NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F020917

Metagenome Family F020917

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F020917
Family Type Metagenome
Number of Sequences 221
Average Sequence Length 43 residues
Representative Sequence MTPEQIDRVFGRGRLKMVTGEHVEVFREAVAPGERRRYTKRFL
Number of Associated Samples 176
Number of Associated Scaffolds 221

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 87.33 %
% of genes near scaffold ends (potentially truncated) 99.10 %
% of genes from short scaffolds (< 2000 bps) 93.21 %
Associated GOLD sequencing projects 160
AlphaFold2 3D model prediction Yes
3D model pTM-score0.52

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.095 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil
(12.217 % of family members)
Environment Ontology (ENVO) Unclassified
(41.176 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(49.321 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 11.27%    β-sheet: 23.94%    Coil/Unstructured: 64.79%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.52
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 221 Family Scaffolds
PF13672PP2C_2 33.03
PF07228SpoIIE 27.60
PF00498FHA 8.60
PF01594AI-2E_transport 0.45
PF01098FTSW_RODA_SPOVE 0.45
PF01370Epimerase 0.45
PF03466LysR_substrate 0.45
PF00578AhpC-TSA 0.45
PF069833-dmu-9_3-mt 0.45

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 221 Family Scaffolds
COG0628Predicted PurR-regulated permease PerMGeneral function prediction only [R] 0.45
COG0772Peptodoglycan polymerase FtsW/RodA/SpoVECell cycle control, cell division, chromosome partitioning [D] 0.45
COG2764Zn-dependent glyoxalase, PhnB familyEnergy production and conversion [C] 0.45
COG3865Glyoxalase superfamily enzyme, possible 3-demethylubiquinone-9 3-methyltransferaseGeneral function prediction only [R] 0.45


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.10 %
UnclassifiedrootN/A0.90 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000956|JGI10216J12902_104602132All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium663Open in IMG/M
3300001431|F14TB_100477771All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1598Open in IMG/M
3300004192|Ga0066448_1056156Not Available548Open in IMG/M
3300004268|Ga0066398_10143310All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria593Open in IMG/M
3300005176|Ga0066679_10399201All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria901Open in IMG/M
3300005178|Ga0066688_10605441All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria704Open in IMG/M
3300005329|Ga0070683_100406284All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1299Open in IMG/M
3300005329|Ga0070683_101063088All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria777Open in IMG/M
3300005330|Ga0070690_100200929All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1387Open in IMG/M
3300005331|Ga0070670_100569875All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1011Open in IMG/M
3300005334|Ga0068869_101897329All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium534Open in IMG/M
3300005335|Ga0070666_10882631All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria661Open in IMG/M
3300005335|Ga0070666_11086251All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria595Open in IMG/M
3300005335|Ga0070666_11331121All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria536Open in IMG/M
3300005347|Ga0070668_100049200All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria3244Open in IMG/M
3300005355|Ga0070671_101145697All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria684Open in IMG/M
3300005356|Ga0070674_100038290All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium3231Open in IMG/M
3300005366|Ga0070659_100325194All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1286Open in IMG/M
3300005435|Ga0070714_100283147All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1541Open in IMG/M
3300005438|Ga0070701_10149158All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1345Open in IMG/M
3300005441|Ga0070700_100979363All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria694Open in IMG/M
3300005451|Ga0066681_10034068All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria2708Open in IMG/M
3300005458|Ga0070681_11611959All Organisms → cellular organisms → Bacteria → Proteobacteria574Open in IMG/M
3300005459|Ga0068867_100355943All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1223Open in IMG/M
3300005466|Ga0070685_10225311All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1230Open in IMG/M
3300005536|Ga0070697_102092439All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium507Open in IMG/M
3300005539|Ga0068853_100311831All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1456Open in IMG/M
3300005539|Ga0068853_101284300All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria707Open in IMG/M
3300005543|Ga0070672_100453007All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1105Open in IMG/M
3300005548|Ga0070665_100314283All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1570Open in IMG/M
3300005555|Ga0066692_10850260All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria560Open in IMG/M
3300005556|Ga0066707_10499610All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria789Open in IMG/M
3300005564|Ga0070664_100165193All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1961Open in IMG/M
3300005569|Ga0066705_10032805All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium2807Open in IMG/M
3300005615|Ga0070702_101655669All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales531Open in IMG/M
3300005616|Ga0068852_100232025All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1759Open in IMG/M
3300005718|Ga0068866_10333327All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria958Open in IMG/M
3300005719|Ga0068861_101147593All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria749Open in IMG/M
3300005719|Ga0068861_101153116All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria747Open in IMG/M
3300005764|Ga0066903_106663198All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria601Open in IMG/M
3300005840|Ga0068870_10141307All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1409Open in IMG/M
3300005842|Ga0068858_101152071All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium762Open in IMG/M
3300005843|Ga0068860_100211828All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1880Open in IMG/M
3300005843|Ga0068860_102714837All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium514Open in IMG/M
3300006046|Ga0066652_101150616All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria735Open in IMG/M
3300006353|Ga0075370_10041064All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria2611Open in IMG/M
3300006354|Ga0075021_10587650All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria710Open in IMG/M
