from Lake Mendota, WI - 08JUN2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300022748 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 20-17_Aug_MG | Environmental | Open in IMG/M |
3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
3300023179 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510 | Environmental | Open in IMG/M |
3300027547 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_25-Nov-14 (SPAdes) | Environmental | Open in IMG/M |
3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027656 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027728 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14m | Environmental | Open in IMG/M |
3300027730 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_8m | Environmental | Open in IMG/M |
3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027741 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027747 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027749 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027760 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027770 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027970 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14.5m | Environmental | Open in IMG/M |
3300027971 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027973 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027974 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300028553 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_16m | Environmental | Open in IMG/M |
3300028581 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_17m | Environmental | Open in IMG/M |
3300029268 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_19m | Environmental | Open in IMG/M |
3300031578 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-2 | Environmental | Open in IMG/M |
3300031673 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-3 | Environmental | Open in IMG/M |
3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
3300031873 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0 | Environmental | Open in IMG/M |
3300031952 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40 | Environmental | Open in IMG/M |
3300032018 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_middle | Environmental | Open in IMG/M |
3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
3300032118 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15 | Environmental | Open in IMG/M |
3300032156 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0 | Environmental | Open in IMG/M |
3300032256 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_top | Environmental | Open in IMG/M |
3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
3300034020 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2015-rr0055 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI25926J51410_10785423 | 3300003490 | Freshwater Lake | VSLQELLTMFSGRIIGTYTPEQYANCVREARANRMRWGMGQW* |
JGI25923J51411_10248834 | 3300003493 | Freshwater Lake | MKGKSMTFKQLLIMFSARVIGTYTPKQYADCVREARANRMRWGMGQW* |
