Metagenome Family F020808

Basic Information
Family ID	F020808
Family Type	Metagenome
Number of Sequences	222
Average Sequence Length	47 residues
Representative Sequence	LNRDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERFENGSDM
Number of Associated Samples	22
Number of Associated Scaffolds	222

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	47.55 %
% of genes near scaffold ends (potentially truncated)	46.40 %
% of genes from short scaffolds (< 2000 bps)	76.58 %
Associated GOLD sequencing projects	12
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.28

Most Common Taxonomy
Group	Bacteria (52.252 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Annelida → Digestive System → Unclassified → Unclassified → Marine Gutless Worms Symbiont (64.414 % of family members)
Environment Ontology (ENVO)	Unclassified (100.000 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Animal → Animal proximal gut (100.000 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 32.88% β-sheet: 0.00% Coil/Unstructured: 67.12%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 222 Family Scaffolds
PF00078	RVT_1	1.80
PF02995	DUF229	0.45
PF16529	Ge1_WD40	0.45
PF01591	6PF2K	0.45
PF16521	Myosin-VI_CBD	0.45
PF06424	PRP1_N	0.45
PF14529	Exo_endo_phos_2	0.45
PF16347	DUF4976	0.45

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	56.76 %
Unclassified	root	N/A	43.24 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	55.41 %
Unclassified	root	N/A	43.24 %
Viruses	superkingdom	All Organisms → Viruses	1.35 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	52.25 %
Unclassified	root	N/A	43.24 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	3.15 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.35 %

Name	Rank	Taxonomy	Distribution
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	52.25 %
Unclassified	root	N/A	43.24 %
Opisthokonta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1.80 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.35 %

Name	Rank	Taxonomy	Distribution
Bacteroidetes/Chlorobi group	clade	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group	52.25 %
Unclassified	root	N/A	43.24 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.35 %
Metazoa	kingdom	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa	0.90 %

Name	Rank	Taxonomy	Distribution
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	52.25 %
Unclassified	root	N/A	43.24 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.35 %
Eumetazoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa	0.90 %

Name	Rank	Taxonomy	Distribution
Cytophagia	class	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia	52.25 %
Unclassified	root	N/A	43.24 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.35 %
Bilateria	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria	0.90 %

Name	Rank	Taxonomy	Distribution
Cytophagales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales	52.25 %
Unclassified	root	N/A	43.24 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.35 %
Protostomia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia	0.45 %
Deuterostomia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia	0.45 %

Name	Rank	Taxonomy	Distribution
Cytophagaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae	52.25 %
Unclassified	root	N/A	43.24 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.35 %
Ecdysozoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa	0.45 %
Chordata	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata	0.45 %

Name	Rank	Taxonomy	Distribution
Candidatus Nephrothrix	genus	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix	52.25 %
Unclassified	root	N/A	43.24 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.35 %
Craniata	subphylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata	0.45 %
Nematoda	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda	0.45 %

Name	Rank	Taxonomy	Distribution
unclassified Candidatus Nephrothrix	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix	52.25 %
Unclassified	root	N/A	43.24 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.35 %
Chromadorea	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea	0.45 %
Vertebrata	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata	0.45 %

Name	Rank	Taxonomy	Distribution
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	52.25 %
Unclassified	root	N/A	43.24 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.35 %
Strongylida	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Strongylida	0.45 %
Gnathostomata	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata	0.45 %

Name	Rank	Taxonomy	Distribution
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	52.25 %
Unclassified	root	N/A	43.24 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.35 %
Teleostomi	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi	0.45 %
Strongylida	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Strongylida	0.45 %

Name	Rank	Taxonomy	Distribution
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	52.25 %
Unclassified	root	N/A	43.24 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.35 %
Euteleostomi	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi	0.45 %
Strongylida	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Strongylida	0.45 %

Name	Rank	Taxonomy	Distribution
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	52.25 %
Unclassified	root	N/A	43.24 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.35 %
Actinopterygii	superclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii	0.45 %
Strongylida	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Strongylida	0.45 %

Name	Rank	Taxonomy	Distribution
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	52.25 %
Unclassified	root	N/A	43.24 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.35 %
Actinopteri	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri	0.45 %
Strongylida	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Strongylida	0.45 %

Name	Rank	Taxonomy	Distribution
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	52.25 %
Unclassified	root	N/A	43.24 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.35 %
Neopterygii	subclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii	0.45 %
Strongylida	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Strongylida	0.45 %

Name	Rank	Taxonomy	Distribution
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	52.25 %
Unclassified	root	N/A	43.24 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.35 %
Teleostei	infraclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei	0.45 %
Strongylida	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Strongylida	0.45 %

Name	Rank	Taxonomy	Distribution
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	52.25 %
Unclassified	root	N/A	43.24 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.35 %
Osteoglossocephalai	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei → Osteoglossocephalai	0.45 %
Strongylida	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Strongylida	0.45 %

Name	Rank	Taxonomy	Distribution
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	52.25 %
Unclassified	root	N/A	43.24 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.35 %
Clupeocephala	no rank	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei → Osteoglossocephalai → Clupeocephala	0.45 %
Strongylida	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Strongylida	0.45 %

Name	Rank	Taxonomy	Distribution
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	52.25 %
Unclassified	root	N/A	43.24 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.35 %
Otomorpha	cohort	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei → Osteoglossocephalai → Clupeocephala → Otomorpha	0.45 %
Strongylida	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Strongylida	0.45 %

Name	Rank	Taxonomy	Distribution
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	52.25 %
Unclassified	root	N/A	43.24 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.35 %
Ostariophysi	subcohort	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei → Osteoglossocephalai → Clupeocephala → Otomorpha → Ostariophysi	0.45 %
Strongylida	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Strongylida	0.45 %

Name	Rank	Taxonomy	Distribution
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	52.25 %
Unclassified	root	N/A	43.24 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.35 %
Otophysi	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei → Osteoglossocephalai → Clupeocephala → Otomorpha → Ostariophysi → Otophysi	0.45 %
Strongylida	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Strongylida	0.45 %

Name	Rank	Taxonomy	Distribution
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	52.25 %
Unclassified	root	N/A	43.24 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.35 %
Cypriniphysae	superorder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei → Osteoglossocephalai → Clupeocephala → Otomorpha → Ostariophysi → Otophysi → Cypriniphysae	0.45 %
Strongylida	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Strongylida	0.45 %

Name	Rank	Taxonomy	Distribution
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	52.25 %
Unclassified	root	N/A	43.24 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.35 %
Cypriniformes	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei → Osteoglossocephalai → Clupeocephala → Otomorpha → Ostariophysi → Otophysi → Cypriniphysae → Cypriniformes	0.45 %
Strongylida	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Strongylida	0.45 %

Name	Rank	Taxonomy	Distribution
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	52.25 %
Unclassified	root	N/A	43.24 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.35 %
Cyprinoidei	suborder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei → Osteoglossocephalai → Clupeocephala → Otomorpha → Ostariophysi → Otophysi → Cypriniphysae → Cypriniformes → Cyprinoidei	0.45 %
Strongylida	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Strongylida	0.45 %

Name	Rank	Taxonomy	Distribution
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	52.25 %
Unclassified	root	N/A	43.24 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.35 %
Cyprinidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei → Osteoglossocephalai → Clupeocephala → Otomorpha → Ostariophysi → Otophysi → Cypriniphysae → Cypriniformes → Cyprinoidei → Cyprinidae	0.45 %
Strongylida	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Strongylida	0.45 %

Name	Rank	Taxonomy	Distribution
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	52.25 %
Unclassified	root	N/A	43.24 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.35 %
Acrossocheilinae	subfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei → Osteoglossocephalai → Clupeocephala → Otomorpha → Ostariophysi → Otophysi → Cypriniphysae → Cypriniformes → Cyprinoidei → Cyprinidae → Acrossocheilinae	0.45 %
Strongylida	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Strongylida	0.45 %

Name	Rank	Taxonomy	Distribution
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	52.25 %
Unclassified	root	N/A	43.24 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.35 %
Onychostoma	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei → Osteoglossocephalai → Clupeocephala → Otomorpha → Ostariophysi → Otophysi → Cypriniphysae → Cypriniformes → Cyprinoidei → Cyprinidae → Acrossocheilinae → Onychostoma	0.45 %
Strongylida	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Strongylida	0.45 %