3300006358|Ga0068871_101355446All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria670Open in IMG/M
3300006854|Ga0075425_102056130All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria638Open in IMG/M
3300006871|Ga0075434_101948916All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria593Open in IMG/M
3300006881|Ga0068865_100086271All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales2266Open in IMG/M
3300006881|Ga0068865_101852640All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales546Open in IMG/M
3300006969|Ga0075419_11506722All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria505Open in IMG/M
3300009131|Ga0115027_10808514All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria716Open in IMG/M
3300009156|Ga0111538_13935987All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria513Open in IMG/M
3300009176|Ga0105242_10578663All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1081Open in IMG/M
3300009551|Ga0105238_12923191All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria514Open in IMG/M
3300010048|Ga0126373_12357858All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria592Open in IMG/M
3300010166|Ga0126306_11128228All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium642Open in IMG/M
3300010329|Ga0134111_10566979All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria505Open in IMG/M
3300010358|Ga0126370_11609243All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria622Open in IMG/M
3300010373|Ga0134128_12772801All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium540Open in IMG/M
3300010373|Ga0134128_12920173All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales526Open in IMG/M
3300010398|Ga0126383_10494650All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1280Open in IMG/M
3300010399|Ga0134127_11807872All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria687Open in IMG/M
3300010400|Ga0134122_10323026All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1333Open in IMG/M
3300010400|Ga0134122_10911738All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales851Open in IMG/M
3300010401|Ga0134121_12238944All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria584Open in IMG/M
3300010401|Ga0134121_12413251All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria567Open in IMG/M
3300010403|Ga0134123_13482730All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria509Open in IMG/M
3300012096|Ga0137389_10221655All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1581Open in IMG/M
3300012185|Ga0136619_10211063All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria738Open in IMG/M
3300012188|Ga0136618_10478992All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales538Open in IMG/M
3300012198|Ga0137364_10766950All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria728Open in IMG/M
3300012357|Ga0137384_10388265All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1154Open in IMG/M
3300012512|Ga0157327_1088725All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales510Open in IMG/M
3300012517|Ga0157354_1022990All Organisms → cellular organisms → Bacteria → Proteobacteria739Open in IMG/M
3300012519|Ga0157352_1045474All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria636Open in IMG/M
3300012684|Ga0136614_11034952All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria564Open in IMG/M
3300012905|Ga0157296_10022639All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1250Open in IMG/M
3300012907|Ga0157283_10330597All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales541Open in IMG/M
3300012913|Ga0157298_10221530All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales622Open in IMG/M
3300012971|Ga0126369_12969528All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria555Open in IMG/M
3300013296|Ga0157374_10747573All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria992Open in IMG/M
3300013306|Ga0163162_13036583All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria539Open in IMG/M
3300013308|Ga0157375_10045814All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria4258Open in IMG/M
3300013308|Ga0157375_10425065All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1494Open in IMG/M
3300013308|Ga0157375_10896953All Organisms → cellular organisms → Bacteria → Proteobacteria1031Open in IMG/M
3300014166|Ga0134079_10618271All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria541Open in IMG/M
3300014326|Ga0157380_10242798All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1625Open in IMG/M
3300014326|Ga0157380_11639706All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria699Open in IMG/M
3300014968|Ga0157379_10890648All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium844Open in IMG/M
3300015167|Ga0167661_1069432All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium649Open in IMG/M
3300015201|Ga0173478_10139007All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales950Open in IMG/M
3300015372|Ga0132256_101154979All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria888Open in IMG/M
3300015374|Ga0132255_105939490All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales517Open in IMG/M
3300016445|Ga0182038_10865266All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria795Open in IMG/M
3300017787|Ga0183260_10026382All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria4404Open in IMG/M
3300017787|Ga0183260_10383678All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium937Open in IMG/M
3300017789|Ga0136617_10713367All Organisms → cellular organisms → Bacteria → Proteobacteria777Open in IMG/M
3300017792|Ga0163161_11396875All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria611Open in IMG/M
3300017792|Ga0163161_12084847All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria504Open in IMG/M
3300018051|Ga0184620_10056795All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1117Open in IMG/M
3300018075|Ga0184632_10297800All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium698Open in IMG/M
3300018078|Ga0184612_10563681All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium545Open in IMG/M
3300018466|Ga0190268_11572383All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria577Open in IMG/M
3300018469|Ga0190270_12183857All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales614Open in IMG/M
3300018481|Ga0190271_12733965All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium592Open in IMG/M
3300018481|Ga0190271_13605649All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria518Open in IMG/M
3300019882|Ga0193713_1133862All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria675Open in IMG/M
3300020002|Ga0193730_1088620All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria869Open in IMG/M
3300020186|Ga0163153_10221401All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium938Open in IMG/M