Ga0066182_100639042 | 3300004125 | Freshwater Lake | AKGGAVSLQELLTMFSGRVIGTYTPEQYANCVLEARANRMRWGMGQW* |
Ga0065861_10763402 | 3300004448 | Marine | VSLADLLIMFSARVIGTYTPEQYADCVREARANRHRWGMGQW* |
Ga0066223_11168912 | 3300004461 | Marine | VTLLNLLAMFSARVIGTYTPAQYSQQVIIARNNRMRWGMGQW* |
Ga0066223_11309084 | 3300004461 | Marine | VTFKQLLAFFSARVIGTYTPEQYANCVQEARANRMRWGMGQW* |
Ga0007796_101356022 | 3300004804 | Freshwater | MTLAKLLSMFSARIIGTYTPAQYAQQVIIARNNRMRWGMGQW* |
Ga0049081_1000147417 | 3300005581 | Freshwater Lentic | VSLQDILAMFSARVIGTYTPEQYAEQVIIARNNRMRWGMGQW* |
Ga0049081_100092285 | 3300005581 | Freshwater Lentic | VSLQELLTMFSGRVIGTYTREQYASCVREARANRMRWGMGQW* |
Ga0049081_100405544 | 3300005581 | Freshwater Lentic | VSLQDLLAMFSGRVIGTYTPEQYANCVREARANRMRWGMGQW* |
Ga0049081_100659133 | 3300005581 | Freshwater Lentic | MSLADLLTMFSARVIGTYTPEQYANCVREARANRMRWGIGQW* |
Ga0049081_101569453 | 3300005581 | Freshwater Lentic | MSLADLLIMFSARIIGTYTPEQYGDCVREARANRHRWGMGQW* |
Ga0073913_100419182 | 3300005940 | Sand | MSLQDLLVMFSARIIGTYTPDQYADCVREARANRHRWGMGQW* |
Ga0073924_10512141 | 3300005992 | Sand | VSLQILLAMFAGRVIGTYTPEQYANAVLTARADRMRWGMGQW* |
Ga0075466_11560182 | 3300006029 | Aqueous | VNLADLLSMFSARIISTYTPEQYAEQVIIARNNRMRWGMGQW* |
Ga0075464_1000447712 | 3300006805 | Aqueous | VSLQELLTMFSARVIGTYTPEQYANCVREARANRMRWGMGQW* |
Ga0075464_100232753 | 3300006805 | Aqueous | VSLADLLIMFSARVIGTYTLEQYADCVREARANRHRWGMGQW* |
Ga0075464_100697491 | 3300006805 | Aqueous | DLLTMFSARVIGTYTPEQYADCVREARANRHRWGMGQW* |
Ga0075464_102368574 | 3300006805 | Aqueous | VSLADLLTMFSGRIIGTYTPEQYANCVREARANRMRWGMGQW* |
Ga0075464_102808955 | 3300006805 | Aqueous | MTLANLIAMFSARIIGTYTPEQYADCVREARANRHRWGMGQW* |
Ga0075464_103716681 | 3300006805 | Aqueous | VSLADLLIMFSARVIGTYTPEQYAHCVREARANRHRWGMGQW* |
Ga0075464_104219842 | 3300006805 | Aqueous | MSLADLLIMFSARVIGTYTPEQYADCVREARANRHRWGMGQW* |
Ga0075464_106687403 | 3300006805 | Aqueous | VSLQELLTMFSGRVIGTYTPEQYANCVREARANRMRWGMGQW* |
Ga0075464_106917541 | 3300006805 | Aqueous | ADLLTMFSARVIGTYTPEQYAEQVIIARNNRMRWGIGQW* |
Ga0104988_1020328 | 3300007735 | Freshwater | VSLQDLLTMFSARVICTYTPEQYAEQVIIARNNRMRWGMGQW* |
Ga0114880_10219124 | 3300008450 | Freshwater Lake | VSLQELLTMFSGRIIGTYTPEQYADCVREARANRMRWGMGQW* |
Ga0102829_10785115 | 3300009026 | Estuarine | VSLQDLLTMFSARVIGTYTPEQYANAVRVARADRMRW |
Ga0114973_100004716 | 3300009068 | Freshwater Lake | VSLADLLAMFSARIIGTYTPEQYAEQVIIARNNRMRWGMGQW* |
Ga0114973_1000788510 | 3300009068 | Freshwater Lake | VSLADLLAMFSARVIGTYTPEQYANCVQEARANRMRWGMGQW* |
Ga0114973_100164653 | 3300009068 | Freshwater Lake | VSLQDLLTMFSARIICTYTPEQYANCVREARANRMRWGMGQW* |
Ga0114973_100181652 | 3300009068 | Freshwater Lake | VTLLDLLAMFSARVIGTYTPAQYAQQVIIARNNRMRWGMGQW* |
Ga0114973_100230575 | 3300009068 | Freshwater Lake | VTLQDLLTMFSARVIGTYTPEQYANCVREARANRMRWGMGQW* |
Ga0114973_100291602 | 3300009068 | Freshwater Lake | VTLKDLLSMFSARVVGTYTPEQYAQQVIIARNNRMRWGMGQW* |
Ga0114973_100508255 | 3300009068 | Freshwater Lake | MSLSDLLIMFSARVIGTYTPKQYANCVREARANRMRWGMGQW* |