Name	Rank	Taxonomy	Distribution
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	52.25 %
Unclassified	root	N/A	43.24 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.35 %
Onychostoma macrolepis	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei → Osteoglossocephalai → Clupeocephala → Otomorpha → Ostariophysi → Otophysi → Cypriniphysae → Cypriniformes → Cyprinoidei → Cyprinidae → Acrossocheilinae → Onychostoma → Onychostoma macrolepis	0.45 %
Strongylida	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Strongylida	0.45 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300001734\|JGI24668J20090_10010110	Not Available	1853	Open in IMG/M
3300001734\|JGI24668J20090_10053176	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	981	Open in IMG/M
3300001734\|JGI24668J20090_10070733	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	879	Open in IMG/M
3300001734\|JGI24668J20090_10097806	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	772	Open in IMG/M
3300001734\|JGI24668J20090_10129507	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	688	Open in IMG/M
3300001734\|JGI24668J20090_10147195	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	651	Open in IMG/M
3300001734\|JGI24668J20090_10151488	Not Available	643	Open in IMG/M
3300001734\|JGI24668J20090_10164149	Not Available	621	Open in IMG/M
3300001734\|JGI24668J20090_10178620	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	598	Open in IMG/M
3300001734\|JGI24668J20090_10201061	Not Available	567	Open in IMG/M
3300001734\|JGI24668J20090_10205122	Not Available	562	Open in IMG/M
3300001734\|JGI24668J20090_10224609	Not Available	539	Open in IMG/M
3300001734\|JGI24668J20090_10258539	Not Available	504	Open in IMG/M
3300001741\|JGI24671J20093_10055858	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	853	Open in IMG/M
3300001741\|JGI24671J20093_10125913	Not Available	634	Open in IMG/M
3300001741\|JGI24671J20093_10224634	Not Available	501	Open in IMG/M
3300001742\|JGI24673J20094_10035715	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1125	Open in IMG/M
3300001742\|JGI24673J20094_10153300	Not Available	645	Open in IMG/M
3300001742\|JGI24673J20094_10166686	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	622	Open in IMG/M
3300001742\|JGI24673J20094_10188793	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	589	Open in IMG/M
3300001742\|JGI24673J20094_10199635	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	575	Open in IMG/M
3300001742\|JGI24673J20094_10210067	Not Available	562	Open in IMG/M
3300001742\|JGI24673J20094_10227037	Not Available	542	Open in IMG/M
3300001744\|JGI24669J20092_10022143	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1073	Open in IMG/M
3300001744\|JGI24669J20092_10049413	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	804	Open in IMG/M
3300001744\|JGI24669J20092_10060179	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	750	Open in IMG/M
3300001744\|JGI24669J20092_10072660	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	701	Open in IMG/M
3300001744\|JGI24669J20092_10143895	Not Available	546	Open in IMG/M
3300001744\|JGI24669J20092_10147994	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	540	Open in IMG/M
3300001746\|JGI24672J20091_10022120	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1059	Open in IMG/M
3300001746\|JGI24672J20091_10026262	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	996	Open in IMG/M
3300001746\|JGI24672J20091_10029018	Not Available	960	Open in IMG/M
3300001746\|JGI24672J20091_10041737	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	844	Open in IMG/M
3300001746\|JGI24672J20091_10071806	Not Available	699	Open in IMG/M
3300002181\|JGI24670J26820_11244058	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	546	Open in IMG/M
3300002181\|JGI24670J26820_11252992	Not Available	552	Open in IMG/M
3300002181\|JGI24670J26820_11282870	Not Available	575	Open in IMG/M
3300002181\|JGI24670J26820_11304063	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	593	Open in IMG/M
3300002181\|JGI24670J26820_11372965	Not Available	661	Open in IMG/M
3300002181\|JGI24670J26820_11467166	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	798	Open in IMG/M
3300002181\|JGI24670J26820_11473909	Not Available	811	Open in IMG/M
3300002181\|JGI24670J26820_11487698	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	840	Open in IMG/M
3300002181\|JGI24670J26820_11492642	Not Available	851	Open in IMG/M
3300002181\|JGI24670J26820_11509133	Not Available	891	Open in IMG/M
3300002181\|JGI24670J26820_11540760	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	987	Open in IMG/M
3300002181\|JGI24670J26820_11609867	Not Available	1473	Open in IMG/M
3300002181\|JGI24670J26820_11617775	Not Available	1620	Open in IMG/M
3300003801\|Ga0056138_1007036	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1488	Open in IMG/M
3300003801\|Ga0056138_1014474	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	942	Open in IMG/M
3300003801\|Ga0056138_1068861	Not Available	516	Open in IMG/M
3300003829\|Ga0056137_1019021	Not Available	689	Open in IMG/M
3300004098\|Ga0065184_10048732	All Organisms → cellular organisms → Eukaryota	1523	Open in IMG/M
3300004098\|Ga0065184_10055466	Not Available	1441	Open in IMG/M
3300004098\|Ga0065184_10084975	Not Available	1184	Open in IMG/M
3300004098\|Ga0065184_10092710	Not Available	1135	Open in IMG/M
3300004098\|Ga0065184_10230784	Not Available	678	Open in IMG/M
3300004098\|Ga0065184_10243648	Not Available	655	Open in IMG/M
3300004122\|Ga0065185_10187797	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	765	Open in IMG/M
3300004122\|Ga0065185_10339665	Not Available	530	Open in IMG/M
3300027500\|Ga0209145_1253776	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	544	Open in IMG/M
3300027540\|Ga0209791_1002643	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	4496	Open in IMG/M
3300027540\|Ga0209791_1012026	Not Available	2566	Open in IMG/M
3300027540\|Ga0209791_1026123	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2000	Open in IMG/M
3300027540\|Ga0209791_1031407	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1882	Open in IMG/M
3300027540\|Ga0209791_1078594	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1330	Open in IMG/M
3300027540\|Ga0209791_1088298	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1266	Open in IMG/M
3300027540\|Ga0209791_1156342	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	963	Open in IMG/M
3300027540\|Ga0209791_1210852	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	810	Open in IMG/M
3300027540\|Ga0209791_1263482	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	695	Open in IMG/M
3300027540\|Ga0209791_1292872	Not Available	644	Open in IMG/M
3300027540\|Ga0209791_1309925	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	616	Open in IMG/M
3300027540\|Ga0209791_1349506	Not Available	557	Open in IMG/M
3300027540\|Ga0209791_1392853	Not Available	501	Open in IMG/M
3300027551\|Ga0209338_1000990	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	9065	Open in IMG/M
3300027551\|Ga0209338_1010887	Not Available	4182	Open in IMG/M
3300027551\|Ga0209338_1030311	All Organisms → cellular organisms → Eukaryota → Opisthokonta	2906	Open in IMG/M
3300027551\|Ga0209338_1040948	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2575	Open in IMG/M
3300027551\|Ga0209338_1043559	Not Available	2512	Open in IMG/M
3300027551\|Ga0209338_1047415	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2425	Open in IMG/M
3300027551\|Ga0209338_1088973	All Organisms → Viruses → Predicted Viral	1790	Open in IMG/M
3300027551\|Ga0209338_1143438	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1344	Open in IMG/M
3300027551\|Ga0209338_1159098	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1252	Open in IMG/M
3300027551\|Ga0209338_1165214	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1219	Open in IMG/M
3300027551\|Ga0209338_1166357	Not Available	1213	Open in IMG/M
3300027551\|Ga0209338_1217678	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	990	Open in IMG/M
3300027551\|Ga0209338_1279153	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	793	Open in IMG/M
3300027551\|Ga0209338_1302218	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	729	Open in IMG/M
3300027551\|Ga0209338_1302369	Not Available	729	Open in IMG/M
3300027551\|Ga0209338_1303188	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	727	Open in IMG/M
3300027551\|Ga0209338_1304813	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	722	Open in IMG/M
3300027551\|Ga0209338_1333856	Not Available	653	Open in IMG/M
3300027551\|Ga0209338_1397602	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	520	Open in IMG/M
3300027556\|Ga0209743_1012853	Not Available	2949	Open in IMG/M
3300027556\|Ga0209743_1015217	Not Available	2796	Open in IMG/M
3300027556\|Ga0209743_1021090	Not Available	2514	Open in IMG/M
3300027556\|Ga0209743_1065416	Not Available	1660	Open in IMG/M
3300027556\|Ga0209743_1102447	Not Available	1350	Open in IMG/M
3300027556\|Ga0209743_1136374	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1167	Open in IMG/M
3300027556\|Ga0209743_1141450	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1144	Open in IMG/M
3300027556\|Ga0209743_1196970	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei → Osteoglossocephalai → Clupeocephala → Otomorpha → Ostariophysi → Otophysi → Cypriniphysae → Cypriniformes → Cyprinoidei → Cyprinidae → Acrossocheilinae → Onychostoma → Onychostoma macrolepis	945	Open in IMG/M