3300021073|Ga0210378_10330125All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria571Open in IMG/M
3300021082|Ga0210380_10150058All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1045Open in IMG/M
3300021384|Ga0213876_10278201All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales889Open in IMG/M
3300021445|Ga0182009_10159592Not Available1076Open in IMG/M
3300021445|Ga0182009_10356946All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium748Open in IMG/M
3300023056|Ga0233357_1012972All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria933Open in IMG/M
3300025321|Ga0207656_10152091All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1096Open in IMG/M
3300025893|Ga0207682_10191692All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium937Open in IMG/M
3300025893|Ga0207682_10637460All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales501Open in IMG/M
3300025893|Ga0207682_10639303All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria500Open in IMG/M
3300025903|Ga0207680_10590102All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria794Open in IMG/M
3300025903|Ga0207680_11037712All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria587Open in IMG/M
3300025905|Ga0207685_10871184All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria500Open in IMG/M
3300025908|Ga0207643_10497499All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria779Open in IMG/M
3300025925|Ga0207650_10045291All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria3236Open in IMG/M
3300025925|Ga0207650_10721434All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium843Open in IMG/M
3300025926|Ga0207659_11178095All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium659Open in IMG/M
3300025931|Ga0207644_10269305All Organisms → cellular organisms → Bacteria → Proteobacteria1364Open in IMG/M
3300025932|Ga0207690_11125627All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria655Open in IMG/M
3300025934|Ga0207686_11510989All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales554Open in IMG/M
3300025935|Ga0207709_10301876All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1191Open in IMG/M
3300025938|Ga0207704_10093776All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1980Open in IMG/M
3300025938|Ga0207704_10279837All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1267Open in IMG/M
3300025941|Ga0207711_10238553All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1667Open in IMG/M
3300025944|Ga0207661_10652096All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales967Open in IMG/M
3300025945|Ga0207679_10067324All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria2686Open in IMG/M
3300025945|Ga0207679_10851284All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales833Open in IMG/M
3300025972|Ga0207668_10021350All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium4129Open in IMG/M
3300025972|Ga0207668_12028156All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria518Open in IMG/M
3300025986|Ga0207658_11473783All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria622Open in IMG/M
3300025986|Ga0207658_11940938All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales536Open in IMG/M
3300026041|Ga0207639_10185942All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Xylophilus → unclassified Xylophilus → Xylophilus sp. Leaf2201771Open in IMG/M
3300026041|Ga0207639_11198461All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria713Open in IMG/M
3300026041|Ga0207639_11381465All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria661Open in IMG/M
3300026067|Ga0207678_10887083All Organisms → cellular organisms → Bacteria788Open in IMG/M
3300026075|Ga0207708_10092437All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium2334Open in IMG/M
3300026088|Ga0207641_10894111All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria882Open in IMG/M
3300026089|Ga0207648_10891605All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria830Open in IMG/M
3300026095|Ga0207676_10234818All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1641Open in IMG/M
3300026095|Ga0207676_11828835All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria606Open in IMG/M
3300026095|Ga0207676_12132354All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria559Open in IMG/M
3300026095|Ga0207676_12134663All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria558Open in IMG/M
3300026118|Ga0207675_101097832All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria815Open in IMG/M
3300027907|Ga0207428_10335933All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1113Open in IMG/M
3300027909|Ga0209382_11124525All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria809Open in IMG/M
3300028380|Ga0268265_10028250All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria4015Open in IMG/M
3300028380|Ga0268265_12349013All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria540Open in IMG/M
3300028381|Ga0268264_11013288All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria837Open in IMG/M
3300028587|Ga0247828_10680202All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria638Open in IMG/M
3300028587|Ga0247828_10734799All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales619Open in IMG/M
3300028587|Ga0247828_10910995All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales567Open in IMG/M
3300028589|Ga0247818_10195582All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1327Open in IMG/M
3300028589|Ga0247818_10480152All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria846Open in IMG/M
3300028590|Ga0247823_11484275All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales508Open in IMG/M
3300028592|Ga0247822_10886556All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium731Open in IMG/M
3300028592|Ga0247822_11533556All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales564Open in IMG/M
3300028596|Ga0247821_11210357All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales513Open in IMG/M
3300028608|Ga0247819_10487534All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium726Open in IMG/M
3300028809|Ga0247824_10284154All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria927Open in IMG/M
3300028809|Ga0247824_10663637All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales632Open in IMG/M
3300028872|Ga0307314_10276710All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria528Open in IMG/M
3300028889|Ga0247827_10421194All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales816Open in IMG/M
3300030048|Ga0302273_1112378All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium805Open in IMG/M
3300030336|Ga0247826_10786462All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales744Open in IMG/M
3300030336|Ga0247826_11673101All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales519Open in IMG/M