Ga0114973_100543962 | 3300009068 | Freshwater Lake | VTLLDLLAMFSARIIGTYTPAQYAQQVIIAQNNRMRWGMGQW* |
Ga0114973_100560955 | 3300009068 | Freshwater Lake | MILAQLLSMFSARVIGTYTPAQYAKQVIIARNNRMRWGIGQW* |
Ga0114973_100610075 | 3300009068 | Freshwater Lake | MTLAQLLAMFSARVIGTYTPAQYAQQVIIARNNRMRWGMGQW* |
Ga0114973_101064112 | 3300009068 | Freshwater Lake | VTLRDLLSMFSARVIGTYTPAQYAQQVIIARNNRMRWGMGQW* |
Ga0114973_101380651 | 3300009068 | Freshwater Lake | GGAVSLTDLLTMFSARIIGTYTPEQYANCVQEARANRHRWGMGQW* |
Ga0114973_101630861 | 3300009068 | Freshwater Lake | MSLSDLLTMFSGRVICTYTPEQYANCVREARANRMRWGMGQW* |
Ga0114973_101659902 | 3300009068 | Freshwater Lake | VTLRDLLAMFSARVIGTYTPDQYDQQVIIARANRMRWGMGQW* |
Ga0114973_102351292 | 3300009068 | Freshwater Lake | VTLRDLLTMFSARVIGTYTPAQYAQQVIIARNNRMRWGMGQW* |
Ga0114973_105280753 | 3300009068 | Freshwater Lake | VSLQDLLAMFSGRIIGTYTPDQYANCVREARANRMRWGMGQW* |
Ga0114980_100202626 | 3300009152 | Freshwater Lake | MFSARVIGTYTLEQYAEQVIIARANRMRWGIGQW* |
Ga0114980_100671226 | 3300009152 | Freshwater Lake | MFSARVIGTYTPEQYAEQVIIARNNRMRWGMGQW* |
Ga0114980_100801061 | 3300009152 | Freshwater Lake | KGVRRNKMTLAQVLLMFSARVIGTYTPEQYANCVREARANRMRWGMGQW* |
Ga0114980_104790743 | 3300009152 | Freshwater Lake | VNLQDLLTMFSARVIGTYTPEQYAEQVIIARNNRMRWGMGQW* |
Ga0114963_100045107 | 3300009154 | Freshwater Lake | VSLQDLLTMFSARVIGTYTPEQYANCVREARANRMRWGIGQW* |
Ga0114963_100180575 | 3300009154 | Freshwater Lake | VTLRDLLCMFSARVIGTYTPAQYAQQVIIARNNRMRWGMGQW* |
Ga0114963_100275372 | 3300009154 | Freshwater Lake | VTLPDLLAMFSARVIGTYTPAQYDQQVIIARNNRMRWGMGQW* |
Ga0114963_100472864 | 3300009154 | Freshwater Lake | VTLKDLLSMFSARVIGTYTPAQYAEQVIIARGNRMRWGMGQW* |
Ga0114963_100545714 | 3300009154 | Freshwater Lake | MTLAQLLSMFSARVIGTYTPAQYAQQVIIARNNRMRWGMGQW* |
Ga0114963_101575883 | 3300009154 | Freshwater Lake | MSLADLLALFSARVIATYTPEQYANCVREARANRHRWGMGQW* |
Ga0114968_100061946 | 3300009155 | Freshwater Lake | VSLQELLSMFSGRIIGTYTPEQYANCVREARANRMRWGMGQW* |
Ga0114968_100106288 | 3300009155 | Freshwater Lake | VSLADLLTMFSARIIGTYTPEQYANCVREARANRMRWGMGQW* |
Ga0114968_100300223 | 3300009155 | Freshwater Lake | VSLQELLTMFSGRVIGTYTPKQYANCVREARANRMRWGMGQW* |
Ga0114968_100527737 | 3300009155 | Freshwater Lake | VTLLDLLAMFSARIIGTYTPAQYAQQVIIARNNRMRWGMGQW* |
Ga0114977_102141021 | 3300009158 | Freshwater Lake | MTLSQLITFFDARIIGTYTPEQYASCVLEARANRMRWGMGQW* |
Ga0114978_1000715513 | 3300009159 | Freshwater Lake | MTLAQVLLMFSARVIGTYTPEQYAEQVIIARNNRMRWGMGQW* |
Ga0114978_100107609 | 3300009159 | Freshwater Lake | MSLQELLTMFSARVIGTYTPEQYANCVREARANRMRWGMGQW* |
Ga0114981_100139183 | 3300009160 | Freshwater Lake | VRLQDLLTMFSARVIGTYTPKQYADCVREARANRHRWGMGQW* |
Ga0114981_100391666 | 3300009160 | Freshwater Lake | EMILAMFAARVICTYTPEQYADCVREARANRHRWGMGQW* |
Ga0114981_100534496 | 3300009160 | Freshwater Lake | VSLADLLSMFSARVIGTYTPEQYADCVKEARANRHRWGMGQW* |
Ga0114981_100783811 | 3300009160 | Freshwater Lake | MTLAQVLLMFSARVIGTYTPEQYANCVREARANRMRWGMGQW* |
Ga0114981_103462902 | 3300009160 | Freshwater Lake | MSLADLLTMFSGRVIGTYTPEQYADCVREARANRHRWGMGQW* |