3300027556\|Ga0209743_1308873	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	680	Open in IMG/M
3300027556\|Ga0209743_1314480	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	670	Open in IMG/M
3300027564\|Ga0209428_1039246	All Organisms → cellular organisms → Eukaryota → Opisthokonta	2297	Open in IMG/M
3300027564\|Ga0209428_1098282	Not Available	1533	Open in IMG/M
3300027564\|Ga0209428_1127469	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1330	Open in IMG/M
3300027564\|Ga0209428_1164672	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1142	Open in IMG/M
3300027564\|Ga0209428_1206714	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	983	Open in IMG/M
3300027564\|Ga0209428_1211854	Not Available	967	Open in IMG/M
3300027564\|Ga0209428_1270484	Not Available	800	Open in IMG/M
3300027564\|Ga0209428_1283122	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	769	Open in IMG/M
3300027564\|Ga0209428_1364321	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	605	Open in IMG/M
3300027564\|Ga0209428_1397218	Not Available	549	Open in IMG/M
3300027584\|Ga0209637_1027570	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2763	Open in IMG/M
3300027584\|Ga0209637_1078224	Not Available	1791	Open in IMG/M
3300027584\|Ga0209637_1091371	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1661	Open in IMG/M
3300027584\|Ga0209637_1105303	All Organisms → cellular organisms → Eukaryota	1542	Open in IMG/M
3300027584\|Ga0209637_1108496	All Organisms → Viruses → Predicted Viral	1517	Open in IMG/M
3300027584\|Ga0209637_1110759	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1500	Open in IMG/M
3300027584\|Ga0209637_1138131	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1320	Open in IMG/M
3300027584\|Ga0209637_1142947	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1292	Open in IMG/M
3300027584\|Ga0209637_1188880	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1080	Open in IMG/M
3300027584\|Ga0209637_1193299	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1063	Open in IMG/M
3300027584\|Ga0209637_1208646	Not Available	1008	Open in IMG/M
3300027584\|Ga0209637_1270854	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	823	Open in IMG/M
3300027584\|Ga0209637_1274429	Not Available	814	Open in IMG/M
3300027584\|Ga0209637_1306529	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	735	Open in IMG/M
3300027584\|Ga0209637_1310045	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	727	Open in IMG/M
3300027584\|Ga0209637_1321456	Not Available	702	Open in IMG/M
3300027584\|Ga0209637_1360965	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	625	Open in IMG/M
3300027584\|Ga0209637_1381738	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	587	Open in IMG/M
3300027584\|Ga0209637_1408503	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	541	Open in IMG/M
3300027585\|Ga0209150_1004033	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	3772	Open in IMG/M
3300027585\|Ga0209150_1023443	Not Available	2181	Open in IMG/M
3300027585\|Ga0209150_1027830	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2062	Open in IMG/M
3300027585\|Ga0209150_1085633	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1345	Open in IMG/M
3300027585\|Ga0209150_1185100	Not Available	916	Open in IMG/M
3300027585\|Ga0209150_1202994	Not Available	867	Open in IMG/M
3300027585\|Ga0209150_1207669	Not Available	855	Open in IMG/M
3300027585\|Ga0209150_1225827	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	808	Open in IMG/M
3300027585\|Ga0209150_1266750	Not Available	719	Open in IMG/M
3300027585\|Ga0209150_1315978	Not Available	632	Open in IMG/M
3300027585\|Ga0209150_1322495	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	621	Open in IMG/M
3300027585\|Ga0209150_1351100	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	578	Open in IMG/M
3300027585\|Ga0209150_1386762	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	528	Open in IMG/M
3300027585\|Ga0209150_1390794	Not Available	523	Open in IMG/M
3300027613\|Ga0209122_1103087	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1363	Open in IMG/M
3300027613\|Ga0209122_1196172	Not Available	954	Open in IMG/M
3300027613\|Ga0209122_1270381	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	758	Open in IMG/M
3300027613\|Ga0209122_1317520	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	665	Open in IMG/M
3300027613\|Ga0209122_1317770	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	664	Open in IMG/M
3300027613\|Ga0209122_1352247	Not Available	606	Open in IMG/M
3300027613\|Ga0209122_1361852	Not Available	591	Open in IMG/M
3300027613\|Ga0209122_1371612	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	575	Open in IMG/M
3300027613\|Ga0209122_1390449	Not Available	546	Open in IMG/M
3300027613\|Ga0209122_1409427	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	520	Open in IMG/M
3300027613\|Ga0209122_1416180	Not Available	511	Open in IMG/M
3300027620\|Ga0209260_10014685	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1533	Open in IMG/M
3300027620\|Ga0209260_10037862	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1148	Open in IMG/M
3300027620\|Ga0209260_10100908	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	841	Open in IMG/M
3300027620\|Ga0209260_10206620	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	637	Open in IMG/M
3300027626\|Ga0209149_1011096	All Organisms → cellular organisms → Eukaryota	6531	Open in IMG/M
3300027626\|Ga0209149_1013843	Not Available	6029	Open in IMG/M
3300027626\|Ga0209149_1017865	Not Available	5479	Open in IMG/M
3300027626\|Ga0209149_1022678	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	4978	Open in IMG/M
3300027626\|Ga0209149_1035147	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	4102	Open in IMG/M
3300027626\|Ga0209149_1057565	Not Available	3191	Open in IMG/M
3300027626\|Ga0209149_1059122	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	3143	Open in IMG/M
3300027626\|Ga0209149_1059917	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	3118	Open in IMG/M
3300027626\|Ga0209149_1064132	Not Available	3000	Open in IMG/M
3300027626\|Ga0209149_1070692	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2833	Open in IMG/M
3300027626\|Ga0209149_1088702	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2461	Open in IMG/M
3300027626\|Ga0209149_1095754	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2340	Open in IMG/M
3300027626\|Ga0209149_1099435	Not Available	2280	Open in IMG/M
3300027626\|Ga0209149_1126075	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1911	Open in IMG/M
3300027626\|Ga0209149_1126994	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1900	Open in IMG/M
3300027626\|Ga0209149_1132621	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1837	Open in IMG/M
3300027626\|Ga0209149_1138268	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1775	Open in IMG/M
3300027626\|Ga0209149_1148512	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1673	Open in IMG/M
3300027626\|Ga0209149_1157492	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1588	Open in IMG/M
3300027626\|Ga0209149_1160249	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1562	Open in IMG/M
3300027626\|Ga0209149_1160397	Not Available	1560	Open in IMG/M
3300027626\|Ga0209149_1190940	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1316	Open in IMG/M
3300027626\|Ga0209149_1214202	Not Available	1164	Open in IMG/M
3300027626\|Ga0209149_1216176	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1152	Open in IMG/M
3300027626\|Ga0209149_1225127	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1100	Open in IMG/M
3300027626\|Ga0209149_1238451	All Organisms → Viruses → Predicted Viral	1030	Open in IMG/M
3300027626\|Ga0209149_1268458	Not Available	888	Open in IMG/M
3300027626\|Ga0209149_1300735	Not Available	755	Open in IMG/M
3300027626\|Ga0209149_1315590	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	702	Open in IMG/M
3300027626\|Ga0209149_1324920	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	671	Open in IMG/M
3300027626\|Ga0209149_1348683	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	596	Open in IMG/M
3300027632\|Ga0209339_1027570	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	3938	Open in IMG/M
3300027632\|Ga0209339_1062252	Not Available	2692	Open in IMG/M
3300027632\|Ga0209339_1089071	Not Available	2206	Open in IMG/M
3300027632\|Ga0209339_1090217	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2190	Open in IMG/M
3300027632\|Ga0209339_1118419	Not Available	1845	Open in IMG/M
3300027632\|Ga0209339_1152965	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1538	Open in IMG/M
3300027632\|Ga0209339_1175704	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1376	Open in IMG/M
3300027632\|Ga0209339_1218327	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Strongylida	1137	Open in IMG/M
3300027632\|Ga0209339_1298535	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	823	Open in IMG/M
3300027632\|Ga0209339_1317622	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	763	Open in IMG/M
3300027632\|Ga0209339_1328415	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	731	Open in IMG/M
3300027632\|Ga0209339_1377473	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	606	Open in IMG/M
3300027632\|Ga0209339_1418782	Not Available	515	Open in IMG/M