3300031543|Ga0318516_10644318All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria603Open in IMG/M
3300031546|Ga0318538_10433187All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria712Open in IMG/M
3300031640|Ga0318555_10256469All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria945Open in IMG/M
3300031640|Ga0318555_10608419All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium592Open in IMG/M
3300031668|Ga0318542_10583002All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium583Open in IMG/M
3300031720|Ga0307469_11409969All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium665Open in IMG/M
3300031751|Ga0318494_10817514All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium546Open in IMG/M
3300031765|Ga0318554_10842366All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium512Open in IMG/M
3300031771|Ga0318546_10738677All Organisms → cellular organisms → Bacteria → Proteobacteria693Open in IMG/M
3300031820|Ga0307473_10290229All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1024Open in IMG/M
3300031859|Ga0318527_10145519All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria992Open in IMG/M
3300031896|Ga0318551_10664622All Organisms → cellular organisms → Bacteria → Proteobacteria603Open in IMG/M
3300031901|Ga0307406_12113044All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales505Open in IMG/M
3300031910|Ga0306923_11930912All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium602Open in IMG/M
3300031938|Ga0308175_102718350All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales553Open in IMG/M
3300031938|Ga0308175_102823004All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium542Open in IMG/M
3300031939|Ga0308174_10145516All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1758Open in IMG/M
3300031996|Ga0308176_10986807All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales888Open in IMG/M
3300032001|Ga0306922_10974058All Organisms → cellular organisms → Bacteria → Proteobacteria877Open in IMG/M
3300032001|Ga0306922_11571410All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium655Open in IMG/M
3300032005|Ga0307411_10277583All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1332Open in IMG/M
3300032005|Ga0307411_12000198All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria541Open in IMG/M
3300032009|Ga0318563_10757798All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium521Open in IMG/M
3300032012|Ga0310902_10561543All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales753Open in IMG/M
3300032013|Ga0310906_10280528All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1054Open in IMG/M
3300032065|Ga0318513_10420301All Organisms → cellular organisms → Bacteria → Proteobacteria653Open in IMG/M
3300032074|Ga0308173_10704842All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales922Open in IMG/M
3300032074|Ga0308173_10846126All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria844Open in IMG/M
3300032074|Ga0308173_10939211All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria801Open in IMG/M
3300032090|Ga0318518_10177757All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1087Open in IMG/M
3300032174|Ga0307470_11089935All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria642Open in IMG/M
3300032180|Ga0307471_100237529All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1863Open in IMG/M
3300032180|Ga0307471_100356294All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1575Open in IMG/M
3300032261|Ga0306920_102876843All Organisms → cellular organisms → Bacteria → Proteobacteria653Open in IMG/M
3300032782|Ga0335082_11630696All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales518Open in IMG/M
3300032828|Ga0335080_11632423All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales634Open in IMG/M
3300032893|Ga0335069_10033848All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria6878Open in IMG/M
3300033290|Ga0318519_11054936All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria506Open in IMG/M
3300033550|Ga0247829_11076656All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria667Open in IMG/M
3300033551|Ga0247830_10051477All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales2704Open in IMG/M
3300033551|Ga0247830_11396895All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria560Open in IMG/M
3300034125|Ga0370484_0021844All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1474Open in IMG/M
3300034147|Ga0364925_0360690All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria548Open in IMG/M
3300034268|Ga0372943_0388313All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria899Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil12.22%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil7.24%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere7.24%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere6.33%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.98%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere4.52%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil3.62%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.62%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere3.17%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand2.71%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.71%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.71%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere2.71%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere2.71%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.26%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.26%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.36%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.36%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.36%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.36%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.36%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.36%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.36%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.81%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.81%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.81%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.45%
WetlandEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland0.45%
Freshwater Microbial MatEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat0.45%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.45%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.45%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.45%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.45%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.45%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.45%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog0.45%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.45%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.45%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.45%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere0.45%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.45%