Ga0114981_105891531 | 3300009160 | Freshwater Lake | MILAQLLSMFSARVIGTYTPDQYAQQVIIARNNRMRWGMGQW* |
Ga0114966_103705132 | 3300009161 | Freshwater Lake | VSLQDLLAMFSARIIGTYTPEQYAEQVIIARNNRMRWGIGQW* |
Ga0114970_100923933 | 3300009163 | Freshwater Lake | VSLADLLTMFCARVIGTYTPEQYADCVREARANRHRWGMGQW* |
Ga0114979_103456942 | 3300009180 | Freshwater Lake | VSLQELLIMFSGRVIGTYTPEQYANCVREARANRMRWGMGQW* |
Ga0114979_104474673 | 3300009180 | Freshwater Lake | MTLAQVLLMFSARVIGTYTPEQYADCVREARTNRHRWGMG |
Ga0114974_100093936 | 3300009183 | Freshwater Lake | MSLADLLSMFSGRIIGTYTREQYANCVREARANRMRWGMGQW* |
Ga0114974_1002809411 | 3300009183 | Freshwater Lake | VSLADLLAMFSARVIGTYTPVQYAEQVIIARANRMRWGMGQW* |
Ga0114976_103346921 | 3300009184 | Freshwater Lake | VKLLDLLAMFSARIIGTYTPAQYAQQVIIARNNRMR |
Ga0114972_104256314 | 3300009187 | Freshwater Lake | LSMFSARVVGTYTPEQYAQQVIIARNNRMRWGMGQW* |
Ga0114960_103614712 | 3300010158 | Freshwater Lake | VTLQDLLAMFSARVIGTYTPAQYAQQVIIARNNRMRWGMGQW* |
Ga0136644_100376362 | 3300010334 | Freshwater Lake | MSLADLLTMFSAHVIGTYTPEQYAEQVIIARNNRMRWGMGQW* |
Ga0136644_104664861 | 3300010334 | Freshwater Lake | MHRRGEQMSLADLLALFSARVIATYTPEQYANCVREARANRHRWGMGQW* |
Ga0133913_102148375 | 3300010885 | Freshwater Lake | MFSARVIGTYTPEQYADCVKEARANRHRWGMGQW* |
Ga0133913_107223764 | 3300010885 | Freshwater Lake | VTLKDLLSMFSARVVGTYTPEQYALQVIIARNNRMRWGMGQW* |
Ga0133913_109097775 | 3300010885 | Freshwater Lake | MHRRGEQMTLAQLLTMFSARIIGTYTPAQYSQQVIIARNNRMRWGMGQW* |
Ga0133913_110912345 | 3300010885 | Freshwater Lake | MFSARVIGTYTPEQYAEQIIIARNNRMRWGMGQW* |
Ga0133913_111113113 | 3300010885 | Freshwater Lake | VSLADLLSMFSARVIGTYTPEQYANCVREARANRMRWGIGQW* |
Ga0151515_1087222 | 3300011114 | Freshwater | VTLQKLLTMFSARVIGTYTPAQYAQQVIIARKNRMRWGMGQW* |
Ga0153799_10148065 | 3300012012 | Freshwater | VSLQDLLTMFSARVIGTYTPEQYANCVREARANRMRWGMGQW* |
Ga0153799_10217602 | 3300012012 | Freshwater | VSLADLLTMFSARVIGTYTPEQYADCVREARANRHRWGMGQW* |
Ga0153805_10765971 | 3300012013 | Surface Ice | VSLQDLLTMFAGRVIGTYTPEQYANAVRVARADRMRWGM |
Ga0157550_12310681 | 3300012710 | Freshwater | VSLRDLLTMFSARVIGTYTPEQYADCVREARANRMRWGMGQW* |
Ga0164293_102908243 | 3300013004 | Freshwater | MSLADLLTMFSARVIGTYTPEQYADCVREARANRHRWGMGQW* |
Ga0164292_102664404 | 3300013005 | Freshwater | TMFSARVIGTYTPEQYADCVREARANRHRWGMGQW* |
Ga0177922_107277132 | 3300013372 | Freshwater | MFSGRVIGTYTPEQYANCVREARANRMRWGMGQW* |
Ga0177922_112973934 | 3300013372 | Freshwater | MIKKLLIMFDAKIIGTYTPEQYADAVTAARANRHRWGMGQW* |
Ga0177922_113306613 | 3300013372 | Freshwater | VSLQELLTMFSARVVGTYTPEQYANCVREARANRMRWGMGQW* |
Ga0181364_10093133 | 3300017701 | Freshwater Lake | MNISDLLIMFSARVIGTYTPEQYANCVLEARANRMRWGMGQW |
Ga0181364_10171625 | 3300017701 | Freshwater Lake | MKGKSMTFKQLLIMFSARVIGTYTPKQYADCVREARANRMRWGMGQW |
Ga0181364_10297463 | 3300017701 | Freshwater Lake | VNLADLLTMFSGRIIGTYTPEQYANCVREARANRMRWGMGQW |
Ga0181364_10738812 | 3300017701 | Freshwater Lake | KMIITMFSARIIGTYTPEQYAHCVREARANRHRWGMGQW |
Ga0181364_10763341 | 3300017701 | Freshwater Lake | LLSMFSGRVIGTYTPEQYANCVREARANRMRWGLGQW |