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	100.00%

Habitat	Taxonomy	Distribution
Annelida	Host-Associated → Annelida	100.00%

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
JGI24668J20090_100101104	3300001734	Marine Gutless Worms Symbiont	LNRDQIVKIARFTGCKNFVGNRKKFIVNVFIDLKPVERFENM*
JGI24668J20090_100531763	3300001734	Marine Gutless Worms Symbiont	IVKIARLTGCKNFVSKRKKFIFNAFVDLKPVERCENGSDM*
JGI24668J20090_100707333	3300001734	Marine Gutless Worms Symbiont	LNKDQIVKIARLTGCKNFVGKRKFIFNAFVDLKPVETFKNGSDM*
JGI24668J20090_100978062	3300001734	Marine Gutless Worms Symbiont	LNIYQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVKRFENGSDM*
JGI24668J20090_101295071	3300001734	Marine Gutless Worms Symbiont	VGTARGLNKDQIVKIARLTGCKNFVGKKKKFIFNALVDLKPVERFENGSDM*
JGI24668J20090_101471952	3300001734	Marine Gutless Worms Symbiont	CWRYRAACDQIVKIARLTGCKNFVGKRKKFIFNAFIDLKPVERSENGSDM*
JGI24668J20090_101514881	3300001734	Marine Gutless Worms Symbiont	WARKGHNRRGAGTARELNRDQIVKIARLTGCKKFLGKRKKFIFNAFVDLKPVERFENGSDM*
JGI24668J20090_101641491	3300001734	Marine Gutless Worms Symbiont	QIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERFENGSDM*
JGI24668J20090_101786201	3300001734	Marine Gutless Worms Symbiont	VGTARGLNRDQIVKIARLTGCKKFVGKRKKFIFNAFVDLKPVERF*
JGI24668J20090_102010612	3300001734	Marine Gutless Worms Symbiont	MRSGTVRGLNRDNIVKIAKLTGCKNFVGKRKKFIFNAFVDHKPVERFENGSDI*
JGI24668J20090_102051221	3300001734	Marine Gutless Worms Symbiont	VRGLYRDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERSDNRSDM*
JGI24668J20090_102246091	3300001734	Marine Gutless Worms Symbiont	ISTFTGCKNFVGKRKKFIFNVFVDLKPVEIFENGSDM*
JGI24668J20090_102585391	3300001734	Marine Gutless Worms Symbiont	LKKDQIVKIARLTGCKNFVGKRKKFIFNVFVDLKPVERFENGSDM*
JGI24671J20093_100558581	3300001741	Marine Gutless Worms Symbiont	LNRDKIVKIARLTGYKNFVGKRKKFIFNAFVDLKPVERFENGSDM*
JGI24671J20093_101259133	3300001741	Marine Gutless Worms Symbiont	LNRVQIVKIARLTGCKNFVGKRMKFTFNVFVDLKPVERFENGSDM*
JGI24671J20093_101413442	3300001741	Marine Gutless Worms Symbiont	MRSGYCEDQFVKIARLTGCKNFVGKRKFIFNAFVDLKPVERLENGSDYVRI*
JGI24671J20093_102246342	3300001741	Marine Gutless Worms Symbiont	RGLNRDQIVKIVRLTGCKNFVGKRKKFIFNVFVDLNPAERFKNGSDM*
JGI24673J20094_100357152	3300001742	Marine Gutless Worms Symbiont	LNRDQIVKIARLTGCKNFVSKTKKFIFNAFIDLKPVERFDFENGSDM*
JGI24673J20094_101533002	3300001742	Marine Gutless Worms Symbiont	GLNRDQIVKIARLTGCKNFIGKRKKFIFNAFIDLKPVERFENGSDM*
JGI24673J20094_101666861	3300001742	Marine Gutless Worms Symbiont	LNRDQIVKIARLSGCRNSVGKIKKFIFNAFADLKPVERFENGSDM*
JGI24673J20094_101887933	3300001742	Marine Gutless Worms Symbiont	RGLNKDQIVKIARLTGFKNFVGKRKKFRPILNAFVDLKPVERFDNGSDM*
JGI24673J20094_101996352	3300001742	Marine Gutless Worms Symbiont	DQIVKIARLTGCKNFVSKKKKFIFNAFIDLKPVERFENGSDM*
JGI24673J20094_102100671	3300001742	Marine Gutless Worms Symbiont	LNRDQIVKIAMLTGCKKFVGKRKKFIFNAFVDLKPVERLENWSDNNVRI*
JGI24673J20094_102270371	3300001742	Marine Gutless Worms Symbiont	GLNRDQIVKXXRLTGCKNFVGKRKKFIFSAFVDLKPVERFENGSNH*
JGI24669J20092_100221431	3300001744	Marine Gutless Worms Symbiont	MTRWLVGLNRDQIVKIARLTGCKNFVGKREKFIFNASVDLKPVERSENRSDM*
JGI24669J20092_100494132	3300001744	Marine Gutless Worms Symbiont	LNRDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERXENRSDM*
JGI24669J20092_100601792	3300001744	Marine Gutless Worms Symbiont	VGTARGLNRDQIVKIARLTGCKNFIGKRKKFIFNAFVDLKPVERFENGSDM*
JGI24669J20092_100726601	3300001744	Marine Gutless Worms Symbiont	LNRDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERFENGTDM*
JGI24669J20092_101438951	3300001744	Marine Gutless Worms Symbiont	KIARLTGCKNFVGKRKKFIFNAFVDLKPVERIENGSET*
JGI24669J20092_101479942	3300001744	Marine Gutless Worms Symbiont	VGTARGLNRDQIVKIARLTGCKNFIGKRKKFIFNAFVDLKPVERFEDGWE*
JGI24672J20091_100221202	3300001746	Marine Gutless Worms Symbiont	LNRDQIVKIARLTGCKNFVSKTKKFIFNAFIDFKPVERCDFENGSDM*
JGI24672J20091_100262623	3300001746	Marine Gutless Worms Symbiont	TARGLNRDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERFENGSDM*
JGI24672J20091_100290181	3300001746	Marine Gutless Worms Symbiont	IVKIARLTGCKNFVGKRKKFIFNAFVDLKPVLRSENRSDM*
JGI24672J20091_100417373	3300001746	Marine Gutless Worms Symbiont	GTARGLNRDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVEN*
JGI24672J20091_100718061	3300001746	Marine Gutless Worms Symbiont	LNRDQIVKIAMLTGCKKFVGKRKKFIFNAFVDLKPXERLENWSDNNVRI*
JGI24672J20091_101720532	3300001746	Marine Gutless Worms Symbiont	ARGLNRDKIVKIVRLNGCKNFVGKRKFIFNAFMDLKPVERFENGSDM*
JGI24670J26820_112440581	3300002181	Marine Gutless Worms Symbiont	AGTARGLNRDQIVKIARLTGCKNFVGKRKEFIFNAFVDLKPVERSENRSDM*
JGI24670J26820_112529921	3300002181	Marine Gutless Worms Symbiont	LNRDQIVKIARLTGCKNFVGKRKKFIFNAFVDVKPVERFENRSDMCGFRSLNNST
JGI24670J26820_112828701	3300002181	Marine Gutless Worms Symbiont	LNRDQIVKIARLTGCKNFVGKKKKFIFNAFVDLKPVERFENGSDIVRI*
JGI24670J26820_113040631	3300002181	Marine Gutless Worms Symbiont	RGLNRDHIVQIARLTGCKDFVGKRKKFVFNMFIDLKPVERFENGGDM*
JGI24670J26820_113729652	3300002181	Marine Gutless Worms Symbiont	MKSGLNRDQIVKIAKLTGCKNFVGKRKKFMFSAFIDLKPVERFENGSDM*
JGI24670J26820_114178172	3300002181	Marine Gutless Worms Symbiont	RKGDNRGAGTARGLNRDEIVKIARLTGCQNFIGRSLYSMRSFNFVDLKPVERSENGSDMICEV
JGI24670J26820_114377092	3300002181	Marine Gutless Worms Symbiont	KIARLTGCKNFVGKRKFIFNAFVDLKPVEKFENGSDM*
JGI24670J26820_114652472	3300002181	Marine Gutless Worms Symbiont	MRSGYCEDQFVKIARLTGCKNFVGKRKFIFNAFVHLKPVERLENGSDYVRI*
JGI24670J26820_114671663	3300002181	Marine Gutless Worms Symbiont	ARLTGCKNFVGKRKKFIFNVFVNLKPVERFENGSDM*
JGI24670J26820_114739091	3300002181	Marine Gutless Worms Symbiont	LNRDKIVKIVRLNGCKNFVGKRKFIFNAFMDLKPVERFENGSDM
JGI24670J26820_114876982	3300002181	Marine Gutless Worms Symbiont	AGTARGLNRDQIVKIARLTGCKNFVGKRKKFIFNSFVDLKPLERFENGSDM*
JGI24670J26820_114926422	3300002181	Marine Gutless Worms Symbiont	LNRDQIVKIAMLTGCKKFVGKRKKFIFNAFVDLKPMERLENWSDNNVRI*
JGI24670J26820_115091331	3300002181	Marine Gutless Worms Symbiont	NRDQIVKIARLTGCKNFIGKRKKFIFNAFIDLKPVERFENGSDM*
JGI24670J26820_115407602	3300002181	Marine Gutless Worms Symbiont	LNRDQIVKIARLTGCKNFVSKRKKFIFNAFVDLKPVERFENGGDM*
JGI24670J26820_116098672	3300002181	Marine Gutless Worms Symbiont	LNRDQIVKIARLTGCENFVGKRKKFIFNAFVDLKPVERFENGSDM*
JGI24670J26820_116177754	3300002181	Marine Gutless Worms Symbiont	MMSGYCEGLDRDQIVKIAGLTGCKNFVGKRKKFIFNAFVDLKPVERFGNRSDM*
Ga0056138_10070361	3300003801	Marine Gutless Worms Symbiont	VGTARGLNKDQIVKIARLTGCKNFVGKRKKFIFNALVDLKPVERFENGSDM*
Ga0056138_10144741	3300003801	Marine Gutless Worms Symbiont	MRSGYCVGLNRDQVVKIARLTGCKNFVGKRKKFIFNAFVDLTPVEKIENGSDM*