Plant RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots0.45%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.45%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.45%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.45%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.91%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.91%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.91%
Unplanted SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil0.91%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.91%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.91%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001431Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemlyEnvironmentalOpen in IMG/M
3300004192Freshwater sediment methanotrophic microbial communities from Lake Washington under simulated oxygen tension - Sediment Metagenome 70_HOW9EnvironmentalOpen in IMG/M
3300004268Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBioEnvironmentalOpen in IMG/M
3300005176Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128EnvironmentalOpen in IMG/M
3300005178Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137EnvironmentalOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005335Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaGHost-AssociatedOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005366Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaGHost-AssociatedOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005438Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaGEnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005451Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130EnvironmentalOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005466Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005539Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2Host-AssociatedOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005840Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006353Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5Host-AssociatedOpen in IMG/M
3300006354Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012EnvironmentalOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300009131Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1EnvironmentalOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010166Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27EnvironmentalOpen in IMG/M
3300010329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012185Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ353 (21.06)EnvironmentalOpen in IMG/M
3300012188Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ330 (21.06)EnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012512Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510Host-AssociatedOpen in IMG/M
3300012517Unplanted soil (control) microbial communities from North Carolina - M.Soil.6.yng.070610EnvironmentalOpen in IMG/M
3300012519Unplanted soil (control) microbial communities from North Carolina - M.Soil.7.yng.070610EnvironmentalOpen in IMG/M
3300012684Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ279 (21.06)EnvironmentalOpen in IMG/M
3300012905Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2EnvironmentalOpen in IMG/M
3300012907Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1EnvironmentalOpen in IMG/M
3300012913Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015EnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015167Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-11b, vegetated hydrological feature)EnvironmentalOpen in IMG/M
3300015201Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2)EnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017787Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ497 (22.06) (version 2)EnvironmentalOpen in IMG/M
3300017789Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ322 (21.06)EnvironmentalOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300018051Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1EnvironmentalOpen in IMG/M
3300018075Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1EnvironmentalOpen in IMG/M
3300018078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coexEnvironmentalOpen in IMG/M
3300018466Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 TEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300019882Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2EnvironmentalOpen in IMG/M
3300020002Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1EnvironmentalOpen in IMG/M
3300020186Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.MP6.IB-1EnvironmentalOpen in IMG/M
3300021073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redoEnvironmentalOpen in IMG/M
3300021082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redoEnvironmentalOpen in IMG/M
3300021384Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9Host-AssociatedOpen in IMG/M
3300021445Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaGEnvironmentalOpen in IMG/M
3300023056Soil microbial communities from Shasta-Trinity National Forest, California, United States - GEON-SFM-MS2EnvironmentalOpen in IMG/M
3300025321Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025893Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025908Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028587Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3EnvironmentalOpen in IMG/M
3300028589Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1EnvironmentalOpen in IMG/M
3300028590Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day30EnvironmentalOpen in IMG/M
3300028592Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30EnvironmentalOpen in IMG/M
3300028596Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glycerol_Day14EnvironmentalOpen in IMG/M
3300028608Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Xylose_Day6EnvironmentalOpen in IMG/M
3300028809Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48EnvironmentalOpen in IMG/M
3300028872Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_204EnvironmentalOpen in IMG/M
3300028889Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2EnvironmentalOpen in IMG/M
3300030048Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N1_3EnvironmentalOpen in IMG/M
3300030336Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1EnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031859Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031901Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2Host-AssociatedOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031939Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2EnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032005Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1Host-AssociatedOpen in IMG/M