Ga0181356_11049172 | 3300017761 | Freshwater Lake | MSLADLLTMFSGRIICTYTPEQYANCVREARANRMRWGMGQWCS |
Ga0181356_11270803 | 3300017761 | Freshwater Lake | MSLADLLTMFSGRIIGTYTPDQYASCVLEARANRMRWGMGQW |
Ga0181356_11856582 | 3300017761 | Freshwater Lake | MIKKLLIMFHAKIIGTYTPEQYANAVREARANRMRWGMGQW |
Ga0181356_11990542 | 3300017761 | Freshwater Lake | VSLQELLTMFSGRIIGTYTPEQYADCVREARANRMRWGLGQW |
Ga0181358_10427523 | 3300017774 | Freshwater Lake | MTFKQLLIMFSARVIGTYTPEQYADCVREARANRMRWGMGQW |
Ga0181358_10972462 | 3300017774 | Freshwater Lake | MSLADLLTMFSGRIICTYTPEQYANCVREARANRMRWGMGQW |
Ga0181349_12903682 | 3300017778 | Freshwater Lake | MIKKLLIMFHAKIIGTYTPEQYANAVREARANRMRWGMGQ |
Ga0181348_12978731 | 3300017784 | Freshwater Lake | QELLTMFSGRVIGTYTPEQYANCVREARANRMRWGMGQW |
Ga0181355_13152642 | 3300017785 | Freshwater Lake | MNISDLLTMFSARIIGTYTPEQYANCVLEARANRMRWGMGQW |
Ga0187842_10341004 | 3300018790 | Freshwater | VSLSDLLTMFSARVICTYTPEQYANCVREARANRMRWGMGQW |
Ga0187842_10873812 | 3300018790 | Freshwater | VCQKFRMTLSQLITFFDARVIGTYTPEQYANCVREARANRMRWGMGQW |
Ga0187845_10047406 | 3300018815 | Freshwater | VSLQDLLTMFSGRVIGTYTPQQYADCVREARANRHRWGMGQW |
Ga0187844_100220582 | 3300018868 | Freshwater | VNLADLLIMFSGRVVGTYTPEQYANCVREARANRMRWGMGQW |
Ga0187844_100773374 | 3300018868 | Freshwater | MTLSQLITFFDARVIGTYTPEQYANCVREARANRMRWGMGQW |
Ga0187844_101582813 | 3300018868 | Freshwater | VSLQDLLTMFSARVIGTYTPEQYANCVREARANRMRWGIRQW |
Ga0187844_102230691 | 3300018868 | Freshwater | MSLPDLLTFFSGRIIGTYTPEQYANCVREARANRMRWGMGQW |
Ga0181359_10027354 | 3300019784 | Freshwater Lake | VSLQELLTMFSGRIIGTYTPEQYANCVREARANRMRWGMGQW |
Ga0181359_10063983 | 3300019784 | Freshwater Lake | MTFKQLLIMFSARVIGTYTPKQYADCVREARANRMRWGMGQW |
Ga0181359_10115425 | 3300019784 | Freshwater Lake | MNISDLLIMFSGRVIGTYTPEQYANCVLEARANRMRWGMGQW |
Ga0181359_10119975 | 3300019784 | Freshwater Lake | VSLADLLTMFSARVIGTYTPEQYASCVLEARANRMRWGMGQW |
Ga0181359_10205306 | 3300019784 | Freshwater Lake | MSLADLLTMFSGRIIGTYTPEQYANCVREARANRMRWGMGQW |
Ga0181359_10395884 | 3300019784 | Freshwater Lake | VSLQELLTMFSARVVGTYTPEQYANCVREARANRMRWGMGQW |
Ga0181359_10980423 | 3300019784 | Freshwater Lake | MSLADLLTMFSGRIIGTYTPEQYADCVREARANRMRWGMGQW |
Ga0181359_11005984 | 3300019784 | Freshwater Lake | VNLADLLIMFSGRVIGTYTLEQYAKCVREARANRMRWGMGQW |
Ga0181359_11283811 | 3300019784 | Freshwater Lake | LMKGKSMTFKQLLIMFSARVIGTYTPEQYANCVREARANRMRWGMGQW |
Ga0181359_11469292 | 3300019784 | Freshwater Lake | LQELLTMFSGRVIGTYTPEQYANCVREARANRMRWGMGQW |
Ga0181359_11743482 | 3300019784 | Freshwater Lake | VSLQDLLTMFFGRIIGTYTPEQYADCVREARANRMRWGMGQW |
Ga0181359_11870473 | 3300019784 | Freshwater Lake | KGKSMTFKQLLIMFSARVIGTYTPEQYADCVREARANRMRWGMGQW |
Ga0181359_12282873 | 3300019784 | Freshwater Lake | VSLADLLTMFSGRVIGTYTPEQYANCVLEARANRMRWGMGQW |
Ga0181359_12563912 | 3300019784 | Freshwater Lake | VSLQELLTMFSARIIGTYTPEQYANCVREARANRMRWGMGQW |
Ga0208364_10145532 | 3300020533 | Freshwater | MTLAQVLLMFSARVICTYTPEQYADCVREARANRHRWGMGQW |
Ga0222713_1001128013 | 3300021962 | Estuarine Water | VSLQDLLAMFEGKVIGTYTLEQYAEQVIVARNNRMRWGMGQW |