Ga0056138_10688612	3300003801	Marine Gutless Worms Symbiont	LNRDQIVKIARLTGCKKFLGKRKKFIFNAFVDLKPVERFENGSDM*
Ga0056137_10190212	3300003829	Marine Gutless Worms Symbiont	LNRDQIVKIARLTGCTNSVGKRKKFIFNEFVDLKLVERFENANDM*
Ga0065184_100487322	3300004098	Marine Gutless Worms Symbiont	IVKIARLTGCKNFVGKRKKFLFSAFVDVKPVERVENGSDM*
Ga0065184_100554661	3300004098	Marine Gutless Worms Symbiont	GTARGLNRDQIVKIARSTGFKNLVGKRNKFVLNAFVDLKPVERFENGSHTARI*
Ga0065184_100849751	3300004098	Marine Gutless Worms Symbiont	TARGLNRDQIVKVARLTGCKNFVCKRKKFIFDAFVDLKPVESLHVNACS*
Ga0065184_100927101	3300004098	Marine Gutless Worms Symbiont	VTTGAGTARGLKRDQVVNIATLSDSKNFVCKRKKFIINAFVDLKPVERFENGSDMS
Ga0065184_102307841	3300004098	Marine Gutless Worms Symbiont	RLKRDKIVKIARLSGCKNFARESQKFIFHAFVDLWPVERFVHCK*
Ga0065184_102436482	3300004098	Marine Gutless Worms Symbiont	VGTARGLNRDQIVKISTFTGCKNFVGKRKKFIFNVFVDLKPVEIFENGSDM*
Ga0065185_101877971	3300004122	Marine Gutless Worms Symbiont	MRRWARKGNNRAGTARGLNKDQIAKIAGFTGCKNFVGKRKKFIFNAFIDFKPVERFENGSDM*
Ga0065185_103396652	3300004122	Marine Gutless Worms Symbiont	LKVNQIVKTVRLPGCNNLVGRRKKFIFNVFVDLKPVERFENGSDMCRF
Ga0209145_12537761	3300027500	Marine Gutless Worms Symbiont	RDQIVKIARLTSCKNFVGKRKKFIFNAFVDLKPVEKSENRSDR
Ga0209791_10026436	3300027540	Marine Gutless Worms Symbiont	VLNRDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPLEKFENRSDM
Ga0209791_10120262	3300027540	Marine Gutless Worms Symbiont	VRGLNRDQIVKIARLTGCKNFVGKRKKFIFNVFTDLKPVERFENWSDM
Ga0209791_10261232	3300027540	Marine Gutless Worms Symbiont	GLNRDQIVKIARLTGYKNFVGKRKKFIFNAFVDLKPVERFENGSDM
Ga0209791_10314071	3300027540	Marine Gutless Worms Symbiont	VGTARGLNRDQIVKIARLTGCKNFVSKRKKFIFDEFVDLKPVERSENGSDM
Ga0209791_10785942	3300027540	Marine Gutless Worms Symbiont	VGTARGLNKDQIVKIARLTGCKNFVGKRKKFIFNALVDLKPVERFENGSDM
Ga0209791_10882982	3300027540	Marine Gutless Worms Symbiont	VNRDQIVKIARLTGCKNFLGRRTKFIFNAFVDLKPVERSENRSDM
Ga0209791_11563421	3300027540	Marine Gutless Worms Symbiont	LNRDQIVKIARLTGCKNFVGKRKKFIFNAFIDLKPVERFENGSDM
Ga0209791_12108522	3300027540	Marine Gutless Worms Symbiont	TARGLNRDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVEN
Ga0209791_12634821	3300027540	Marine Gutless Worms Symbiont	MRSGYCEGVEMNRDQIVKTARLTGCKNFIGKRKKFIFNAFVDLKPVERSENRSDMRGFRSLNNSTSK
Ga0209791_12928721	3300027540	Marine Gutless Worms Symbiont	VRGLNRDQIVKIARSIGCKNFVGKRKKFIFNAFTDLKPVQISENGSDM
Ga0209791_13099252	3300027540	Marine Gutless Worms Symbiont	MRSGYCEGLKRDQVVKIARQTGYKNFVGKRKKFIFNTFVDLKPVERFQNGSDM
Ga0209791_13495062	3300027540	Marine Gutless Worms Symbiont	LNRDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERIENGSET
Ga0209791_13787221	3300027540	Marine Gutless Worms Symbiont	MRSGYCEDQFVKIARLTGCKNFVGKRKFIFNAFVDLKPVERLENGSDYVRI
Ga0209791_13928531	3300027540	Marine Gutless Worms Symbiont	GAGTARGLNRDQIVKIARLTGCKNFVGKRKKFIFNAYVDLKPVERSEHRSDIVRI
Ga0209338_10009905	3300027551	Marine Gutless Worms Symbiont	MKSGLNRDQIVKIAKLTGCKNFVGKRKKFMFSAFIDLKPVERFENGSDM
Ga0209338_10108874	3300027551	Marine Gutless Worms Symbiont	MRSGTVRGLNRDNIVKIAKLTGCKNFVGKRKKFIFNAFVDHKPVERFENGSDI
Ga0209338_10180835	3300027551	Marine Gutless Worms Symbiont	MGTSRGLNRDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPV
Ga0209338_10303114	3300027551	Marine Gutless Worms Symbiont	NRDQTVKIARLTGCKNFVGKRKKFIFNVFVDLKPVERSENRSDM
Ga0209338_10409483	3300027551	Marine Gutless Worms Symbiont	QIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVVRFENRSDM
Ga0209338_10435591	3300027551	Marine Gutless Worms Symbiont	LNRDQIVKIARLTGCKKFVGKRKKFIFNAFVDLKPVETGEIGEWE
Ga0209338_10474152	3300027551	Marine Gutless Worms Symbiont	MRRWARKGNNRAGTARGLNKDQIAKIAGFTGCKNFVGKRKKFIFNAFIDFKPVERFENGSDM
Ga0209338_10889732	3300027551	Marine Gutless Worms Symbiont	VRGLHRDQIVKIARLTGCKNFVGKRQQLIFNTFTDLMPMERFET
Ga0209338_11434381	3300027551	Marine Gutless Worms Symbiont	RGLNRDKIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERFENRSDM
Ga0209338_11590981	3300027551	Marine Gutless Worms Symbiont	VRGLNRDQIVKIARLTGCKNFVGKRKKFVLNVFVDLKPVARFENRSDM
Ga0209338_11652141	3300027551	Marine Gutless Worms Symbiont	GTAMGLNRDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERSENRSYVRI
Ga0209338_11663571	3300027551	Marine Gutless Worms Symbiont	MKSGTARALNTDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERFEDGV
Ga0209338_12176782	3300027551	Marine Gutless Worms Symbiont	LNRDEIVKIARLTGYKNFVGKRKKFIFNAFVDLKPVERFENRGDM
Ga0209338_12791531	3300027551	Marine Gutless Worms Symbiont	QIVKIARLTGCKNFVGTGNKKKFWPIFNAFVDLKPVERFENGSDI
Ga0209338_13022182	3300027551	Marine Gutless Worms Symbiont	TARGLNRDHIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERFENGSDM
Ga0209338_13023691	3300027551	Marine Gutless Worms Symbiont	NRDQIVKISTFTGCKNFVGKRKKFIFNVFVDLKPVEIFENGSDM
Ga0209338_13031882	3300027551	Marine Gutless Worms Symbiont	VRGLKIDQTVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERSENRSDM
Ga0209338_13048131	3300027551	Marine Gutless Worms Symbiont	VKIARLTGCKNFVGKRKKFIFNAFVDLKPVERIENGSDM
Ga0209338_13338562	3300027551	Marine Gutless Worms Symbiont	LNRDQIVKIAMLTGCKKFVGKRKKFIFNAFVDLKPMERLENWSDNNVRI
Ga0209338_13976022	3300027551	Marine Gutless Worms Symbiont	VKIARLTGFKNFVGQRKKFIFNAFVDLKPVERFENWSDM
Ga0209743_10128531	3300027556	Marine Gutless Worms Symbiont	ARRLKRDKIVKIARLSGCKNFARESQKFIFHAFVDLWPVERFVHCK
Ga0209743_10152171	3300027556	Marine Gutless Worms Symbiont	LRGRGGLNRDQIVKIAKLTGCKNFVGKRKKFIFNAFIDLKSVERFENASDM
Ga0209743_10210903	3300027556	Marine Gutless Worms Symbiont	MRSRYCEGIEQDYQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERFENGSDM
Ga0209743_10654161	3300027556	Marine Gutless Worms Symbiont	RGLNRDQIVKIARLTGCKNFEGKRKKFIFNAFVDLKPVLRSENRSDM
Ga0209743_11024471	3300027556	Marine Gutless Worms Symbiont	LNRDQIVKIARLTGCKNFVGKRKFIYNVFVDLKPVE
Ga0209743_11363742	3300027556	Marine Gutless Worms Symbiont	LKKDQIVKIARLTGCKNFVGKRKKFIFNVFVDLKPVERFENRSDNYVRI
Ga0209743_11414502	3300027556	Marine Gutless Worms Symbiont	LNRDQIVKIARLTGCKNFVSKTKKFIFNAFIDFKPVERCDFENGSDM
Ga0209743_11969701	3300027556	Marine Gutless Worms Symbiont	VGTARGLNRDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERFELE
Ga0209743_13088732	3300027556	Marine Gutless Worms Symbiont	MKSGYCEGVKIARLTGCKNFVGKRKKFIFSAFVDLKPVERFENGSDM
Ga0209743_13144801	3300027556	Marine Gutless Worms Symbiont	ARRLNRDQIVKIARLTGCKNFVGKIKKFIFNAFVDLKPVERLE
Ga0209743_14045542	3300027556	Marine Gutless Worms Symbiont	GAGTARGLNRDQIVKIARLTGCKNFVGKRKKFVFNAFVDLKPLERFKNRSDM