3300032009Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19EnvironmentalOpen in IMG/M
3300032012Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3EnvironmentalOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300032065Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20EnvironmentalOpen in IMG/M
3300032074Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M
3300033550Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4EnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M
3300034125Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_tus_01_15EnvironmentalOpen in IMG/M
3300034147Sediment microbial communities from East River floodplain, Colorado, United States - 44_j17EnvironmentalOpen in IMG/M
3300034268Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI10216J12902_10460213223300000956SoilMKPADIERVFGRSRLRMVTGDHVEVYREAAQPGERRRYTKRFLATDAGDFR
F14TB_10047777113300001431SoilMTPEQIERVFGCSRLKMATGEHVEVFREAVRPGERRRYTKRFLET
Ga0066448_105615623300004192Freshwater SedimentMERSDIDLVFGRGRVRMVTGKHVEVFREDSQPGERRRYSKRFLATAAGD
Ga0066398_1014331023300004268Tropical Forest SoilMTPGQIDRVFGRGRLKMATGEHVEVFREAAAPGERRRYTKRFLNT
Ga0066679_1039920123300005176SoilMTPEQIDHVFGRGRLKMVTGEHVEVFREAVAPGERRRYTKRFLN
Ga0066688_1060544113300005178SoilMTPEQIDRVFGRGRLKMATGEHVEVFREAVASGERRRYTKRFLNTREGD
Ga0070683_10040628433300005329Corn RhizosphereMTSDQLERVFGRTRLKMATGEHVEVHREAASPGERRRYTKRFL
Ga0070683_10106308813300005329Corn RhizosphereMKQEQIERVFGRGRLRMVTGEHVEVFREAVAPGERRRYTKRFLATGDADF
Ga0070690_10020092933300005330Switchgrass RhizosphereMTPADIDRVFGRGRVRMVTGEHVEVFREASLPGERRRYTKRFLATA
Ga0070670_10056987523300005331Switchgrass RhizosphereMTPQQIEQVFGRGRLKMATGDHVEVFREAIAPGERRRYTKRF
Ga0068869_10189732923300005334Miscanthus RhizosphereVTPADIDRVFGRARLRMVTGDHVEVFREASLPGERRRYTKRFLATAAGD
Ga0070666_1088263113300005335Switchgrass RhizosphereMTPEQIDRVFGRGRLKMATGEHVEVFREAVRTGERRRYTKRFLSTQDGD
Ga0070666_1108625113300005335Switchgrass RhizosphereMTRDQIDRVFGRDRLKMVTGDHVEVFREAASDGSRRRYTKRFLDTRDGDFG
Ga0070666_1133112113300005335Switchgrass RhizosphereMTPQQIEQVFGRGRLKMATGEHVAVFREAMMPGERRRYTKRFLKT
Ga0070668_10004920013300005347Switchgrass RhizosphereMTPEQIDHVFGRGRLKMVTGQHVEVFREAMAPGERRRYTKRFLATSDGD
Ga0070671_10114569713300005355Switchgrass RhizosphereMTPEQIEQVFGRGRLKMATGEHVEVFREAMMPGERRRYTKRFL
Ga0070674_10003829053300005356Miscanthus RhizosphereMTPEQIDHVFGRGRLKMDTGAHVEVFREAAPPGESRRYTKRFLTTADG
Ga0070659_10032519433300005366Corn RhizosphereMTPADLDRVFGRGRLRMVTGEHVEVFREAALPGERRRYTKRFL
Ga0070714_10028314733300005435Agricultural SoilMTPEQIERVFGRGRLKMATGAHVEVFREAVPPGERRRYTKR
Ga0070701_1014915833300005438Corn, Switchgrass And Miscanthus RhizosphereMTPEQIERVFGHGRLKMVTGEHVEVFREAVVPGERRRYTKRFLNSTDGDFA
Ga0070700_10097936313300005441Corn, Switchgrass And Miscanthus RhizosphereMNAELERVFGRGRQKMATGDHVEVFREAAAPGERGRYTKRFLATG
Ga0066681_1003406833300005451SoilMTPENIERVFGRSRLKMVTGEHVEVFREAVAPGERRRYTKRFLNTREGDF
Ga0070681_1161195913300005458Corn RhizosphereMSPAEIERVFGRGRVRMTTGEHVEVFREEAREGEERRYTKRFLETA
Ga0068867_10035594313300005459Miscanthus RhizosphereMTPADIDRVFGRGRVRMVTGEHVEVFREASLPGERRRYTKRFL
Ga0070685_1022531113300005466Switchgrass RhizosphereMMTPDQIEQVFGRGRLKMATGQHVEVFREAMASGERRRYTKRFLATIDGDFGP
Ga0070697_10209243923300005536Corn, Switchgrass And Miscanthus RhizosphereMTPEQIDRVFGRGRLKMVTGEHVEVYREAVAPGERRRYTKRFLNTPEGDF
Ga0068853_10031183133300005539Corn RhizosphereMTPADIDRVFGRGRVRMVTGEHVEVFREASLPGERRRYTKRFLAT
Ga0068853_10128430013300005539Corn RhizosphereMTRDQIDRVFGRDRLKMVTGDHVEVFREAASAGSRRRYTK
Ga0070672_10045300723300005543Miscanthus RhizosphereMTPASIDRVFGRGRLRMVTGDHVEVFREESQPGERRRYTKRFLATPAGD
Ga0070665_10031428313300005548Switchgrass RhizosphereMTRDQIDRVFGRDRLKMVTGDHVEVFREAASDGSRRRYTKRFLDTRD
Ga0066692_1085026023300005555SoilMTPEQIDRVFGRGRLKMATGEHVEVFREAVISGERRRYTKRFLDTT
Ga0066707_1049961013300005556SoilMTPEQIDRVFGRGRLKMVTGEHVEVFREAVAPGERRRYTKRFL
Ga0070664_10016519313300005564Corn RhizosphereMTRDQIDRVFGRDRLKMVTGDHVEVFREAATDGSRRRYTKRFLDTRDGDF
Ga0066705_1003280543300005569SoilMTPEQIDHVFGRGRLKMVTGEHVEVFREAVAPGERRRYTKR
Ga0070702_10165566913300005615Corn, Switchgrass And Miscanthus RhizosphereMKPADIDRVFGRGRLRMVTGDHVEVFREHAAPGERRRYTKRFLATAAGDFS
Ga0068852_10023202513300005616Corn RhizosphereMTRDQIDRVFGRDRLKMVTGDHVEVFREAASAGSRRRYTKRFLDT
Ga0068866_1033332723300005718Miscanthus RhizosphereMTPEQIDRVFGRGRLKMVTGEHVEVYREAVAPGERRRYTKRFLNTPEG
Ga0068861_10114759323300005719Switchgrass RhizosphereMTPEQIDHVFGRGRLKMVTGQHVEVFREAMAPGERRRYTKR
Ga0068861_10115311623300005719Switchgrass RhizosphereMTLDQIDRVFGRGRLKMVTGDHVEVFREAASDGNRRRYTKRFLDTRE
Ga0066903_10666319813300005764Tropical Forest SoilVKAETIERVFGRERIKMATGDHVEVFRESVAPGERGRYTKRFLETGDA
Ga0068870_1014130713300005840Miscanthus RhizosphereMTRDQIDRVFGRDRLKMVTGDHVEVFREAASDGSRRRYTKRFLDTRDGDF
Ga0068858_10115207113300005842Switchgrass RhizosphereMTPEQIDRVFGRGRLKMVTGEHVEVYREAVGPTERRRYTKRFL
Ga0068860_10021182833300005843Switchgrass RhizosphereMTPEQIDRVFGRGRLKMVTGDHVEVFREAAMAGDRRRYTKRFLNT
Ga0068860_10271483723300005843Switchgrass RhizosphereMTPEQIERVFGRGRLKMVTGEHVEVFREAVAPGERRRYTKRFLNTTDG
Ga0066652_10115061613300006046SoilMTPEQIDHVFGRGRLKMVTGEHVEVFREAVAPGERRRYTKRFL
Ga0075370_1004106443300006353Populus EndosphereMTPGDIDRVFGRSRLRMVTGDHVEVFREETSPGERRRYTKRFLATTAGD
Ga0075021_1058765023300006354WatershedsMTPEQIERVFGCSRLKMATGEHVEVFREAVRAGERRRYTKR
Ga0068871_10135544613300006358Miscanthus RhizosphereMTPEQIEQVFGRGRLKMATGEHVEVFREAMMPGERRRYTKRFLTTSAGD
Ga0075425_10205613023300006854Populus RhizosphereMTPTQIDRVFGRGRLKMVTGEHVEVFREAVGPGERR
Ga0075434_10194891613300006871Populus RhizosphereMTPEQIERVFGCSRLKMATGEHVEVFREAVRPGERRRYTKRFLN
Ga0068865_10008627113300006881Miscanthus RhizosphereMSPADLDRVFGRARLRMVTGEHVEVFREASLPGERRRYTKRFLATA
Ga0068865_10185264023300006881Miscanthus RhizosphereMTPAAIERVFGRGRLRMVTGDHVEVFREESQPGERRRYTKRFL
Ga0075419_1150672223300006969Populus RhizosphereMTPEQIERVFGCSRLKMATGEHVEVFREAVRPGERRRYTKRFLETG
Ga0115027_1080851423300009131WetlandMTPEQIDQVFGRGRLKMATGEHVEVFREAIAPGERRRYTKRFLATSD
Ga0111538_1393598713300009156Populus RhizosphereMTPELIERVFGRGRLKMVTGEHVEVFREAVAPGERRRYNKRFVNTT
Ga0105242_1057866313300009176Miscanthus RhizosphereMTAEHIERVFGRGRLKMTTGEHVEVFREAVAPGDRRRYTKR
Ga0105238_1292319113300009551Corn RhizosphereMTPAQIDRVFGRERLKMVTGEHVEVYREAVAPGEPR
Ga0126373_1235785813300010048Tropical Forest SoilMTPEQIDRVFGRERLKMATGEHVEVFREAAAWGERRRYTKRFLSTEEGDYG
Ga0126306_1112822813300010166Serpentine SoilMTPAAMDRVFGRGRLRMVTGDHVEVYREEALPGERRRYTKRFL
Ga0134111_1056697913300010329Grasslands SoilMTPEQIDRVFGRGRLKMVTGDHVEVFREAAAAGER
Ga0126370_1160924313300010358Tropical Forest SoilMTPEQIERVFGRGRLKMVTGEHVEVFREAVARGERRRYTKRFLN
Ga0134128_1277280123300010373Terrestrial SoilMTPDQIDRVFGRGRLKMVTGEHVEVYREAVAPGERRRYTKRFL
Ga0134128_1292017313300010373Terrestrial SoilMTPADIDRVFGRGRVRMVTGEHVEVFRGASLPGERRRHTKRLLATAAGD
Ga0126383_1049465033300010398Tropical Forest SoilMTPEQINLVFGRSRLRMRTGEHVEVFREGVGPGERRRYTKRFLDSG
Ga0134127_1180787213300010399Terrestrial SoilMTAEHIERVFGRGRLKMTTGEHVEVFREAVAPGGRRRYTKRFLATDEAD
Ga0134122_1032302633300010400Terrestrial SoilMSPEQIDRVFGRGRLKMVTGEHVEVYREAVAKGERRRYTKRFLNTTDG
Ga0134122_1091173823300010400Terrestrial SoilMTPADIDRVFGRGRVRMVTGEHVEVFREASLPGERRRYT
Ga0134121_1223894423300010401Terrestrial SoilMKPADIERVFGRGRLKMMTGEHVEVFREEAAPGERRRYTKRF
Ga0134121_1241325123300010401Terrestrial SoilMTPQQIEQVFGGERLKIATGDHVEVYREALAPGQR
Ga0134123_1348273023300010403Terrestrial SoilMTPADIDRVFGRGRLRMVTGDHVEVFREQSLPGERRRYTKRFLATAAG
Ga0137389_1022165513300012096Vadose Zone SoilMTPAQIERVFGLGRLKMATGEHVEVFREAVAPGER
Ga0136619_1021106323300012185Polar Desert SandMASEPIDRVFGSGRLQMVTGAHVEVFREAAAPGESRRYTKRFLTTA
Ga0136618_1047899213300012188Polar Desert SandMTPASIDRVFGHGRLQMVTGDHVEVFREEAPAGARRRYTKRFLAT
Ga0137364_1076695013300012198Vadose Zone SoilMTPEQIERVFGLGRLKMATGEHVEVFREAVAPGERRRYTKRFLATSDADF
Ga0137384_1038826523300012357Vadose Zone SoilMTPAQIERVFGLGRLKMATGEHVEVFREAVAPGERRRYTKRFLATSDADF
Ga0157327_108872513300012512Arabidopsis RhizosphereMKPVDIDRVFGRGRLKMVTGAHVEVFREASLPGERRRYTKRFL
Ga0157354_102299023300012517Unplanted SoilMTPAEIDRVFGRGRLRMTTGEHVEVFREEARDGEERRYSK
Ga0157352_104547433300012519Unplanted SoilMSPADLDRVFGRARLRMVTGEHVEVFREASLPGERR
Ga0136614_1103495213300012684Polar Desert SandMASEPIDRVFGSGRLQMVTGAHVEVFREAAAPGESRRY
Ga0157296_1002263933300012905SoilMTPADIDRVFGRGRLRMVTGDHVEVFREHSLPGERRRYTKRFLA
Ga0157283_1033059723300012907SoilMSPPAIDRVFGRGRLRMVTGDHVEVFREESQPGER
Ga0157298_1022153013300012913SoilMTPAAIDRVFGRGRLRMVTGDHVEVFREESQPGERRRYTKR
Ga0126369_1296952813300012971Tropical Forest SoilMTPEQIDRVFGRARLKMVTGEHVEVFREAAATGERRRYTKRFLNTA
Ga0157374_1074757323300013296Miscanthus RhizosphereMMTPDQIEQVFGRGRLKMATGQHVEVFREAMASGERRRYTKRFLA
Ga0163162_1303658313300013306Switchgrass RhizosphereMTPQQIEQVFGRGRLKIATGEHVAVFREAMMPGERRRYTKRFL
Ga0157375_1004581453300013308Miscanthus RhizosphereMTPADIDRVFGRGRVRMVTGEHVEVFREASLPGERRRYTKRFLATAAG
Ga0157375_1042506513300013308Miscanthus RhizosphereMTPEQIERVFGRGRLKMVTGEHVEVFREAVAPGERRRYTKRF
Ga0157375_1089695323300013308Miscanthus RhizosphereMTPAEIDRVFGRARVRMMTGEHVEVFREEARDGEERRYSK
Ga0134079_1061827123300014166Grasslands SoilMTPEQIDRVFGRGRLKMVTGDHVEVFREAAAAGERRR
Ga0157380_1024279823300014326Switchgrass RhizosphereMTPADVDRVFGRGLVKMVTGEHVEVYREAALPGERRR*
Ga0157380_1163970613300014326Switchgrass RhizosphereMNPEQIDRVFGRGRLKMVTGEHVEVFREAVIPGERRRYTKRF
Ga0157379_1089064813300014968Switchgrass RhizosphereMTPADIDRVFGRSRLRMVTGAHVEVFREASLPGERRRYTKRFLATAAGDFRM
Ga0167661_106943233300015167Glacier Forefield SoilMTPDQIDRVFGRGRLRMVTGDHVEVFREAVQPGERRRY
Ga0173478_1013900713300015201SoilMTPADIDRVFGRGRLRMVTGDHVEVFREESQPGERRRYTKRFLATAA
Ga0132256_10115497923300015372Arabidopsis RhizosphereMTPEQVDRVFGRGRLKMATGDHVEVFREAAPPGERRRYTKRFLSTQEGD
Ga0132255_10593949013300015374Arabidopsis RhizosphereMNPLDPDRVFGRSRLRMVTGAHVEVYREAAAPGERRRYTKRFLATEAG
Ga0182038_1086526613300016445SoilMNAEQIERVFGRGRLKMVTGEHVEVFREGVARGERRRYTKRFLNTRE
Ga0183260_1002638213300017787Polar Desert SandVTPMTSEPIDRVFGRGRLQMVTGAHVEVFREAAAPGE
Ga0183260_1038367823300017787Polar Desert SandMTPAAIERVFGHGRVRMVTGDHVEVFREEAAPGERRRYTKRFLATDAGDFR
Ga0136617_1071336733300017789Polar Desert SandMKPAALERVFGRSRLKMVTGQYVEVYREATAPGERRRYTKRF
Ga0163161_1139687523300017792Switchgrass RhizosphereMTPADIDRVFGRGRLRMVTGDHVEVFREHSLPGERRRYTKRFLATAAG
Ga0163161_1208484723300017792Switchgrass RhizosphereMTSDQLERVFGRTRLKMATGEHVEVHREAASPGERRRYTKRFLSTDEADFREW
Ga0184620_1005679523300018051Groundwater SedimentMTPEQIERVFGRGRLKMVTGEHVEVFREAVAPGERRRYTKRFLNTTD
Ga0184632_1029780023300018075Groundwater SedimentMTPEQIDRVFGRGRLKMVTGEHVEVYREAVAPGERRRYTKRFLN
Ga0184612_1056368113300018078Groundwater SedimentMTPEQIERVFGRGRLKMVTGEHVEVFREAVAPGERRR
Ga0190268_1157238323300018466SoilMTIADIDRVFGRCRLRMVTGDHVEVFREASQPGERRRYTKRFLA
Ga0190270_1218385723300018469SoilMSPPAIDRVFGRGRLRMVTGDHVEVFREESQPGERRR
Ga0190271_1273396523300018481SoilMSPAEIDRVFGRGRLRMVTGDHVEVFREPALPGERRRYTKRFLA
Ga0190271_1360564913300018481SoilMDPIDRVFGRDRLQMVTGAHVEVFREAAARGESRRYTKRFL
Ga0193713_113386213300019882SoilMTPEQIDRVFGRGRLKMATGDHVEVFREAVVSGGRRRYTKRFLD
Ga0193730_108862013300020002SoilMTPEQIDRVFGRGRLKMATGDHVEVFREAVVSGGRRRYTKRFPDTS
Ga0163153_1022140123300020186Freshwater Microbial MatMTPAANDRVFGRGRLRMVTGDHVEVFREESQPGERRRYT
Ga0210378_1033012513300021073Groundwater SedimentMTPEQIDRVFGPGRLKMVTGEHVEVFREAVVPGQRRRYT
Ga0210380_1015005813300021082Groundwater SedimentMKHADIDRVFGRGRLRMVTGDHVEVFREHAAPGERRRYTKRFLATPAG
Ga0213876_1027820113300021384Plant RootsMTPADIDRVFGRGRLRMVTGEHVEVFREASPPGERRRYTKRFLAT
Ga0182009_1015959233300021445SoilMNTPAREVVFGRSRLAMSTRKHVEVFREAAAADERRRYTKRFLATA
Ga0182009_1035694613300021445SoilMTPAAIDRVFGRGRLRMVTGDHVEVFREESQPGERRRYTKRFLATPA
Ga0233357_101297213300023056SoilMTPEQIERVFGLGRLKMATGEHVEVFREAVAPGERRRYTKRFLATS
Ga0207656_1015209113300025321Corn RhizosphereMTPADIDRVFGRGRLRMVTGDHVEVFREASLPGQR
Ga0207682_1019169223300025893Miscanthus RhizosphereMTPEQIDRVFGRGRLKMVTGEHVEVFREAVVSGER
Ga0207682_1063746013300025893Miscanthus RhizosphereMTPTDIDRVFGRGRLRMVTGDHVEVFREHSLPGER
Ga0207682_1063930323300025893Miscanthus RhizosphereMTPDQIEQVFGRGRLKMATGQHVEVFREAMASGERRRY
Ga0207680_1059010223300025903Switchgrass RhizosphereMTPEQIERVFGHGRLKMVTGEHVEVFREAVVPGERRRYTKRFLNSTDGD
Ga0207680_1103771213300025903Switchgrass RhizosphereMTPQQIEQVFGRGRLKMATGEHVAVFREAMMPGERRRYTKRFLKTS
Ga0207685_1087118413300025905Corn, Switchgrass And Miscanthus RhizosphereMTPADIDRVFGRGRLRMVTGDHVEVFREHSLPGERRRYTK
Ga0207643_1049749913300025908Miscanthus RhizosphereMTPEQIERVFGHGRLKMVTGEHVEVFREAVVPGERRR
Ga0207650_1004529153300025925Switchgrass RhizosphereMTPADIDRVFGRGRLRMVTGDHVEVFREQSLPGERRRYTKRFLA
Ga0207650_1072143423300025925Switchgrass RhizosphereMTPAAIDRVFGRGRLRMVTGDHVEVFREESQPGERRRYTKRF
Ga0207659_1117809533300025926Miscanthus RhizosphereMTPEQIDRVFGRGRLRMVTGEHVEVFREAVAPGERRRYTKRFLNSTD
Ga0207644_1026930513300025931Switchgrass RhizosphereVFGAGRLQMATGAHVEVFREAVEHGVERRYTKRFLAGP
Ga0207690_1112562713300025932Corn RhizosphereMTSDQLERVFGRTRLKMATGEHVEVHREAAAPGERRRYTKRFLSTD
Ga0207686_1151098913300025934Miscanthus RhizosphereMKHADIDRVFGRGRLRMVTGDHVEVFREHAAPGERRRYTKRFLA
Ga0207709_1030187633300025935Miscanthus RhizosphereMTPASIDRVFGRGRLRMVTGDHVEVFREESQPGERRRYTKRFLATP
Ga0207704_1009377633300025938Miscanthus RhizosphereMTPADIDRVFGRGRLRMVTGDHVEVFREHSLPGERRR
Ga0207704_1027983713300025938Miscanthus RhizosphereMTPQQIDRVFGRERLKMVTGEHVEVYREAVAPGEPRRYTKRFLA
Ga0207711_1023855313300025941Switchgrass RhizosphereMKHADIDRVFGRGRLRMVTGDHVEVFREHAAPGERR
Ga0207661_1065209623300025944Corn RhizosphereMTPADIDRVFGRGRVRMVTGEHVEVFREASLPGERRR
Ga0207679_1006732413300025945Corn RhizosphereMTPADIDRVFGRSRLRMVTGAHVEVFREASLPGERRRYTKRFLATAAGDF
Ga0207679_1085128423300025945Corn RhizosphereMMPADIDRVFGRGRLRMVTGDHVEVFRERSLPGERRRYTKRFLATAAG
Ga0207668_1002135013300025972Switchgrass RhizosphereMTPEQIERVFGRGRLKMVTGEHVEVFREAVAPGERR
Ga0207668_1202815613300025972Switchgrass RhizosphereMTPDQIDRVFGCGRLKMVTGEHVEVFREAACAGERRRYTKRFLN
Ga0207658_1147378313300025986Switchgrass RhizosphereMTPQQIDRVFGRERLKMVTGEHVEVYREAVAPGEPRRYTKR
Ga0207658_1194093813300025986Switchgrass RhizosphereMTPASIDRVFGRGRLRMVTGDHVEVFREESQPGERRRYTKRFLATPAG
Ga0207639_1018594213300026041Corn RhizosphereMTPAEIDRVFGRGRLRMTTGEHVEVFREEARDGEERRYSKRFLDTA
Ga0207639_1119846123300026041Corn RhizosphereMTPDQIDHVFGRGRLKMDTGAHVEVFREAAPPGESR
Ga0207639_1138146513300026041Corn RhizosphereMTPAQIDRVFGRERLKMVTGEHVEVYREAVAPGEPRRYTKRFLATPNG
Ga0207678_1088708333300026067Corn RhizosphereMTPQQIEQVFGRGRLKMATGDHVEVFREAIAPGERRRYTKRFLTT
Ga0207708_1009243733300026075Corn, Switchgrass And Miscanthus RhizosphereMTPEQIERVFGHGRLKMVTGEHVEVFREAVVSGERRRYTKRFLNSTDGD
Ga0207641_1089411123300026088Switchgrass RhizosphereMTPEQIDRVFGRGRLKMVTGDHVEVFREAATAGDR
Ga0207648_1089160523300026089Miscanthus RhizosphereMTPQQIEQVFGGERLKIATGDHVEVYREALAAGQRRRYTKRFLATAAGD
Ga0207676_1023481833300026095Switchgrass RhizosphereMTPADIDRVFGRARLRMVTGDHVEVFREASLPGERRRY
Ga0207676_1182883523300026095Switchgrass RhizosphereMTPEQIDHVFGRGRLKMDTGAHVEVFREAAPPGESR
Ga0207676_1213235413300026095Switchgrass RhizosphereMTRDQIDRVFGRDRLKMVTGDHVEVFREAASDGSRRRYTKRFLDT
Ga0207676_1213466323300026095Switchgrass RhizosphereMTPEQIDHVFGRGRLKMVTGQHVEVFREAMAPGERRRYT
Ga0207675_10109783213300026118Switchgrass RhizosphereMTPDQIEQVFGRGRLKMATGEHVEVFREAIAPGERR
Ga0207428_1033593313300027907Populus RhizosphereMTLDQIDRVFGRGRLKMVTGDHVEVFREAASDGNRRRYTKRFLDT
Ga0209382_1112452523300027909Populus RhizosphereMTPDQIEQVFGRGRLKMATGEHVEVFREAMATGERR
Ga0268265_1002825053300028380Switchgrass RhizosphereMHEDLEHVFGRGRRKMATGDHVEVFREAAAPGERRRYTKR
Ga0268265_1234901323300028380Switchgrass RhizosphereMTPEQIDRVFGRGRLKMATGEHVEVFREAIRTGERRRYTK
Ga0268264_1101328813300028381Switchgrass RhizosphereMTPEQIDRVFGRGRLKMVTGDHVEVFREAAMAGDRRRYTKRF
Ga0247828_1068020223300028587SoilMTPEQIDRVFGRGRLQMVTGAHVEVFREAAAPGESRRYTKRFLK
Ga0247828_1073479923300028587SoilMTPADIDRVFGRGRLRMVTGDHVEVFREHSLPGERRRGRSGRRR
Ga0247828_1091099523300028587SoilMTPADIDRVFGRGRLRMVTGDHVEVFREQSLPGERRRYTKRFLATA
Ga0247818_1019558233300028589SoilMTPADIDRVFGRGRLRMVTGDHVEVFREHSLPGERRRYTKRFLATA
Ga0247818_1048015213300028589SoilMTHADIDRVFGRSRLRMVTGAHVEVFREASLPGERRRYTKRFLA
Ga0247823_1148427513300028590SoilMTPADIDRVFGRGRLRMVTGDHVEVFREHSLPGERRRY
Ga0247822_1088655623300028592SoilMTPASIDRVFGRGRLRMVTGDHVEVFREESQPGERRRYTKRFLATPAGDFRQW
Ga0247822_1153355623300028592SoilMTPSDIDRVFGRGRLRMVTGEHVEVYREASLPGER
Ga0247821_1121035723300028596SoilMTPADIDRVFGRGRLRMVTGDHVEVFREHSLPGERRRYTKRF
Ga0247819_1048753423300028608SoilMTPASIDRVFGRGRLRMVTGDHVEVFREESQPGERRRYTKRFLATPAGDFR
Ga0247824_1028415423300028809SoilMSAMSNGEIERVFGRGRLKMATGDHVEVFREAVAAGER
Ga0247824_1066363723300028809SoilMTPADIDRVFGRGRLRMVTGDHVEVFREHALPGERRRY
Ga0307314_1027671023300028872SoilMTPADIDRVFGRSRLRMVTGAHVEVFREASLPGERRRYTKRFLATAAGDFR
Ga0247827_1042119413300028889SoilMTPADIDRVFGRTRLRMVTGDHVEVFREASLPGERRRYTK
Ga0302273_111237823300030048BogMTPAHIDRVFGRGRLRMVTGDHVEVFREEAMPGERR
Ga0247826_1078646223300030336SoilMTPADIDRVFGRGRLRMVTGEHVEVFREASLPGERRRYTKRFL
Ga0247826_1167310113300030336SoilMTPADIDRVFGRGRLRMVTGEHVEVFREASLPGERRRYTKRFLAT
Ga0318516_1064431823300031543SoilMTPDQIDRVFGRGRLKMVTGEHVEVYREAVAPGERRRY
Ga0318538_1043318723300031546SoilMTPGQIDRVFGRERLKMATGEHVEVFREAAAPGERRRYTKRFLNTI
Ga0318555_1025646913300031640SoilMTPEQIDRVFGRGRLKMVTGEHVEVYREAVGPGER
Ga0318555_1060841913300031640SoilMTPEQIERVFGRGRLKMVTGEHVEVFREAVARGERRRYTKRFLNT
Ga0318542_1058300213300031668SoilMNAEQIERVFGRGRLKMVTGEHVEVFREAVARGERRRY
Ga0307469_1140996913300031720Hardwood Forest SoilMTPEQIDRVFGRGRLKMVTGEHVEVYREAVAPGERRRYTKRFL
Ga0318494_1081751423300031751SoilMTPEQIDRVFGRGRLKMVTGEHVEVYREAVGPGERRRYTKRFLNTPD
Ga0318554_1084236623300031765SoilMNAEQIERVFGRGRLKMVTGEHVEVFREEALPGERRRYTKRFLCTSE
Ga0318546_1073867723300031771SoilMTPAEIDRVFGRARMRMVTGEHVEVFREEAREGEERLY
Ga0307473_1029022913300031820Hardwood Forest SoilMTPEQIDRVFGRGRLKMVTGEHVEVYREAVGPGERRRYTK
Ga0318527_1014551913300031859SoilMNAEQIERVFGRGRLKMVTGEHVEVFREGVARGERRRYTKRFLNTQ
Ga0318551_1066462223300031896SoilMTPAEIDRVFGRARMRMVTGEHVEVFREEALEGEER
Ga0307406_1211304413300031901RhizosphereMTADDIDRVFGRTRLRMVTGAHVEVFREASLPGERRRYTKRFLA
Ga0306923_1193091213300031910SoilMTPEQIDRVFGRGRLKMVTGEHVEVYREAVGPGERRRYTKR
Ga0308175_10271835013300031938SoilMRPADIDRVFGRSRLRMVTGDHVEVFREAARPGERRRYTKRFLATAAGD
Ga0308175_10282300423300031938SoilMTPEQIERVFGRGRLQMVTGKHVEVFREAAGDGRRRKYTKRF
Ga0308174_1014551613300031939SoilMKSDQIERVFGRGRLKMATGEHVEVFREAVGPGQRRRYTKRFLDSG
Ga0308176_1098680723300031996SoilMTPADIDRVFGRGRLRMVTGDHVEVFREESLPGERRRYTKRFLA
Ga0306922_1097405813300032001SoilMTPAEIDRVFGRARMRMVTGEHVEVFREEAREGEE
Ga0306922_1157141023300032001SoilMTPEQIDRVFGRGRLKMVTGEHVEVYREAVGPGERRRYTKRF
Ga0307411_1027758333300032005RhizosphereMDSIDRVFGRNRLQMVTGAHVEVFREAAARGESRRYTKRFLTTADGD
Ga0307411_1200019823300032005RhizosphereMTPADIDRVFGRSRLRMVTGAHVEVFREASLAGERRRYTKRF
Ga0318563_1075779813300032009SoilMTPEQIERVFGRGRLKMVTGEHVEVFREAVARGERRRYTKRFLNTREGDFG
Ga0310902_1056154313300032012SoilMTPADIDRVFGRSRLRMVTGEHVEVFREASLPGERRRYTKRFLAT
Ga0310906_1028052823300032013SoilMTAEHIERVFGRGRLKMTTGEHVEVFREAVAPGDRRRYTKRFLATDE
Ga0318513_1042030113300032065SoilMTPAEIDRVFGRARTRMMTGEHVEVFREEAREGEERRY
Ga0308173_1070484223300032074SoilMTPADIDRVFGRGRLRMVTGDHVEVFREHSLPGER
Ga0308173_1084612613300032074SoilMTSDQLERVFGRARLKMATGEHVEVHREAASPGERRRYTKRFLSTDDAD
Ga0308173_1093921123300032074SoilMTPEQIDRVFGRGRLKMVTGDHVEVFREAAAAGDRRRYTKR
Ga0318518_1017775723300032090SoilMNAEQIERVFGRGRLKMVTGEHVEVFREGVARGERRRYTKRFLN
Ga0307470_1108993523300032174Hardwood Forest SoilMTPADIDRVFGRGRLRMVTGDHVEVFREAALPGQRRCYT
Ga0307471_10023752913300032180Hardwood Forest SoilMTPEQIERVFGRGRLKMTTGEHVEVFREAVASGERRRYTKR
Ga0307471_10035629413300032180Hardwood Forest SoilMTPDQIEQVFGRGRLKMATGEHVEVFREAMAPGERRR
Ga0306920_10287684323300032261SoilMTPAEIDRVFGRARMRMVTGEHVEVFREEAREGEERPYTKRFL
Ga0335082_1163069613300032782SoilMNPMDLDRVFGRSRLRMVTGAHVEVFREESAPGERRRYTKRFLATPD
Ga0335080_1163242313300032828SoilMNASDLDRVFGRGRLRMVTGDHVEVFREEALPGERRRYTKRFLAT
Ga0335069_1003384813300032893SoilMSTADLDRVFGRSRLRMVTGAHVEVFREEAVAGERRRYTKRFL
Ga0318519_1105493613300033290SoilMTPEQIEQVFGRGRLKMATGDHVEVFREAMVAGERRRYTKRFLATRD
Ga0247829_1107665623300033550SoilMTAMSTGEIERVFGRGRLKMATGDHVEVFREAVAAGERR
Ga0247830_1005147713300033551SoilMTPADIDRVFGRGRLRMVTGDHVEVFREHALPGERRRYTKRFLAT
Ga0247830_1139689523300033551SoilMTPADIDRVFGRSRLRMVTGAHVEVFREASLPGERRRYTKRF
Ga0370484_0021844_2_1243300034125Untreated Peat SoilMTPADIDRVFGRRRLRMVTGDHVEVFREESLPGERRRYTKR
Ga0364925_0360690_1_1503300034147SedimentMNADPIDRVFGRGRLRMVTGAQVEVFREAAAPGEARRYTKRFLATAEGDY
Ga0372943_0388313_768_8993300034268SoilMTPADLDRVFGRSRLRMATGAHVEVYRDETPPGQARRFSKRFLE


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.