Ga0222712_100014917 | 3300021963 | Estuarine Water | MSLVDLLTMFSARVICTYTPEQYADCVREARANRHRWGMGQW |
Ga0222712_101335714 | 3300021963 | Estuarine Water | KLIELFNARIIGTYTPAQYAQQVIIARNNRMRWGMGQW |
Ga0181354_10128983 | 3300022190 | Freshwater Lake | VSLQELLTMFSGRVIGTYTPEQYANCVLEARANRMRWGMGQW |
Ga0181354_10148903 | 3300022190 | Freshwater Lake | MTFKQLLIMFSARVIGTYTLKQYADCVREARANRMRWGMGQW |
Ga0181354_10441134 | 3300022190 | Freshwater Lake | MIEKLLIMFDAKIIGTYTPEQYAEQVIVARNNRMRWGMGQW |
Ga0181354_10446045 | 3300022190 | Freshwater Lake | VSLQDLLTMFFGRVIGTYTPEQYADCVREARANRMRWGMGQW |
Ga0181354_10725445 | 3300022190 | Freshwater Lake | VSLQDLLTMFFGRVIGTYTPEQYANCVREARANRMRWGMGQW |
Ga0181354_11323731 | 3300022190 | Freshwater Lake | MILMKGKSMTFKQLLIMFSARVIGTYTPEQYADCVREARANRMRWGMGQW |
Ga0181351_12163474 | 3300022407 | Freshwater Lake | LTMFSARVIGTYTPEQYANCVREARANRMRWGMGQW |
Ga0228702_100457615 | 3300022748 | Freshwater | VTLRDLLTMFSARVIGTYTPAQYAQQVIIARNNRMRWGIGQW |
Ga0214917_1001322713 | 3300022752 | Freshwater | MILMKGKSMTFKQLLIMFSARVIGTYTPAQYAQQVIIARNNRMRWGMGQW |
Ga0214917_100196085 | 3300022752 | Freshwater | VSLQELLTMFSGRIIGTYTPEQYADCVREARANRHRWGMGQW |
Ga0214917_100222723 | 3300022752 | Freshwater | VTLKDLLSMFSARVIGTYTPAQYAEQVIIARNNRMRWGMGQW |
Ga0214917_100271073 | 3300022752 | Freshwater | VSLQDLLTMFSARVIGTYTPEQYAQQVIIARSNRMRWGMGQW |
Ga0214917_100555904 | 3300022752 | Freshwater | VSLADLLTMFSARIIGTYTPEQYADCVREARANRHRWGMGQW |
Ga0214917_100633915 | 3300022752 | Freshwater | VSLAELLIMFSARVIGTYTPEQYADCVREARANRHRWGMGQW |
Ga0214917_101157601 | 3300022752 | Freshwater | VSLTDLLTMFSARIICTYTPEQYANCVLEARANRHRWGMGQW |
Ga0214921_1000246542 | 3300023174 | Freshwater | MTLAQLLSMFSARIIGTYTPEQYANCVQEARANRMRWGMGQW |
Ga0214921_100101465 | 3300023174 | Freshwater | VSLQDLLIMFSARVIGTYTPEQYADCVREARANRMRWGMGQW |
Ga0214921_100181345 | 3300023174 | Freshwater | VSLQDLLTMFSGRVIGTYTPEQYANCVREARANRMRWGMGQW |
Ga0214921_100787305 | 3300023174 | Freshwater | VTFKQLLAFFSARVIGTYTPEQYADCVREARANRMRWGMGQW |
Ga0214921_100860284 | 3300023174 | Freshwater | MTLADFLTMFSARVIGTYTPEQYAEQVIIARNNRMRWGIGQW |
Ga0214923_100983323 | 3300023179 | Freshwater | MNLQELIVFFSARIIGTYTPEQYAECVREARANRMRWGIGQW |
Ga0209864_10318894 | 3300027547 | Sand | SLQHLLTMFAGRVIGTYTPEQYANAVLTARADRMRWGMGQW |
Ga0208974_100014011 | 3300027608 | Freshwater Lentic | VSLQDILAMFSARVIGTYTPEQYAEQVIIARNNRMRWGMGQW |
Ga0208974_10123446 | 3300027608 | Freshwater Lentic | VSLQELLTMFSGRVIGTYTREQYASCVREARANRMRWGMGQW |
Ga0208974_10662792 | 3300027608 | Freshwater Lentic | MSLADLLTMFSARVIGTYTPEQYANCVREARANRMRWGMGQW |
Ga0209357_11891422 | 3300027656 | Freshwater Lake | AVAEGGAVSLQELLTMFSGRVIGTYTPEQYANCVLEARANRMRWGMGQW |
Ga0208975_10300705 | 3300027659 | Freshwater Lentic | VSLQDLLAMFSGRVIGTYTPEQYANCVREARANRMRWGMGQW |
(restricted) Ga0247836_11750172 | 3300027728 | Freshwater | VSLADLLVMFSARVIGRYTPAQYARNVLIARADRWRWGIGQW |
(restricted) Ga0247833_10279405 | 3300027730 | Freshwater | VSLADLLVMFSARIVGRYTPEQYAEQVIVARNNRMRWGMGQW |