Ga0209679_12079391	3300027557	Marine Gutless Worms Symbiont	LNRDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPLEKFENRS
Ga0209428_10392463	3300027564	Marine Gutless Worms Symbiont	TARGLNRDQIVKIARLTSCKNFVGKRKKFIFNAFVDLKPVERSENRSDM
Ga0209428_10982821	3300027564	Marine Gutless Worms Symbiont	QTVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERFDNESDM
Ga0209428_11274691	3300027564	Marine Gutless Worms Symbiont	MRRVLNRDQIVKISRCTGCKNFVGKRKKFIFNAFIDLKLVERFENGSDM
Ga0209428_11646722	3300027564	Marine Gutless Worms Symbiont	VGTARGLNRDQTVKIARLTGCKNNVGKRKKFIFNAFVDLKPVERSENRSDM
Ga0209428_11656882	3300027564	Marine Gutless Worms Symbiont	LNRDKIVKIARLTGCKNFVGKRKKFIFNAFVDFKPVERFENRSDM
Ga0209428_12067141	3300027564	Marine Gutless Worms Symbiont	LNRDQIVKIARLTGCKNFIGKRKKFIFNAFVDLKPVERFENGSDM
Ga0209428_12118542	3300027564	Marine Gutless Worms Symbiont	VGTARGLNRDQIVKISTFTGCKNFVGKRKKFIFNVFVDLKPVEIFENGSDM
Ga0209428_12704841	3300027564	Marine Gutless Worms Symbiont	LNRDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERFENGSDM
Ga0209428_12831221	3300027564	Marine Gutless Worms Symbiont	IVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERIENGSDM
Ga0209428_13643211	3300027564	Marine Gutless Worms Symbiont	QPMRSGTARGLNRDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPV
Ga0209428_13972181	3300027564	Marine Gutless Worms Symbiont	LNRDQIVKTARLSGCKNFVGKRKKFVFNAFVDLKPVERIGVICE
Ga0209637_10275702	3300027584	Marine Gutless Worms Symbiont	VLNRDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERFENRSDM
Ga0209637_10782242	3300027584	Marine Gutless Worms Symbiont	MRSGSCEGVENRDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERFENGNDM
Ga0209637_10913712	3300027584	Marine Gutless Worms Symbiont	LNRDQIVKIARLTGYKNFVGKRKKFIFNAFIDLKPVERFENGSDI
Ga0209637_11053031	3300027584	Marine Gutless Worms Symbiont	MSQLAYSFRDQIVKIARLTGCKNFIGKRKKFIFNAFVDLKPVEIFENGSDV
Ga0209637_11084961	3300027584	Marine Gutless Worms Symbiont	ARLTGCKNFVGKRKKFIFSAFIDLKPVERFENGSDM
Ga0209637_11107592	3300027584	Marine Gutless Worms Symbiont	ARGLNRDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVVRSENRSDRPM
Ga0209637_11381312	3300027584	Marine Gutless Worms Symbiont	LNKDQIVKIARLTGFKNFVGKRKKFRPILNAFVDLKPVERFDNGSDM
Ga0209637_11429472	3300027584	Marine Gutless Worms Symbiont	ARGLNRDQIVKIARLTGCKNFVGKRKKFIFNAFVNLKPVERSENRSDM
Ga0209637_11888801	3300027584	Marine Gutless Worms Symbiont	TARGLNRDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERSENRSDM
Ga0209637_11932992	3300027584	Marine Gutless Worms Symbiont	GAGTARGLNRDQIVKIARLTGCKNFVGKRKKFIFNAFADLKPVERFENRSDM
Ga0209637_12086462	3300027584	Marine Gutless Worms Symbiont	LNRDQIVKIAMLTGCKKFVGKRKKFIFNAFVDLKPVERLENWSDNNVRI
Ga0209637_12700331	3300027584	Marine Gutless Worms Symbiont	LKRDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPAQRRGVVS
Ga0209637_12708542	3300027584	Marine Gutless Worms Symbiont	LNRDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERFENGSLQLIEVCTL
Ga0209637_12744291	3300027584	Marine Gutless Worms Symbiont	GTARGLNRDQIVKISTFTGCKNFVGKRKKFIFNVFVDLKPVEIFENGSDM
Ga0209637_13065292	3300027584	Marine Gutless Worms Symbiont	LKKDQIVKIARLTGCKNFVGKRKKFIFNVFVDLKPVERFENRSDM
Ga0209637_13100452	3300027584	Marine Gutless Worms Symbiont	LNRDKIVKIARLTGCKNFVGKRKKFIFSAFVDLKPVERSENRSDM
Ga0209637_13214561	3300027584	Marine Gutless Worms Symbiont	DQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERFENRSDVKI
Ga0209637_13609652	3300027584	Marine Gutless Worms Symbiont	MGLNRDQIVKIARLTGCKNFVSKKKKFIFNAFIDLKPVERFENGSDM
Ga0209637_13817382	3300027584	Marine Gutless Worms Symbiont	RDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERSGNGSDM
Ga0209637_14085031	3300027584	Marine Gutless Worms Symbiont	VGTARGLNRDQTVKIARLTGCKNFVGKRKKFIFNVFVDLKPVERSEYRSDM
Ga0209150_10040333	3300027585	Marine Gutless Worms Symbiont	LNRDHTVKIARLTGCKNFAGKRKKFIFNAFIDLKPVERFENGSDM
Ga0209150_10157062	3300027585	Marine Gutless Worms Symbiont	VLNRDEIVKIARLTGCKNFVGKRKKFIFNAFVDLKPLEKFENRSDM
Ga0209150_10234432	3300027585	Marine Gutless Worms Symbiont	LNRDQIVKIARLTGCKNFIGKRKKFIFNAFIDLKPVERFENGSDM
Ga0209150_10278303	3300027585	Marine Gutless Worms Symbiont	LNRDQIVKIARLTGCKNFVGKRKKFIFSVFIDLKLVERFENRSDM
Ga0209150_10856331	3300027585	Marine Gutless Worms Symbiont	IARLTGCKNFVGKRKKFIFNAFIDLKPVERFENGSDM
Ga0209150_11851001	3300027585	Marine Gutless Worms Symbiont	VRGLNRDKIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERLENGGDNYVRIQQT
Ga0209150_12029941	3300027585	Marine Gutless Worms Symbiont	VRGLNRDQIVKIVRLTGCKNFVGKRKKFIFNVFVDLNPAERFENGSDM
Ga0209150_12076691	3300027585	Marine Gutless Worms Symbiont	QGGAGTAIGLNRDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVEICECE
Ga0209150_12258271	3300027585	Marine Gutless Worms Symbiont	RGLNRDQIVKIARLTGCKNFIGKRKKFIFNAFVDLKPVERFENGSDM
Ga0209150_12667501	3300027585	Marine Gutless Worms Symbiont	LNRDQIVKIARLTSCKNFVSKRKKFIFNAFVDLKPVERFENGSDT
Ga0209150_13159782	3300027585	Marine Gutless Worms Symbiont	LSRDQIVKIARLTGCKNFVGKRKKFNAFVDLKPVERSENRSDM
Ga0209150_13224951	3300027585	Marine Gutless Worms Symbiont	VGTARGLNRDQIVKIARLTGCKNFIGKRKKFIFNAFVDLKPVERFEDGWE
Ga0209150_13511002	3300027585	Marine Gutless Worms Symbiont	NRDEIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVEN
Ga0209150_13867621	3300027585	Marine Gutless Worms Symbiont	IARLTGCKNFVGKRKKFIFNVFVDLKPVERFENGSDM
Ga0209150_13907942	3300027585	Marine Gutless Worms Symbiont	LNRDQVVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERFENRSDM
Ga0209122_11030872	3300027613	Marine Gutless Worms Symbiont	LNRDHIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERFENGSDM
Ga0209122_11961721	3300027613	Marine Gutless Worms Symbiont	AATARGLNRDQTVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERFDNESDM
Ga0209122_12703812	3300027613	Marine Gutless Worms Symbiont	MRSGYCDGVVMNRDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERFENGSDM
Ga0209122_13175201	3300027613	Marine Gutless Worms Symbiont	VRGLKRDQIVKIARLTGYKNFIGKRQKFIFNAFVDLKPVERFENRSDM
Ga0209122_13177702	3300027613	Marine Gutless Worms Symbiont	MRSGTASGLNRDQIVRIARLTGCKNFVGKRKKFIFNAFINLKPVERLENRSDM
Ga0209122_13522471	3300027613	Marine Gutless Worms Symbiont	VEIDPQVAHGRGDRDQIVKIARLTGCKNFVGKRKKFIFNAFVERFENGSDM
Ga0209122_13556841	3300027613	Marine Gutless Worms Symbiont	GAGTARGLNRDQIVKIARLTGCKNFVGNRKKFIFNAFVDLKPVERFENRSDM
Ga0209122_13618522	3300027613	Marine Gutless Worms Symbiont	VGEKGVNRRGAGTANGLNEYQTVKIATLTGCKNFVGKRKKFIFNAFVDLKPVERSENRSD
Ga0209122_13716122	3300027613	Marine Gutless Worms Symbiont	LNRDQIVKIARLTGCKNFVGKRKKFIFNAFADLKPVERFENGSDM