Ga0209087_10031137 | 3300027734 | Freshwater Lake | MTLSQLITFFDARIIGTYTPEQYASCVLEARANRMRWGMGQW |
Ga0209087_10501493 | 3300027734 | Freshwater Lake | VKLLDLLAMFSARIIGTYTPAQYAQQVIIARNNRMRWGMGQW |
Ga0209087_10604976 | 3300027734 | Freshwater Lake | VNLADLLTMFSARVIGTYTLEQYAEQVIIARANRMRWGIGQW |
Ga0209190_10018825 | 3300027736 | Freshwater Lake | VTLRDLLSMFSARVIGTYTPAQYAQQVIIARNNRMRWGMGQW |
Ga0209190_101022912 | 3300027736 | Freshwater Lake | VTLRDLLAMFSARVIGTYTPDQYDQQVIIARANRMRWGMGQW |
Ga0209190_10154984 | 3300027736 | Freshwater Lake | VTLRDLLTMFSARVIGTYTPAQYAQQVIIARNNRMRWGMGQW |
Ga0209190_12310984 | 3300027736 | Freshwater Lake | GAAAKGGAVSLADLLTMFSARIIGTYTPEQYANCVREARANRHRWGMGQW |
Ga0209085_100090031 | 3300027741 | Freshwater Lake | VSLQDLLTMFSARVIGTYTPEQYANCVREARANRMRWGIGQW |
Ga0209085_100320712 | 3300027741 | Freshwater Lake | VTLPDLLAMFSARVIGTYTPAQYDQQVIIARNNRMRWGMGQW |
Ga0209085_10110513 | 3300027741 | Freshwater Lake | MTLAQLLSMFSARVIGTYTPAQYAQQVIIARNNRMRWGMGQW |
Ga0209085_10209144 | 3300027741 | Freshwater Lake | VTLKDLLSMFSARVIGTYTPAQYAEQVIIARGNRMRWGMGQW |
Ga0209085_10325545 | 3300027741 | Freshwater Lake | VTLRDLLCMFSARVIGTYTPAQYAQQVIIARNNRMRWGMGQW |
Ga0209085_12902413 | 3300027741 | Freshwater Lake | MKGKSMTFKQLLIMFSARIIGTYTPSQYAQQVIIARNNRMRWGMGQW |
Ga0209189_10645693 | 3300027747 | Freshwater Lake | MSLADLLTMFSAHVIGTYTPEQYAEQVIIARNNRMRWGMGQW |
Ga0209189_11225182 | 3300027747 | Freshwater Lake | MTLAQLLTMFSARIIGTYTPAQYSQQVIIARNNRMRWGMGQW |
Ga0209189_12654471 | 3300027747 | Freshwater Lake | MHRRGEQMSLADLLALFSARVIATYTPEQYANCVREARANRHRWGMGQW |
Ga0209084_12506581 | 3300027749 | Freshwater Lake | TLRDLLTMFSARVIGTYTPAQYAQQVIIARNNRMRWGMGQW |
Ga0209596_12691643 | 3300027754 | Freshwater Lake | VSLQELLTMFSGRVIGTYTPKQYANCVREARANRMRWGMGQW |
Ga0209296_10071083 | 3300027759 | Freshwater Lake | VSLADLLAMFSARVIGTYTPVQYAEQVIIARANRMRWGMGQW |
Ga0209296_10198133 | 3300027759 | Freshwater Lake | MSLADLLSMFSGRIIGTYTREQYANCVREARANRMRWGMGQW |
Ga0209296_11537612 | 3300027759 | Freshwater Lake | VSLADLLIMFSARVIGTYTPEQYADCVREARANRHRWGMGQW |
Ga0209598_101053975 | 3300027760 | Freshwater Lake | MSLSDLLTMFSGRVICTYTPEQYANCVREARANRMRWGMGQW |
Ga0209088_100042984 | 3300027763 | Freshwater Lake | MSLADLLTMFSGRVIGTYTPEQYADCVREARANRHRWGMGQW |
Ga0209088_100547891 | 3300027763 | Freshwater Lake | WKGVRRNKMTLAQVLLMFSARVIGTYTPEQYANCVREARANRMRWGMGQW |
Ga0209088_101612884 | 3300027763 | Freshwater Lake | DLLTMFSARVIGTYTPEQYAEQVIIARNNRMRWGMGQW |
Ga0209086_100681464 | 3300027770 | Freshwater Lake | VSLQDLLAMFSARIIGTYTPEQYAEQVIIARNNRMRWGIGQW |
Ga0209500_1000588913 | 3300027782 | Freshwater Lake | MTLAQVLLMFSARVIGTYTPEQYAEQVIIARNNRMRWGMGQW |
Ga0209500_100158093 | 3300027782 | Freshwater Lake | MSLQELLTMFSARVIGTYTPEQYANCVREARANRMRWGMGQW |
Ga0209500_101901632 | 3300027782 | Freshwater Lake | VNLQDLLTMFSARVIGTYTPEQYAEQVIIARNNRMRWGMGQW |
Ga0209400_10014169 | 3300027963 | Freshwater Lake | VTLLDLLAMFSARIIGTYTPAQYAQQVIIARNNRMRWGMGQW |
Ga0209400_100173431 | 3300027963 | Freshwater Lake | VTLLDLLAMFSARVIGTYTPAQYAQQVIIARNNRMRWGMGQW |