Ga0209122_13904491	3300027613	Marine Gutless Worms Symbiont	RDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERIENGSET
Ga0209122_14094272	3300027613	Marine Gutless Worms Symbiont	LNRDQIVKIARLTGCKNFVGKRKKFIFNAFVELKPVERFENRSDM
Ga0209122_14161801	3300027613	Marine Gutless Worms Symbiont	KDQIVKIARLTGCKNFVGKRKKFIFNVFVDLKPVERFENRSDM
Ga0209260_100146851	3300027620	Marine Gutless Worms Symbiont	MKSGLNRDQIVKIAKLTGCKNFVGKRKKFMFNAFIDLKPVERFENGSDM
Ga0209260_100206011	3300027620	Marine Gutless Worms Symbiont	IARLTGCKNFVGKRKKFIFNAFVDLKPVERFENRSDM
Ga0209260_100378621	3300027620	Marine Gutless Worms Symbiont	GLNRDQIVKIARLTGCKNFVGKRKKFIFSAFIDLKPVERFENGSDM
Ga0209260_101009081	3300027620	Marine Gutless Worms Symbiont	RLTGCKNFAGKRKKFIFNAFIDLKPVERFENGSDM
Ga0209260_102066202	3300027620	Marine Gutless Worms Symbiont	TASGLNRDQIVKIARLTGCKNFVSKTKKFIFNAFIDLKPVERFDFENGSDM
Ga0209149_10110961	3300027626	Marine Gutless Worms Symbiont	GLNRDQIVIARLTGCKNFVGKRKKFIFSAFIDLKPVERFENGSDM
Ga0209149_10138431	3300027626	Marine Gutless Worms Symbiont	MRSGYTARGLNRDQIVKIARLTGCKNFVGKRKKFIFNAFVDL
Ga0209149_10178653	3300027626	Marine Gutless Worms Symbiont	LNRDQIVKIARLTGCKNFVGKKKKFIFNAFVDLKPVERFENGSDIVRI
Ga0209149_10226783	3300027626	Marine Gutless Worms Symbiont	VGTARGLNRDQIVKIARLTGCKNFEGKRKKFIFNAFVDLKPVLRSENRSDM
Ga0209149_10351471	3300027626	Marine Gutless Worms Symbiont	VKIARLTGCKNFVGKRKKFIFNAFIDLKPVERFENGSDM
Ga0209149_10575652	3300027626	Marine Gutless Worms Symbiont	MKSGTARALNTDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERFEDGVIM
Ga0209149_10591221	3300027626	Marine Gutless Worms Symbiont	MRSRYCEGLNRDQIVKIARLTGCKNFVGKREKFIFNASVDLKPVERSENRSDM
Ga0209149_10599174	3300027626	Marine Gutless Worms Symbiont	VTFNEETVTARGLNRDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERFENGSDV
Ga0209149_10641321	3300027626	Marine Gutless Worms Symbiont	GAGTARGLNRDQIVKIARLTGCKNFVGKRKKFIFSAFVDLKPVERSENRSDM
Ga0209149_10642251	3300027626	Marine Gutless Worms Symbiont	VGTARGLNRDQIVKIATLTGCKNFVSKRKKFIFDEFVDLKPVERSENGSDM
Ga0209149_10706921	3300027626	Marine Gutless Worms Symbiont	LNRDKIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERFENRSDM
Ga0209149_10887022	3300027626	Marine Gutless Worms Symbiont	MRSGYCDGVVMNRDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERSENTSDM
Ga0209149_10957541	3300027626	Marine Gutless Worms Symbiont	RGLNRDHIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERFENGSDM
Ga0209149_10994353	3300027626	Marine Gutless Worms Symbiont	DQVVKIARLTGCKNFVGKRKKFMFNAFVDLKPVQRFENRSDM
Ga0209149_11260753	3300027626	Marine Gutless Worms Symbiont	MMRGLNRDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERFDNGNNM
Ga0209149_11269941	3300027626	Marine Gutless Worms Symbiont	MRNGYCEGLNRDQIIKIARLTGCKNFVGKRKKFIFNAFVDLKPVERFENRSNM
Ga0209149_11326212	3300027626	Marine Gutless Worms Symbiont	VNRDQIVKIARLTGCKNFLGRRTKFIFNAFVDLKTVERSENRSNM
Ga0209149_11382681	3300027626	Marine Gutless Worms Symbiont	QIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERFENGSDM
Ga0209149_11485122	3300027626	Marine Gutless Worms Symbiont	GLNRDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERSENRSDM
Ga0209149_11574923	3300027626	Marine Gutless Worms Symbiont	GLNRDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERFENGSDISYLRI
Ga0209149_11602492	3300027626	Marine Gutless Worms Symbiont	LNKDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVDRSENRSDM
Ga0209149_11603971	3300027626	Marine Gutless Worms Symbiont	RGLNRDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERSGNGSDM
Ga0209149_11909403	3300027626	Marine Gutless Worms Symbiont	RDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERFENRSDVKI
Ga0209149_12142021	3300027626	Marine Gutless Worms Symbiont	MRSGYCEGLNRDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERSEN
Ga0209149_12161763	3300027626	Marine Gutless Worms Symbiont	VRGLNRDQIVKIARLTGCKNFVSKRKKFIFNAFVDLKPVERFENGGDM
Ga0209149_12251272	3300027626	Marine Gutless Worms Symbiont	TARGSNRDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVVRFENRSDM
Ga0209149_12384511	3300027626	Marine Gutless Worms Symbiont	MRSGYCEGLNRDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERFENRSDT
Ga0209149_12684581	3300027626	Marine Gutless Worms Symbiont	VGTARGLNKDRIVKIARLTGCKNFVGKRKKFIFNALVDLKPVEIFENGSDM
Ga0209149_13007351	3300027626	Marine Gutless Worms Symbiont	MRSQYCEGLNRDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERFE
Ga0209149_13155901	3300027626	Marine Gutless Worms Symbiont	RLTGCKNFVGKRKKFIFNAFVDLKPVERIENGSDM
Ga0209149_13249202	3300027626	Marine Gutless Worms Symbiont	VGTARGLNRDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPV
Ga0209149_13486831	3300027626	Marine Gutless Worms Symbiont	LNRDQIVKIARLTGCKNFVGKRKKFIFNAFIDLKPVERSENRNDT
Ga0209339_10275705	3300027632	Marine Gutless Worms Symbiont	KIARLTGCKNFVGKRKKFIFNAFVDLKPVERFENGSDM
Ga0209339_10433881	3300027632	Marine Gutless Worms Symbiont	LNRDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPV
Ga0209339_10622521	3300027632	Marine Gutless Worms Symbiont	AGTASGLNRDQIVKIARLTGCKNFIGKRKKFIFNAFIDLKPVERFENGSDM
Ga0209339_10890711	3300027632	Marine Gutless Worms Symbiont	LNRDKIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERLENGGDNYVRIQQT
Ga0209339_10902171	3300027632	Marine Gutless Worms Symbiont	LNRDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERFENRSDYVRI
Ga0209339_11184192	3300027632	Marine Gutless Worms Symbiont	MMSGYCEGLDRDQIVKIAGLTGCKNFVGKRKKFIFNAFVDLKPVERFGNRSDM
Ga0209339_11529651	3300027632	Marine Gutless Worms Symbiont	VGTARGLNRDQIVKISRLTVCKNVVGKRKKFIFNAFYDLKPVERSENRSDM
Ga0209339_11755212	3300027632	Marine Gutless Worms Symbiont	RDQIVKIARLTGCKNFVGKRKKFIFNSFVDLKPLERFENGSDM
Ga0209339_11757041	3300027632	Marine Gutless Worms Symbiont	GLNRDQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERFENGSDM
Ga0209339_12183271	3300027632	Marine Gutless Worms Symbiont	VNRDQIVKIARLTGCKNIVGKRKMFIFNAFVDLKPEERFEKRND
Ga0209339_12484712	3300027632	Marine Gutless Worms Symbiont	LNRDQIVKIPVARLTGCKNFVGKRKKFIFNAFVDFKPVERFDNGSDM
Ga0209339_12985351	3300027632	Marine Gutless Worms Symbiont	IVKIARLTGCKKFVGKRKKFIFNAFVDLKPVERFENGSDI
Ga0209339_13176222	3300027632	Marine Gutless Worms Symbiont	GTARGLNRYQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERFENRSDM
Ga0209339_13284151	3300027632	Marine Gutless Worms Symbiont	NRDQIVKIAKLTGCKNFVGKREKFIFNAFVDLKPVERFENGSDM
Ga0209339_13774732	3300027632	Marine Gutless Worms Symbiont	DQIVKIARLTGCKNFVGKRKKFIFNAFVDLKPVERFDNGNNM
Ga0209339_14187821	3300027632	Marine Gutless Worms Symbiont	KDQIVKIARLTGCKNFVGKRKKFIFNVFVDLKPVERFENRSDNYVRI