Ga0209400_10086477 | 3300027963 | Freshwater Lake | VSLQELLSMFSGRIIGTYTPEQYANCVREARANRMRWGMGQW |
Ga0209400_11117484 | 3300027963 | Freshwater Lake | VTLLDLLAMFSARIIGTYTSAQYAQQVIIAQNNRMRWGMGQW |
Ga0209191_100475312 | 3300027969 | Freshwater Lake | VCQKFRMTLSQLITFFDARIIGTYTPEQYASCVLEARANRMRWGMGQW |
Ga0209191_12103651 | 3300027969 | Freshwater Lake | VSLADLLAMFSARVIGTYTPVQYAEQVIIARANRMRW |
(restricted) Ga0247837_11592423 | 3300027970 | Freshwater | MSLADLLTMFSARIVGRYTPAQYARNVLIARADRWRWGIGQW |
Ga0209401_100034446 | 3300027971 | Freshwater Lake | VSLADLLAMFSARIIGTYTPEQYAEQVIIARNNRMRWGMGQW |
Ga0209401_100393515 | 3300027971 | Freshwater Lake | VTLLDLLAMFSARIIGTYTPAQYAQQVIIAQNNRMRWGMGQW |
Ga0209401_10076278 | 3300027971 | Freshwater Lake | MSLSDLLIMFSARVIGTYTPKQYANCVREARANRMRWGMGQW |
Ga0209401_10078847 | 3300027971 | Freshwater Lake | VTLKDLLSMFSARVVGTYTPEQYAQQVIIARNNRMRWGMGQW |
Ga0209401_10115545 | 3300027971 | Freshwater Lake | MTLAQLLAMFSARVIGTYTPAQYAQQVIIARNNRMRWGMGQW |
Ga0209401_10364003 | 3300027971 | Freshwater Lake | VTLQDLLTMFSARVIGTYTPEQYANCVREARANRMRWGMGQW |
Ga0209401_10543644 | 3300027971 | Freshwater Lake | MILAQLLSMFSARVIGTYTPAQYAKQVIIARNNRMRWGIGQW |
Ga0209401_10861335 | 3300027971 | Freshwater Lake | VTLRDLLAMFSARVIGTYTPTQYAQQVIIARNNRMRWGMGQW |
Ga0209298_100224111 | 3300027973 | Freshwater Lake | MTLAQVLLMFSARVIGTYTPEQYANCVREARANRMRWGMGQW |
Ga0209299_10140611 | 3300027974 | Freshwater Lake | FEMILAMFAARVICTYTPEQYADCVREARANRHRWGMGQW |
(restricted) Ga0247839_11085341 | 3300028553 | Freshwater | ADLLVMFSARVIGRYTPAQYARNVLIARADRWRWGIGQW |
(restricted) Ga0247840_102877323 | 3300028581 | Freshwater | SLADLLVMFSARIVGRYTPAQYARNVLIARADRWRWGIGQW |
(restricted) Ga0247842_103766953 | 3300029268 | Freshwater | SLADLLTMFSARIVGRYTPAQYARNVLIARADRWRWGIGQW |
Ga0307376_100980285 | 3300031578 | Soil | VSLDQLIEFFDARVIGTYTPEQYAEQVIIARNNRMRWGMGQW |
Ga0307376_103104094 | 3300031578 | Soil | VSLADLLVMFSARIVARYTPEQYAQQVIVARNNRMRWGIGQW |
Ga0307377_111074902 | 3300031673 | Soil | VVSLQDLLTMFSARVIGTYTPEQYAQQVIIARNNRMRWGMGQW |
Ga0315291_104047106 | 3300031707 | Sediment | AAAEGGAVSLQDLLTMFSARVIGTYTPEQYANAVLTARADRMRWGMGQW |
Ga0315291_106847471 | 3300031707 | Sediment | VSLQDLLTMFAGRVIGTYTLEQYANCVREARANRMRWGMGQW |
Ga0315297_104811071 | 3300031873 | Sediment | AAEGGAVSLQDLLTMFAGRVIGTYTPDQYANAVLTARADRMRWGMGQW |
Ga0315294_109405542 | 3300031952 | Sediment | VSLQDLLTMFAGRVIGTYTPDQYANCVREARANRMRWGMGQW |
Ga0315272_106673862 | 3300032018 | Sediment | VSLQDLLTMFSARIIGTYTPEQYADCVREARANRMRWGMGQW |
Ga0315905_100265586 | 3300032092 | Freshwater | VSLQELLTMFSGRIIGTYTPEQYADCVREARANRMRWGMGQW |
Ga0315277_112908041 | 3300032118 | Sediment | VSLQDLLTMFSARVIGTYTPEQYADCVREARANRMRWGMGQW |
Ga0315295_104174453 | 3300032156 | Sediment | DLLTMFAGRVIGTYTLEQYANAVRVARADRMRWGMGQW |
Ga0315271_109567483 | 3300032256 | Sediment | MIKKLLIMFDAKIIGTYTPEQYANAVREARANRMRWGMGQW |
Ga0334982_0077653_880_1008 | 3300033981 | Freshwater | MSLQELLTMFSARVIGTYTPEEYANCVREARANRMRWGMGQW |
Ga0335002_0056469_2690_2806 | 3300034020 | Freshwater | MSLADLLAMFSACVIGIYTPEQYADCVREARANRHRWGM |
⦗Top⦘ |