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.28
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.28
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F020808

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300001734	Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type A ELBA extract 1	Host-Associated	Open in IMG/M
3300001741	Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type G ELBA extract 1	Host-Associated	Open in IMG/M
3300001742	Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type G ELBA extract 3	Host-Associated	Open in IMG/M
3300001744	Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type A ELBA extract 2	Host-Associated	Open in IMG/M
3300001746	Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type G ELBA extract 2	Host-Associated	Open in IMG/M
3300002181	Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type A ELBA extract 3	Host-Associated	Open in IMG/M
3300003801	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius algarvensis Type A CAVOLI.1	Host-Associated	Open in IMG/M
3300003829	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius algarvensis Type G CAVOLI	Host-Associated	Open in IMG/M
3300004098	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius algarvensis Type A CAVOLI.2 (version 2)	Host-Associated	Open in IMG/M
3300004122	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius algarvensis Type A CAVOLI.3 (version 2)	Host-Associated	Open in IMG/M
3300027500	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius filocauda PIANOSA.2 (SPAdes)	Host-Associated	Open in IMG/M
3300027540	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius algarvensis Type A CAVOLI.1 (SPAdes)	Host-Associated	Open in IMG/M
3300027551	Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type A ELBA extract 1 (SPAdes)	Host-Associated	Open in IMG/M
3300027556	Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type G ELBA extract 2 (SPAdes)	Host-Associated	Open in IMG/M
3300027557	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius sp. 2 HERON ISLAND (SPAdes)	Host-Associated	Open in IMG/M
3300027564	Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type G ELBA extract 1 (SPAdes)	Host-Associated	Open in IMG/M
3300027584	Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type G ELBA extract 3 (SPAdes)	Host-Associated	Open in IMG/M
3300027585	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius algarvensis Type A CAVOLI.3 (SPAdes)	Host-Associated	Open in IMG/M
3300027613	Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type A ELBA extract 2 (SPAdes)	Host-Associated	Open in IMG/M
3300027620	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius algarvensis Type G CAVOLI (SPAdes)	Host-Associated	Open in IMG/M
3300027626	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius algarvensis Type A CAVOLI.2 (SPAdes)	Host-Associated	Open in IMG/M
3300027632	Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type A ELBA extract 3 (SPAdes)	Host-Associated	Open in IMG/M

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign