 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F020955 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 221 |
| Average Sequence Length | 40 residues |
| Representative Sequence | LARFRTWIDTHTDQVIIYGSLILGFWLIANSIYLIVT |
| Number of Associated Samples | 171 |
| Number of Associated Scaffolds | 221 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 2.27 % |
| % of genes near scaffold ends (potentially truncated) | 96.83 % |
| % of genes from short scaffolds (< 2000 bps) | 92.31 % |
| Associated GOLD sequencing projects | 165 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.48 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (63.801 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (28.507 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.887 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (49.321 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 53.85% β-sheet: 0.00% Coil/Unstructured: 46.15% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 221 Family Scaffolds |
|---|---|---|
| PF07690 | MFS_1 | 3.17 |
| PF13191 | AAA_16 | 2.26 |
| PF00196 | GerE | 1.81 |
| PF06325 | PrmA | 1.81 |
| PF07885 | Ion_trans_2 | 1.81 |
| PF00106 | adh_short | 1.36 |
| PF08281 | Sigma70_r4_2 | 1.36 |
| PF10011 | DUF2254 | 1.36 |
| PF00296 | Bac_luciferase | 1.36 |
| PF01568 | Molydop_binding | 1.36 |
| PF10009 | DUF2252 | 1.36 |
| PF01734 | Patatin | 0.90 |
| PF00583 | Acetyltransf_1 | 0.90 |
| PF12680 | SnoaL_2 | 0.90 |
| PF00571 | CBS | 0.90 |
| PF00440 | TetR_N | 0.90 |
| PF00578 | AhpC-TSA | 0.90 |
| PF04229 | GrpB | 0.90 |
| PF13302 | Acetyltransf_3 | 0.90 |
| PF14145 | YrhK | 0.90 |
| PF11139 | SfLAP | 0.90 |
| PF11716 | MDMPI_N | 0.90 |
| PF13669 | Glyoxalase_4 | 0.90 |
| PF00773 | RNB | 0.45 |
| PF00072 | Response_reg | 0.45 |
| PF13561 | adh_short_C2 | 0.45 |
| PF00581 | Rhodanese | 0.45 |
| PF01569 | PAP2 | 0.45 |
| PF02775 | TPP_enzyme_C | 0.45 |
| PF13186 | SPASM | 0.45 |
| PF00596 | Aldolase_II | 0.45 |
| PF06527 | TniQ | 0.45 |
| PF13305 | TetR_C_33 | 0.45 |
| PF13701 | DDE_Tnp_1_4 | 0.45 |
| PF00588 | SpoU_methylase | 0.45 |
| PF00135 | COesterase | 0.45 |
| PF02073 | Peptidase_M29 | 0.45 |
| PF01740 | STAS | 0.45 |
| PF04264 | YceI | 0.45 |
| PF13377 | Peripla_BP_3 | 0.45 |
| PF02929 | Bgal_small_N | 0.45 |
| PF02630 | SCO1-SenC | 0.45 |
| PF09137 | Glucodextran_N | 0.45 |
| PF02668 | TauD | 0.45 |
| PF00654 | Voltage_CLC | 0.45 |
| PF01202 | SKI | 0.45 |
| PF01904 | DUF72 | 0.45 |
| PF03631 | Virul_fac_BrkB | 0.45 |
| PF10708 | DUF2510 | 0.45 |
| PF13560 | HTH_31 | 0.45 |
| PF02310 | B12-binding | 0.45 |
| PF01022 | HTH_5 | 0.45 |
| PF04679 | DNA_ligase_A_C | 0.45 |
| PF10282 | Lactonase | 0.45 |
| PF00679 | EFG_C | 0.45 |
| PF08044 | DUF1707 | 0.45 |
| PF03663 | Glyco_hydro_76 | 0.45 |
| PF00009 | GTP_EFTU | 0.45 |
| PF04464 | Glyphos_transf | 0.45 |
| PF01068 | DNA_ligase_A_M | 0.45 |
| PF00884 | Sulfatase | 0.45 |
| PF01179 | Cu_amine_oxid | 0.45 |
| PF06772 | LtrA | 0.45 |
| PF07366 | SnoaL | 0.45 |
| PF03466 | LysR_substrate | 0.45 |
| PF02866 | Ldh_1_C | 0.45 |
| PF07920 | DUF1684 | 0.45 |
| PF02515 | CoA_transf_3 | 0.45 |
| COG ID | Name | Functional Category | % Frequency in 221 Family Scaffolds |
|---|---|---|---|
| COG2264 | Ribosomal protein L11 methylase PrmA | Translation, ribosomal structure and biogenesis [J] | 1.81 |
| COG2890 | Methylase of polypeptide chain release factors | Translation, ribosomal structure and biogenesis [J] | 1.81 |
| COG3897 | Protein N-terminal and lysine N-methylase, NNT1/EFM7 family | Posttranslational modification, protein turnover, chaperones [O] | 1.81 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 1.36 |
| COG1752 | Predicted acylesterase/phospholipase RssA, containd patatin domain | General function prediction only [R] | 0.90 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 0.90 |
| COG2320 | GrpB domain, predicted nucleotidyltransferase, UPF0157 family | General function prediction only [R] | 0.90 |
| COG3621 | Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR | General function prediction only [R] | 0.90 |
| COG4667 | Predicted phospholipase, patatin/cPLA2 family | Lipid transport and metabolism [I] | 0.90 |
| COG0038 | H+/Cl- antiporter ClcA | Inorganic ion transport and metabolism [P] | 0.45 |
| COG0039 | Malate/lactate dehydrogenase | Energy production and conversion [C] | 0.45 |
| COG0219 | tRNA(Leu) C34 or U34 (ribose-2'-O)-methylase TrmL, contains SPOUT domain | Translation, ribosomal structure and biogenesis [J] | 0.45 |
| COG0557 | Exoribonuclease R | Transcription [K] | 0.45 |
| COG0565 | tRNA C32,U32 (ribose-2'-O)-methylase TrmJ or a related methyltransferase | Translation, ribosomal structure and biogenesis [J] | 0.45 |
| COG0566 | tRNA G18 (ribose-2'-O)-methylase SpoU | Translation, ribosomal structure and biogenesis [J] | 0.45 |
| COG1225 | Peroxiredoxin | Posttranslational modification, protein turnover, chaperones [O] | 0.45 |
| COG1295 | Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase) | Function unknown [S] | 0.45 |
| COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 0.45 |
| COG1801 | Sugar isomerase-related protein YecE, UPF0759/DUF72 family | General function prediction only [R] | 0.45 |
| COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 0.45 |
| COG1887 | CDP-glycerol glycerophosphotransferase, TagB/SpsB family | Cell wall/membrane/envelope biogenesis [M] | 0.45 |
| COG1999 | Cytochrome oxidase Cu insertion factor, SCO1/SenC/PrrC family | Posttranslational modification, protein turnover, chaperones [O] | 0.45 |
| COG2175 | Taurine dioxygenase, alpha-ketoglutarate-dependent | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.45 |
| COG2272 | Carboxylesterase type B | Lipid transport and metabolism [I] | 0.45 |
| COG2309 | Leucyl aminopeptidase (aminopeptidase T) | Amino acid transport and metabolism [E] | 0.45 |
| COG2353 | Polyisoprenoid-binding periplasmic protein YceI | General function prediction only [R] | 0.45 |
| COG3250 | Beta-galactosidase/beta-glucuronidase | Carbohydrate transport and metabolism [G] | 0.45 |
| COG3358 | Uncharacterized conserved protein, DUF1684 family | Function unknown [S] | 0.45 |
| COG3387 | Glucoamylase (glucan-1,4-alpha-glucosidase), GH15 family | Carbohydrate transport and metabolism [G] | 0.45 |
| COG3733 | Cu2+-containing amine oxidase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.45 |
| COG4292 | Low temperature requirement protein LtrA (function unknown) | Function unknown [S] | 0.45 |
| COG4776 | Exoribonuclease II | Transcription [K] | 0.45 |
| COG4833 | Predicted alpha-1,6-mannanase, GH76 family | Carbohydrate transport and metabolism [G] | 0.45 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 65.16 % |
| Unclassified | root | N/A | 34.84 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459013|GO6OHWN02F1C2G | Not Available | 512 | Open in IMG/M |
| 3300000956|JGI10216J12902_110101933 | Not Available | 582 | Open in IMG/M |
| 3300001976|JGI24752J21851_1058612 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 530 | Open in IMG/M |
| 3300004081|Ga0063454_100691465 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 766 | Open in IMG/M |
| 3300004091|Ga0062387_100712682 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 736 | Open in IMG/M |
| 3300005162|Ga0066814_10112230 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 521 | Open in IMG/M |
| 3300005332|Ga0066388_105304254 | Not Available | 654 | Open in IMG/M |
| 3300005436|Ga0070713_100777535 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → unclassified Frankia → Frankia sp. | 917 | Open in IMG/M |
| 3300005436|Ga0070713_100939610 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 833 | Open in IMG/M |
| 3300005436|Ga0070713_101209032 | Not Available | 731 | Open in IMG/M |
| 3300005436|Ga0070713_102143514 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 542 | Open in IMG/M |
| 3300005526|Ga0073909_10219651 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 831 | Open in IMG/M |
| 3300005539|Ga0068853_100164404 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 2004 | Open in IMG/M |
| 3300005553|Ga0066695_10597854 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Embleya → Embleya scabrispora | 662 | Open in IMG/M |
| 3300005618|Ga0068864_100989989 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Virgisporangium → Virgisporangium ochraceum | 833 | Open in IMG/M |
| 3300005937|Ga0081455_10319029 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1108 | Open in IMG/M |
| 3300005983|Ga0081540_1134518 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1003 | Open in IMG/M |
| 3300006028|Ga0070717_11770242 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 559 | Open in IMG/M |
| 3300006052|Ga0075029_101340381 | Not Available | 503 | Open in IMG/M |
| 3300006057|Ga0075026_100065994 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1738 | Open in IMG/M |
| 3300006175|Ga0070712_100094126 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2201 | Open in IMG/M |
| 3300006175|Ga0070712_100310816 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1279 | Open in IMG/M |
| 3300006176|Ga0070765_100193036 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1844 | Open in IMG/M |
| 3300006237|Ga0097621_101817293 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 581 | Open in IMG/M |
| 3300006354|Ga0075021_10134245 | Not Available | 1488 | Open in IMG/M |
| 3300006577|Ga0074050_12000081 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 560 | Open in IMG/M |
| 3300006578|Ga0074059_11946743 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 523 | Open in IMG/M |
| 3300006578|Ga0074059_12166485 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1157 | Open in IMG/M |
| 3300006795|Ga0075520_1201930 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 842 | Open in IMG/M |
| 3300006800|Ga0066660_10974013 | Not Available | 684 | Open in IMG/M |
| 3300006854|Ga0075425_101123437 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 894 | Open in IMG/M |
| 3300006854|Ga0075425_102657162 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 553 | Open in IMG/M |
| 3300006871|Ga0075434_101061637 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 823 | Open in IMG/M |
| 3300006871|Ga0075434_102226644 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 552 | Open in IMG/M |
| 3300006904|Ga0075424_101800903 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 648 | Open in IMG/M |
| 3300006954|Ga0079219_11264001 | Not Available | 646 | Open in IMG/M |
| 3300009011|Ga0105251_10083546 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1474 | Open in IMG/M |
| 3300009098|Ga0105245_11112747 | Not Available | 836 | Open in IMG/M |
| 3300009176|Ga0105242_10023875 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4825 | Open in IMG/M |
| 3300009525|Ga0116220_10550967 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 527 | Open in IMG/M |
| 3300009623|Ga0116133_1007245 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2767 | Open in IMG/M |
| 3300009700|Ga0116217_10093959 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2062 | Open in IMG/M |
| 3300009792|Ga0126374_10741860 | Not Available | 743 | Open in IMG/M |
| 3300010048|Ga0126373_11980783 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 645 | Open in IMG/M |
| 3300010048|Ga0126373_13030235 | Not Available | 524 | Open in IMG/M |
| 3300010154|Ga0127503_10992114 | Not Available | 591 | Open in IMG/M |
| 3300010343|Ga0074044_10613780 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 710 | Open in IMG/M |
| 3300010360|Ga0126372_10361199 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1307 | Open in IMG/M |
| 3300010360|Ga0126372_12121626 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300010361|Ga0126378_10706408 | Not Available | 1120 | Open in IMG/M |
| 3300010379|Ga0136449_101939015 | All Organisms → cellular organisms → Bacteria | 873 | Open in IMG/M |
| 3300010379|Ga0136449_102583506 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 725 | Open in IMG/M |
| 3300010379|Ga0136449_103253200 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → unclassified Acidimicrobiales → Acidimicrobiales bacterium | 626 | Open in IMG/M |
| 3300010379|Ga0136449_103784788 | Not Available | 570 | Open in IMG/M |
| 3300010379|Ga0136449_104647722 | Not Available | 502 | Open in IMG/M |
| 3300012198|Ga0137364_10156844 | All Organisms → cellular organisms → Bacteria | 1649 | Open in IMG/M |
| 3300012204|Ga0137374_11082481 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Pleosporomycetidae → Pleosporales → Pleosporineae → Phaeosphaeriaceae → Longispora | 572 | Open in IMG/M |
| 3300012205|Ga0137362_11177064 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300012207|Ga0137381_10305853 | Not Available | 1385 | Open in IMG/M |
| 3300012207|Ga0137381_10750715 | Not Available | 847 | Open in IMG/M |
| 3300012357|Ga0137384_10846783 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 738 | Open in IMG/M |
| 3300012362|Ga0137361_11567824 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Methanomada group → Methanobacteria → Methanobacteriales | 580 | Open in IMG/M |
| 3300012918|Ga0137396_10790427 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300012924|Ga0137413_11370373 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 570 | Open in IMG/M |
| 3300012924|Ga0137413_11642177 | Not Available | 526 | Open in IMG/M |
| 3300012951|Ga0164300_10184439 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1009 | Open in IMG/M |
| 3300012957|Ga0164303_10423504 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 829 | Open in IMG/M |
| 3300012984|Ga0164309_10571106 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 878 | Open in IMG/M |
| 3300012989|Ga0164305_10044829 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2544 | Open in IMG/M |
| 3300013105|Ga0157369_12113744 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 571 | Open in IMG/M |
| 3300014165|Ga0181523_10608936 | Not Available | 599 | Open in IMG/M |
| 3300014655|Ga0181516_10493643 | Not Available | 628 | Open in IMG/M |
| 3300014968|Ga0157379_12503760 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 516 | Open in IMG/M |
| 3300015374|Ga0132255_106233747 | Not Available | 505 | Open in IMG/M |
| 3300016270|Ga0182036_10898124 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 726 | Open in IMG/M |
| 3300016319|Ga0182033_11575232 | Not Available | 594 | Open in IMG/M |
| 3300016319|Ga0182033_12159742 | Not Available | 508 | Open in IMG/M |
| 3300016357|Ga0182032_10044137 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2842 | Open in IMG/M |
| 3300016357|Ga0182032_10557444 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 949 | Open in IMG/M |
| 3300016404|Ga0182037_10387047 | Not Available | 1149 | Open in IMG/M |
| 3300016445|Ga0182038_12176968 | Not Available | 503 | Open in IMG/M |
| 3300017926|Ga0187807_1024331 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1869 | Open in IMG/M |
| 3300017932|Ga0187814_10104532 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1046 | Open in IMG/M |
| 3300017937|Ga0187809_10203735 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 702 | Open in IMG/M |
| 3300017942|Ga0187808_10213215 | Not Available | 860 | Open in IMG/M |
| 3300017942|Ga0187808_10306994 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 716 | Open in IMG/M |
| 3300017946|Ga0187879_10047057 | All Organisms → cellular organisms → Bacteria | 2548 | Open in IMG/M |
| 3300017955|Ga0187817_10409582 | Not Available | 865 | Open in IMG/M |
| 3300017972|Ga0187781_11198110 | Not Available | 559 | Open in IMG/M |
| 3300017973|Ga0187780_10540108 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 834 | Open in IMG/M |
| 3300017973|Ga0187780_10911719 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae | 638 | Open in IMG/M |
| 3300017974|Ga0187777_10492603 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Saccharopolyspora | 856 | Open in IMG/M |
| 3300017974|Ga0187777_11219608 | Not Available | 551 | Open in IMG/M |
| 3300017975|Ga0187782_10736448 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
| 3300017995|Ga0187816_10216788 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 833 | Open in IMG/M |
| 3300018035|Ga0187875_10002185 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 14599 | Open in IMG/M |
| 3300018058|Ga0187766_10301171 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1038 | Open in IMG/M |
| 3300018058|Ga0187766_10513005 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 808 | Open in IMG/M |
| 3300018058|Ga0187766_10762371 | Not Available | 673 | Open in IMG/M |
| 3300018058|Ga0187766_10790999 | Not Available | 662 | Open in IMG/M |
| 3300018058|Ga0187766_10930704 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Saccharopolyspora | 615 | Open in IMG/M |
| 3300018060|Ga0187765_11258862 | Not Available | 522 | Open in IMG/M |
| 3300018085|Ga0187772_11078150 | Not Available | 589 | Open in IMG/M |
| 3300018085|Ga0187772_11193742 | Not Available | 560 | Open in IMG/M |
| 3300018090|Ga0187770_10287478 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1278 | Open in IMG/M |
| 3300018090|Ga0187770_11537472 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300018482|Ga0066669_10881603 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Methanomada group → Methanobacteria → Methanobacteriales | 799 | Open in IMG/M |
| 3300020069|Ga0197907_10677461 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 514 | Open in IMG/M |
| 3300020580|Ga0210403_11122596 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 610 | Open in IMG/M |
| 3300020581|Ga0210399_10430094 | All Organisms → cellular organisms → Bacteria | 1100 | Open in IMG/M |
| 3300020582|Ga0210395_11115008 | Not Available | 582 | Open in IMG/M |
| 3300020583|Ga0210401_11147814 | Not Available | 635 | Open in IMG/M |
| 3300021178|Ga0210408_10147800 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1860 | Open in IMG/M |
| 3300021401|Ga0210393_11295764 | Not Available | 584 | Open in IMG/M |
| 3300021402|Ga0210385_11169850 | Not Available | 590 | Open in IMG/M |
| 3300021405|Ga0210387_10420403 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1185 | Open in IMG/M |
| 3300021405|Ga0210387_10728738 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
| 3300021405|Ga0210387_11634423 | Not Available | 547 | Open in IMG/M |
| 3300021406|Ga0210386_10097707 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2402 | Open in IMG/M |
| 3300021406|Ga0210386_11507347 | Not Available | 560 | Open in IMG/M |
| 3300021407|Ga0210383_11745585 | Not Available | 509 | Open in IMG/M |
| 3300021432|Ga0210384_11139792 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 684 | Open in IMG/M |
| 3300021432|Ga0210384_11524838 | Not Available | 574 | Open in IMG/M |
| 3300021478|Ga0210402_10827590 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Planctomonas → unclassified Planctomonas → Planctomonas sp. JC2975 | 851 | Open in IMG/M |
| 3300021479|Ga0210410_11621563 | Not Available | 540 | Open in IMG/M |
| 3300021560|Ga0126371_11584867 | Not Available | 781 | Open in IMG/M |
| 3300021560|Ga0126371_12994891 | Not Available | 572 | Open in IMG/M |
| 3300022533|Ga0242662_10322703 | Not Available | 520 | Open in IMG/M |
| 3300023090|Ga0224558_1145277 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 767 | Open in IMG/M |
| 3300024283|Ga0247670_1052643 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Virgisporangium → Virgisporangium ochraceum | 735 | Open in IMG/M |
| 3300024331|Ga0247668_1070256 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Virgisporangium → Virgisporangium ochraceum | 708 | Open in IMG/M |
| 3300025509|Ga0208848_1089157 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 630 | Open in IMG/M |
| 3300025574|Ga0208717_1020480 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1781 | Open in IMG/M |
| 3300025625|Ga0208219_1083044 | Not Available | 744 | Open in IMG/M |
| 3300025634|Ga0208589_1062048 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → unclassified Oscillatoriales → Oscillatoriales cyanobacterium SpSt-402 | 924 | Open in IMG/M |
| 3300025928|Ga0207700_11085356 | Not Available | 716 | Open in IMG/M |
| 3300025981|Ga0207640_10833429 | Not Available | 801 | Open in IMG/M |
| 3300026078|Ga0207702_11659065 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 632 | Open in IMG/M |
| 3300026377|Ga0257171_1057963 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300026557|Ga0179587_10341557 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 970 | Open in IMG/M |
| 3300026895|Ga0207758_1015400 | Not Available | 751 | Open in IMG/M |
| 3300026979|Ga0207817_1030465 | Not Available | 574 | Open in IMG/M |
| 3300027497|Ga0208199_1116416 | Not Available | 548 | Open in IMG/M |
| 3300027725|Ga0209178_1035150 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1583 | Open in IMG/M |
| 3300027765|Ga0209073_10314993 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300027795|Ga0209139_10361345 | Not Available | 507 | Open in IMG/M |
| 3300027854|Ga0209517_10321797 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. RKAG290 | 896 | Open in IMG/M |
| 3300027855|Ga0209693_10135733 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1216 | Open in IMG/M |
| 3300027855|Ga0209693_10442054 | Not Available | 626 | Open in IMG/M |
| 3300027884|Ga0209275_10330862 | Not Available | 850 | Open in IMG/M |
| 3300027894|Ga0209068_10576687 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300028565|Ga0302145_10246604 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales | 593 | Open in IMG/M |
| 3300028565|Ga0302145_10305354 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 526 | Open in IMG/M |
| 3300030730|Ga0307482_1018699 | All Organisms → cellular organisms → Bacteria | 1410 | Open in IMG/M |
| 3300031564|Ga0318573_10264506 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 918 | Open in IMG/M |
| 3300031572|Ga0318515_10309560 | Not Available | 847 | Open in IMG/M |
| 3300031572|Ga0318515_10353065 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 788 | Open in IMG/M |
| 3300031708|Ga0310686_105580046 | Not Available | 657 | Open in IMG/M |
| 3300031708|Ga0310686_116149444 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 588 | Open in IMG/M |
| 3300031720|Ga0307469_11801965 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → unclassified Rhodococcus → Rhodococcus sp. MTM3W5.2 | 591 | Open in IMG/M |
| 3300031723|Ga0318493_10533481 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 651 | Open in IMG/M |
| 3300031765|Ga0318554_10033330 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2773 | Open in IMG/M |
| 3300031765|Ga0318554_10608490 | Not Available | 615 | Open in IMG/M |
| 3300031765|Ga0318554_10861552 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300031778|Ga0318498_10145638 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1078 | Open in IMG/M |
| 3300031778|Ga0318498_10365214 | Not Available | 643 | Open in IMG/M |
| 3300031781|Ga0318547_10506760 | Not Available | 745 | Open in IMG/M |
| 3300031782|Ga0318552_10107718 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1380 | Open in IMG/M |
| 3300031797|Ga0318550_10533854 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Phycicoccus → unclassified Phycicoccus → Phycicoccus sp. Soil748 | 565 | Open in IMG/M |
| 3300031799|Ga0318565_10191410 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 995 | Open in IMG/M |
| 3300031819|Ga0318568_10371627 | Not Available | 890 | Open in IMG/M |
| 3300031821|Ga0318567_10647620 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 600 | Open in IMG/M |
| 3300031831|Ga0318564_10422674 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea → unclassified Nonomuraea → Nonomuraea sp. H16431 | 582 | Open in IMG/M |
| 3300031833|Ga0310917_10130510 | All Organisms → cellular organisms → Bacteria | 1644 | Open in IMG/M |
| 3300031846|Ga0318512_10682872 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 526 | Open in IMG/M |
| 3300031879|Ga0306919_10850002 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Phycicoccus → unclassified Phycicoccus → Phycicoccus sp. Soil748 | 700 | Open in IMG/M |
| 3300031880|Ga0318544_10163539 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 856 | Open in IMG/M |
| 3300031890|Ga0306925_11020322 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Saccharopolyspora | 842 | Open in IMG/M |
| 3300031893|Ga0318536_10552912 | Not Available | 577 | Open in IMG/M |
| 3300031894|Ga0318522_10169031 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Saccharopolyspora | 826 | Open in IMG/M |
| 3300031942|Ga0310916_10609901 | Not Available | 927 | Open in IMG/M |
| 3300031942|Ga0310916_10916317 | Not Available | 734 | Open in IMG/M |
| 3300031942|Ga0310916_11579302 | Not Available | 533 | Open in IMG/M |
| 3300031945|Ga0310913_10361196 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1028 | Open in IMG/M |
| 3300031946|Ga0310910_11110138 | Not Available | 616 | Open in IMG/M |
| 3300031946|Ga0310910_11472193 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 523 | Open in IMG/M |
| 3300031954|Ga0306926_11280234 | Not Available | 857 | Open in IMG/M |
| 3300031959|Ga0318530_10166171 | All Organisms → cellular organisms → Bacteria | 900 | Open in IMG/M |
| 3300032001|Ga0306922_10668663 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1095 | Open in IMG/M |
| 3300032001|Ga0306922_10860171 | Not Available | 944 | Open in IMG/M |
| 3300032008|Ga0318562_10651358 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 607 | Open in IMG/M |
| 3300032009|Ga0318563_10348443 | Not Available | 801 | Open in IMG/M |
| 3300032035|Ga0310911_10272637 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 971 | Open in IMG/M |
| 3300032041|Ga0318549_10299308 | Not Available | 725 | Open in IMG/M |
| 3300032044|Ga0318558_10384345 | Not Available | 698 | Open in IMG/M |
| 3300032044|Ga0318558_10499458 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 607 | Open in IMG/M |
| 3300032051|Ga0318532_10217452 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Candidatus Dormibacteraeota → unclassified Candidatus Dormibacteraeota → Candidatus Dormibacteraeota bacterium | 678 | Open in IMG/M |
| 3300032052|Ga0318506_10268842 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 756 | Open in IMG/M |
| 3300032052|Ga0318506_10339655 | Not Available | 666 | Open in IMG/M |
| 3300032054|Ga0318570_10353960 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300032054|Ga0318570_10506695 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 551 | Open in IMG/M |
| 3300032063|Ga0318504_10291423 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 772 | Open in IMG/M |
| 3300032090|Ga0318518_10532382 | Not Available | 601 | Open in IMG/M |
| 3300032160|Ga0311301_10398350 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 2110 | Open in IMG/M |
| 3300032160|Ga0311301_11056509 | Not Available | 1064 | Open in IMG/M |
| 3300032515|Ga0348332_10305928 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → unclassified Acidimicrobiales → Acidimicrobiales bacterium | 1204 | Open in IMG/M |
| 3300032770|Ga0335085_10062078 | All Organisms → cellular organisms → Bacteria | 4987 | Open in IMG/M |
| 3300032770|Ga0335085_10463851 | All Organisms → cellular organisms → Bacteria | 1454 | Open in IMG/M |
| 3300032805|Ga0335078_10128122 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3621 | Open in IMG/M |
| 3300032828|Ga0335080_10287518 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1789 | Open in IMG/M |
| 3300032828|Ga0335080_10768264 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 998 | Open in IMG/M |
| 3300032892|Ga0335081_12254243 | Not Available | 571 | Open in IMG/M |
| 3300032897|Ga0335071_10038257 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4752 | Open in IMG/M |
| 3300032897|Ga0335071_11647722 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300032954|Ga0335083_11343880 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300033134|Ga0335073_11047515 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Saccharopolyspora | 838 | Open in IMG/M |
| 3300033134|Ga0335073_12024622 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 526 | Open in IMG/M |
| 3300033158|Ga0335077_11343688 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 692 | Open in IMG/M |
| 3300033289|Ga0310914_10015792 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5743 | Open in IMG/M |
| 3300033807|Ga0314866_065276 | Not Available | 616 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 28.51% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 7.24% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.88% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 5.43% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.98% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.98% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.62% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.62% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.17% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.71% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 2.26% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.26% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.36% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.36% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.36% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.36% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.81% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.81% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.45% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.45% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.45% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.45% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.45% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.45% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.45% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.45% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.45% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.45% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.45% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.45% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.45% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.45% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.45% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.45% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.45% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.45% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.91% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.91% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.91% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.91% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.91% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.91% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.91% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459013 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis soil at the rocks surface 0-21cm | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Host-Associated | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005162 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAB | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006577 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006578 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006795 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-B | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009623 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300014655 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaG | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300023090 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 20-24 | Environmental | Open in IMG/M |
| 3300024283 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK11 | Environmental | Open in IMG/M |
| 3300024331 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09 | Environmental | Open in IMG/M |
| 3300025509 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025574 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-3 shallow (SPAdes) | Environmental | Open in IMG/M |
| 3300025625 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025634 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-2 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026377 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-B | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300026895 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 12 (SPAdes) | Environmental | Open in IMG/M |
| 3300026979 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 13 (SPAdes) | Environmental | Open in IMG/M |
| 3300027497 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027795 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028565 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_3 | Environmental | Open in IMG/M |
| 3300030730 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033807 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_10 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| N57_08147940 | 2170459013 | Grass Soil | VAKIRNWINTHTDQVIILGSLILGFWLIGNSIYLIV |
| JGI10216J12902_1101019332 | 3300000956 | Soil | WINTHTDQVIIAGSLIIGLWLVANSIYLIATETG* |
| JGI24752J21851_10586122 | 3300001976 | Corn, Switchgrass And Miscanthus Rhizosphere | LIRFRSWIDSHTDQVIILGSFILGFWLIANSMYLVFT* |
| Ga0063454_1006914653 | 3300004081 | Soil | SQTQAFLIRTRTWIDAHTDQVVIVVSLVLGFWLVADSIYLILT* |
| Ga0062387_1007126823 | 3300004091 | Bog Forest Soil | SRALMGRFRAWINDHTDQVIIVGSLVIGLWLIADDIYLVVS* |
| Ga0066814_101122302 | 3300005162 | Soil | ALLARPRARIDAHTDQGIIAGSLIIGLWLIASSIYLIVSQTAST* |
| Ga0066388_1053042541 | 3300005332 | Tropical Forest Soil | QELLARFRTWIDDHTDQAIIAGSLIIGLWLIANSLYLIITQTTST* |
| Ga0070713_1007775353 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | AFLARFRTWMDTRTDQVIIVGSLVLGFWLIANSIYLIVS* |
| Ga0070713_1009396101 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | SRPGQSQELLARFRTRIDTHTDQMIIAGSLVIGCWLIADSLYLIVSQTASA* |
| Ga0070713_1012090321 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | QSQVLLARFRTWIDTHTDQVIIYGSLILGFWLIANSIYLIVT* |
| Ga0070713_1021435141 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | AFLARFRTWMETHTDQVIIVGCFILGFWLIASSINLIRA* |
| Ga0073909_102196511 | 3300005526 | Surface Soil | ARTRTWIDTHTDQAIIILSLGLGFWLIADSIYLLVT* |
| Ga0068853_1001644041 | 3300005539 | Corn Rhizosphere | DQTLLIRFRSWIDSHTDQVIILGSFILGFWLIANSMYLVFT* |
| Ga0066695_105978541 | 3300005553 | Soil | FRTRIDTHTDQMIIAGSLIIGFWLIANSLYLIVSQTAST* |
| Ga0068864_1009899891 | 3300005618 | Switchgrass Rhizosphere | LRRARTWIDSHTDQVIIAGSLIIGFWLIADSIYLLVT* |
| Ga0081455_103190292 | 3300005937 | Tabebuia Heterophylla Rhizosphere | VARPGPAQDLLARIRTRIDTHTDQMIIAGSLIIGLWLIADSLYLIVTQTTSA* |
| Ga0081540_11345182 | 3300005983 | Tabebuia Heterophylla Rhizosphere | RFKSWIDSHTDQAIILGSFILGFWLIANSVYLIFT* |
| Ga0070717_117702422 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | RSQALLAGFRTWIDAHTDQVIIWGSLILGFWLIANSINLIVS* |
| Ga0075029_1013403813 | 3300006052 | Watersheds | TQAFLARTKTWIDTHTDQVIIIVSLVLGLWLVGYSIYLVIT* |
| Ga0075026_1000659941 | 3300006057 | Watersheds | RIRAWIDSHTDQVIVILSLGLGLYLVASSAYYLFT* |
| Ga0070712_1000941264 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | FLARLRHWIDTHTDQVIIIVSLVLGFWLIGNSIYYLIT* |
| Ga0070712_1003108161 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | FLARCRSWIERHTDQAIVIGCLILGFWLIVNSIYLIVS* |
| Ga0070765_1001930363 | 3300006176 | Soil | RPDQNKAFVDRFRAWIDAHTDQAIIVGGLILGLWFIGRSIYLIVT* |
| Ga0097621_1018172931 | 3300006237 | Miscanthus Rhizosphere | VKAWIDTHTDQAIIIVPVLLGLWLIGKGSYLLAT* |
| Ga0075021_101342452 | 3300006354 | Watersheds | SLRNWISTHSDQVIIIVSLVAGFWLIGKSVATLVS* |
| Ga0074050_120000811 | 3300006577 | Soil | AFLARARAWIERHTDQAIVIGCLILGFWLIANSIYLIVT* |
| Ga0074059_119467431 | 3300006578 | Soil | FRAWIDAHTDQAIIGGSLIIGLYLIVKDIYLIVT* |
| Ga0074059_121664851 | 3300006578 | Soil | ESQIFVAKIRTWINTHTDQVIILGSLILGFWLIGNSIYLIVT* |
| Ga0075520_12019301 | 3300006795 | Arctic Peat Soil | QAFLARTRTWIDTHTDQVIIVVSLILGFYLIGKSIYVLVT* |
| Ga0066660_109740132 | 3300006800 | Soil | ARLRHWIDTHTDQVIIIVSLVLGFWLVGNSIYYIVT* |
| Ga0075425_1011234372 | 3300006854 | Populus Rhizosphere | LIRFRSWIDSHTDQVIILGSFILGFWLIANSMYLVFA* |
| Ga0075425_1026571622 | 3300006854 | Populus Rhizosphere | RFQTWINTHTDQFVIAGSLIIGLWLVANSIYLIVTGTGG* |
| Ga0075434_1010616371 | 3300006871 | Populus Rhizosphere | ARTWIDSHTDQVIIAGSLIIGFWLIADSIYLLVT* |
| Ga0075434_1022266442 | 3300006871 | Populus Rhizosphere | QAFLARCRAWIERHTDQAIVIGCLILGFWLIVNSIYLIVN* |
| Ga0075424_1018009031 | 3300006904 | Populus Rhizosphere | LIRFRSWIDSHTDQVIIIGSFILGFWLIANSMYLVFT* |
| Ga0079219_112640011 | 3300006954 | Agricultural Soil | RFRTWIDTHTDQVIIIGSLLLGLWLIANSIYLIVT* |
| Ga0105251_100835463 | 3300009011 | Switchgrass Rhizosphere | ESQIFVAKIRTWINTHTDQVIIFGSLILGFWLIGNSIYLIVT* |
| Ga0105245_111127472 | 3300009098 | Miscanthus Rhizosphere | LARFRTWIDTHTDQVIIYGSLILGLWLIANSVYLIVT* |
| Ga0105242_100238751 | 3300009176 | Miscanthus Rhizosphere | KIRTWINTHTDQVIIFGSLILGFWLIGNSIYLIVT* |
| Ga0116220_105509671 | 3300009525 | Peatlands Soil | ARFRTWIETHTDQVIIAGSLILGFWLIAKSIYLIVT* |
| Ga0116133_10072451 | 3300009623 | Peatland | QEFLTRSRHWIDTHTDQVIIIVSLVLGFWLVATSIYYIVT* |
| Ga0116217_100939591 | 3300009700 | Peatlands Soil | LARFRTWINTRTERVIIVGSLVIGLWLIADSIYLVIS* |
| Ga0126374_107418601 | 3300009792 | Tropical Forest Soil | TQAFLVRCRTWIEDHTDQVIIIGSLVIGFWLIGDSIYLLVT* |
| Ga0126373_119807831 | 3300010048 | Tropical Forest Soil | EFLARIQTWITDHTDQVIIYGSLILGFWLIANSLYIVLQ* |
| Ga0126373_130302352 | 3300010048 | Tropical Forest Soil | ALMGRFRTWVDTHTDQVIIVGSLIIGFWLIGDSIYLIVT* |
| Ga0127503_109921142 | 3300010154 | Soil | LLAKIRTWINGHTDQAIILGSLILGFWLIANSIYLIVT* |
| Ga0074044_106137801 | 3300010343 | Bog Forest Soil | ARLRHWIDTHTDQVIIIVSLVLGFWLIGNSIYYIVT* |
| Ga0126372_103611991 | 3300010360 | Tropical Forest Soil | GKSQAFLAWVRTWIDAHTDQVIIAGSLILGLWLIGYSNYLVVT* |
| Ga0126372_121216261 | 3300010360 | Tropical Forest Soil | QAFLLRCRTWIDDHTDQAIIVGSLVIGLFLIGDSIYLIVT* |
| Ga0126378_107064081 | 3300010361 | Tropical Forest Soil | TQAFLVRCRTWIEDHTDQVIIVGSLLIGFWLIGDSIYLIVT* |
| Ga0136449_1019390151 | 3300010379 | Peatlands Soil | LLARFRSWIDAHTDQVIIGGSLIIGLWLIAKDIYLIV* |
| Ga0136449_1025835063 | 3300010379 | Peatlands Soil | LARFRSWIDTHTDQVIIWGSLVVGFWLIADGIYLIVT* |
| Ga0136449_1032532002 | 3300010379 | Peatlands Soil | LARLRHWIDTHTDQVIIIVSLVLGFWLVGTSIYYIVT* |
| Ga0136449_1037847883 | 3300010379 | Peatlands Soil | LARFRTWMEAHTDQVIILVSFIFGFWLTANSINLVVT* |
| Ga0136449_1046477221 | 3300010379 | Peatlands Soil | AFLARFRTWMETHTDQVIILGSLILGFWLIANSIYLIVT* |
| Ga0137364_101568441 | 3300012198 | Vadose Zone Soil | TRFRTWIDSHTDQVIILGSFILGFWLIANSMYLIFT* |
| Ga0137374_110824811 | 3300012204 | Vadose Zone Soil | QVLLARFRTWIDTHTDQVIIYGSLLLGLWLIANSTYLIVT* |
| Ga0137362_111770642 | 3300012205 | Vadose Zone Soil | LAGFRTWISTHTQPVIIWGILIVGLWLIANSIYLILT* |
| Ga0137381_103058532 | 3300012207 | Vadose Zone Soil | ARFRTWIDTHTDQVIIYGSLLLGLWLIANSIYLIVT* |
| Ga0137381_107507152 | 3300012207 | Vadose Zone Soil | LRHWIDTHTDQVIIIVSLVLGFWLVGNSIYYLIT* |
| Ga0137384_108467831 | 3300012357 | Vadose Zone Soil | QVLLARFRTWIDTHTDQVIIYGSLLLGLWLIANSIYLIVT* |
| Ga0137361_115678241 | 3300012362 | Vadose Zone Soil | TRAWIDSHTDQVIVIVSLVLGFWLIADSIYLIVS* |
| Ga0137396_107904271 | 3300012918 | Vadose Zone Soil | RFRTWIGTHTQPVIIWGSLVVGLWLIANSIYLIVT* |
| Ga0137413_113703731 | 3300012924 | Vadose Zone Soil | RPGQSQELLARFRTRIDTHTDQMIIAGSLVIGFWLIANSLYLIVSQTA* |
| Ga0137413_116421771 | 3300012924 | Vadose Zone Soil | RFRTWIDAHTDQVIIWGSLILGFWLIANSINLVVS* |
| Ga0164300_101844391 | 3300012951 | Soil | KIRTWINTHTDQVIILGSLLLGFWLIGNSIRLIVT* |
| Ga0164303_104235041 | 3300012957 | Soil | QSKALLARFRTWIDTHTDQVIIVGSLLLGFWLIANSIYLIVTETGG* |
| Ga0164309_105711063 | 3300012984 | Soil | LTKIRTWINTHTDQVIILGSLLLGFWLIGNSIYLIVT* |
| Ga0164305_100448291 | 3300012989 | Soil | RSQIFLTRIRTWINTHTDQVIILGSLILGFWLIGNSIRLIVT* |
| Ga0157369_121137442 | 3300013105 | Corn Rhizosphere | EFLARSRRWIDTHTDQVIVIVSLVLGFWLVATSIYYIVT* |
| Ga0181523_106089361 | 3300014165 | Bog | RLRTWIDTHTDQVIIWGSLILGFWLIAYSITLIVT* |
| Ga0181516_104936432 | 3300014655 | Bog | ALLASSRTWIDSHTDQVIIVVSLVLGFWLIGKSIYLIVS* |
| Ga0157379_125037601 | 3300014968 | Switchgrass Rhizosphere | EIYAGFRAAQSQAFLVTFRTWMDTHTDQMIIVGSLLVGFWLIARSIYLIIT* |
| Ga0132255_1062337472 | 3300015374 | Arabidopsis Rhizosphere | ALLGRTRPWIDTHTDQVIIAGSLILGFWLIANSIYLIIT* |
| Ga0182036_108981242 | 3300016270 | Soil | LLARFQAWINTHTDQVIIAGSLILGLWLMGNSIYLIVTQTSG |
| Ga0182033_115752322 | 3300016319 | Soil | VFLAKFRAWMDTHTDQVIIAGSLVLGFWLIGKSIYLIIT |
| Ga0182033_121597422 | 3300016319 | Soil | AWIDAHTDQGITAGSLLIGLWLIANSIYLIVSQTAST |
| Ga0182032_100441373 | 3300016357 | Soil | MPLFWTGQSQASLARIRTWIDSHTDWLIIAGSLILGFWLIGKS |
| Ga0182032_105574442 | 3300016357 | Soil | IDTHTDQVIIAGSLIIGLWLIANSLYLIVSQSSST |
| Ga0182040_110777572 | 3300016387 | Soil | LGLEIYAAFWTGQSQASLARIRTWIDSHTDWLIIAGSLILGFWLIGKSIYLIVS |
| Ga0182037_103870471 | 3300016404 | Soil | IDTHTDQVIIAGSLLIGLWLIANSIYLIVSQTAST |
| Ga0182038_121769681 | 3300016445 | Soil | AVFRFDQSQALLARVRKWIDDHTDQVIIVGALVLGFWLIGNSIYLIVDA |
| Ga0187807_10243311 | 3300017926 | Freshwater Sediment | LARLRHWIDTHTDQVIIIVSLVLGFWLIGNSIYYIVT |
| Ga0187814_101045321 | 3300017932 | Freshwater Sediment | GQSQAFLARFRTWIDVHTDQVIIVGSLILGFWLIGKSIYLIVT |
| Ga0187809_102037351 | 3300017937 | Freshwater Sediment | PDETQMLLKRIRTWMDTHTDQVIIVGSLILGFWLIGHSIYLIVTA |
| Ga0187808_102132153 | 3300017942 | Freshwater Sediment | SQALMGRFRTWADTHTDQVIIAGRLIIGFRLIGDSIYLAVT |
| Ga0187808_103069942 | 3300017942 | Freshwater Sediment | LARFRTWIDTHTDQVIIIGSLILGFWLIGNSIYLVVT |
| Ga0187879_100470571 | 3300017946 | Peatland | QEFLTRSRHWIDTHTDQVIIIVSLVLGFWLVATSIYYIVT |
| Ga0187817_104095821 | 3300017955 | Freshwater Sediment | SDRSQAFLAGVQKWIDTNTDQLIVIGSLVLGFWLIADSLYLIIS |
| Ga0187781_111981102 | 3300017972 | Tropical Peatland | LALEAYAGLWTSRSRPFLARFRTWMDTHTDQLIIAGSLILGLWLIGKSIYLIVA |
| Ga0187780_105401081 | 3300017973 | Tropical Peatland | ALEIYAGFWASRSQPVLARFRTWMDTHTDQLIIVGSLVVGFWLIAKSIYLAVT |
| Ga0187780_109117191 | 3300017973 | Tropical Peatland | QELMGGFRTWIDTHTDQVIIVGSLLIGLWLIGDSIYLIVS |
| Ga0187777_104926032 | 3300017974 | Tropical Peatland | YARFWTGQSQVSLARFRTWIDSHTGQLIIAGSLIVGFWLIGKSLYLIVG |
| Ga0187777_112196081 | 3300017974 | Tropical Peatland | ALLARLRTWIDTHTDQVIIVGSLLIGFWLIANSIYLIVSA |
| Ga0187782_107364481 | 3300017975 | Tropical Peatland | RPGQSQASLARFRTWIDSHTDQLIVVGSLIVGFWLIAKSIYLIVG |
| Ga0187816_102167882 | 3300017995 | Freshwater Sediment | QQFLARLRHWIDTHTDQVIIIVSLVLGFWLIGNSIYYLVT |
| Ga0187875_1000218511 | 3300018035 | Peatland | AQEFLTRSRHWIDTHTDQVIIIVSLVLGFWLVATSIYYIVT |
| Ga0187766_103011711 | 3300018058 | Tropical Peatland | SQALLAKFRAWIDDHTDQVIIVGSVAIGLWLIANSIYLIVS |
| Ga0187766_105130051 | 3300018058 | Tropical Peatland | AVRPEQSQALLGRFRKWIDSHTDQVIIWGSLIVGFWLIANSIYVLVS |
| Ga0187766_107623712 | 3300018058 | Tropical Peatland | PFYAAFWTGRSQASLARFRTWIDSHTDQLIIAGSLILGFWLIGKSIYLIVS |
| Ga0187766_107909992 | 3300018058 | Tropical Peatland | YAGFWASRSQPVLARFRTWMDTHTDQLIIVGSLVLGFWLIGKSIYLVVT |
| Ga0187766_109307042 | 3300018058 | Tropical Peatland | AFLARFRTWIDVHTDQVIIAGSLILGFWLIGKSIYLIVT |
| Ga0187765_112588622 | 3300018060 | Tropical Peatland | IYAGFWKGQSQPVLARFRTWIDAHTDQIIIVGSLVLGFWLIGKSIYLIVT |
| Ga0187772_110781501 | 3300018085 | Tropical Peatland | RFRTWIDTHTDQVIIVGSLIIGFWLIGDSIYLIVT |
| Ga0187772_111937421 | 3300018085 | Tropical Peatland | ESQVFLGRVRAWIDSHTDQVIILGSLILGFWLIGHSIYLIVTSTS |
| Ga0187770_102874781 | 3300018090 | Tropical Peatland | WTSQSQAFLARFRTWIDAHTDQIITAGSLILGFWLIGKSIYLIVT |
| Ga0187770_115374721 | 3300018090 | Tropical Peatland | LLVRSRNWIDTHTDQVIVAGSLIIGLWLIADSIYLIVS |
| Ga0066669_108816032 | 3300018482 | Grasslands Soil | AFLSRTRAWIDSHTDQVIVIVSLVLGFWLIADSIYLIVS |
| Ga0197907_106774612 | 3300020069 | Corn, Switchgrass And Miscanthus Rhizosphere | QIFVAKIRTWINTHTDQVIIFGSLILGFWLIGNSIYLIVT |
| Ga0210403_111225962 | 3300020580 | Soil | GFRTWIDAHTDQVIIWGSLIVGFWLIANGINLILA |
| Ga0210399_104300941 | 3300020581 | Soil | IYAAVRPEQSQALLARIRKWIDSHTDQAIIWGSLIVGFWLIANSLYVILS |
| Ga0210395_111150082 | 3300020582 | Soil | SQVLLARFRTWIDTHTDQVIIYGSLILGLWLIANSVYLIVT |
| Ga0210401_111478141 | 3300020583 | Soil | FLTRFRTWIDTHTDQVIIIGSLLLGLWLIANSIYLIVT |
| Ga0210408_101478001 | 3300021178 | Soil | RTRIDTRTDQMIIVGSLIIGFWLIANSLYLIVSQTAST |
| Ga0210393_112957642 | 3300021401 | Soil | TRLRHWIDTHTDQVIIIVSLVLGFWLVGNSIYYIVT |
| Ga0210385_111698502 | 3300021402 | Soil | QDFLTRTRHWIDTHTDQVIVIVSLVLGFWLVADSIYYIVT |
| Ga0210387_104204032 | 3300021405 | Soil | QLLLARFRAWMETHTDQVIIFGGLILGFWLIANSLYLIIT |
| Ga0210387_107287381 | 3300021405 | Soil | AFLTRFRTWIDSHTDQVIILGSLILGFWLIANSMYLIFT |
| Ga0210387_116344231 | 3300021405 | Soil | TRFRTWIDTHTDQVIIIGSLLLGLWLIANSIYLIVT |
| Ga0210386_100977075 | 3300021406 | Soil | MEIYAIIRPDQSKAFLDRFRAWIDAHTDQAIIAGGLILGFWFIAKSIYLIVT |
| Ga0210386_115073471 | 3300021406 | Soil | FLDRFRAWIDAHTDQAIIAGGLILGLWFIAKSIYLIVT |
| Ga0210383_117455851 | 3300021407 | Soil | QVLLARFRTWIDTHTDQVIIYGSLILGLWLIANSVYLIVT |
| Ga0210384_111397921 | 3300021432 | Soil | AFLTRFRTWIDTHTDQVIIIGSLLLGLWLIANSIYLIVT |
| Ga0210384_115248381 | 3300021432 | Soil | AFLARFRTWMETHTDQVIIVGCLILGFWLIASSINLIRA |
| Ga0210402_108275902 | 3300021478 | Soil | VSRPSQSQELLARIRTRIDTHTDQMIIVGSMIIGFWLIANSLYLIVSQTAST |
| Ga0210410_116215631 | 3300021479 | Soil | QAFLTRFRTWIDTHTDQVIIIGSLLLGLWLIANSIYLIVT |
| Ga0126371_115848671 | 3300021560 | Tropical Forest Soil | SQALLARFRAWIDDHTDQVIIVGSLLIGFWLIGDSIYLAVT |
| Ga0126371_129948913 | 3300021560 | Tropical Forest Soil | ARFRAWIDSHTDQLIIAGGLLLGLWLIGKSIYLIVS |
| Ga0242662_103227031 | 3300022533 | Soil | EQSQAFLTRFRTWIDTHTDQVIIIGSLLLGLWLIANSIYLIVT |
| Ga0224558_11452771 | 3300023090 | Soil | ARTRTWIDTHTDQVIIVVSLILGFYLIGKSIYVLVT |
| Ga0247670_10526431 | 3300024283 | Soil | ALLRRAQTWIDSHTDQVIIAGSLIIGFWLIADSIYLLVT |
| Ga0247668_10702561 | 3300024331 | Soil | QALLRRAQTWIDSHTDQVIIAGSLIIGFWLIADSIYLLVT |
| Ga0208848_10891571 | 3300025509 | Arctic Peat Soil | AQRFLARSRHWIDSHTDQVIIIVSLVLGFWLVATSIYYIVT |
| Ga0208717_10204801 | 3300025574 | Arctic Peat Soil | QDFLARSRHWIDTHTDQVIVIVSLVLGFWLVATSIYYIVT |
| Ga0208219_10830442 | 3300025625 | Arctic Peat Soil | PAQEFLTRSRRWISTHTDQVIIIVSLVLGFWLVATSIYYIVT |
| Ga0208589_10620481 | 3300025634 | Arctic Peat Soil | AGFRIWIDAHTDQVIIWGSLILGFWLIANSINLVIS |
| Ga0207700_110853562 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | LARFRTWIDTHTDQVIIYGSLILGFWLIANSIYLIVT |
| Ga0207640_108334292 | 3300025981 | Corn Rhizosphere | RFRTWIDTHTDQVIIYGSLILGFWLIANSVYLIVT |
| Ga0207702_116590652 | 3300026078 | Corn Rhizosphere | AKIRTWINAHTDQVIIFGSLILGFWLIANSIYLIVT |
| Ga0257171_10579631 | 3300026377 | Soil | RFRTWIGTHTQPVIIWGSLIVGLWLIANSIYLIVT |
| Ga0179587_103415572 | 3300026557 | Vadose Zone Soil | PGKSRALLARFRTWIDAHTDQVIIWGSLILGFWLIANSINLVVS |
| Ga0207758_10154003 | 3300026895 | Tropical Forest Soil | MGRFRTWISDHTDQVIIVGSLLIGFWLIGDSIYLIVT |
| Ga0207817_10304651 | 3300026979 | Tropical Forest Soil | QASLARFRTWIDAHTDQLIIAGSLILGCWLIGKSIYLILS |
| Ga0208199_11164161 | 3300027497 | Peatlands Soil | FLARLRHWIDTHTDQVIIIVSLVLGFWLIGNSIYYILT |
| Ga0209178_10351501 | 3300027725 | Agricultural Soil | KALLARFRTWIDTHTDQVIIYGSLILGFWLIANSVYLIVT |
| Ga0209073_103149931 | 3300027765 | Agricultural Soil | RFRNWIDSHTDQVIILGSFILGFWLIANSMYLVFA |
| Ga0209139_103613452 | 3300027795 | Bog Forest Soil | AQEFLARSRHWIDTHTDQVILIVSLILGFWLVATSIYYIVT |
| Ga0209517_103217971 | 3300027854 | Peatlands Soil | DQNKAFLDRFRAWIDAHTDQVIIAGGLILGLWFIGKSIYLIVT |
| Ga0209693_101357331 | 3300027855 | Soil | LARLRHWIDTHTDQVIIIASLVLGFWLVGNSIYYIVT |
| Ga0209693_104420543 | 3300027855 | Soil | LLGRFRTWMETHTDQVIILGSLILGFWLIANSLYLIIT |
| Ga0209275_103308622 | 3300027884 | Soil | LASVRQWIDTHTDQVIIVVSLVLGFWLIGKSAYLLAT |
| Ga0209068_105766871 | 3300027894 | Watersheds | LLARLRTWLDNNTDQVIIIVSLVIGFWLIGDSIYLVVT |
| Ga0302145_102466041 | 3300028565 | Bog | ARIRTWISGHTDQVIVGISGVLGIWLVATSSYALLT |
| Ga0302145_103053542 | 3300028565 | Bog | RIRNWIDTHTDQVIIIGSIALGFYLIGKSIYALVT |
| Ga0307482_10186991 | 3300030730 | Hardwood Forest Soil | RAWIDAHTDQGIIAGSLIIGFWLIANSIYLIVSQTASA |
| Ga0318573_102645062 | 3300031564 | Soil | ALLNRARTWIDTHTDQVIIVGSLIIGFWLIGDSLYLIVS |
| Ga0318515_103095601 | 3300031572 | Soil | FLVRFRTWMDTHTDQVIIVVSLVLGLWLIAKSTYLIIIT |
| Ga0318515_103530652 | 3300031572 | Soil | TQAFLVRCRTWIEDHTDQVIIVGSLLIGFWLIGDSIYLAVT |
| Ga0310686_1055800462 | 3300031708 | Soil | EECRAFLLRMRAWIGAHTDQVIIVVSLALGFWLIGKSSYYLAT |
| Ga0310686_1161494441 | 3300031708 | Soil | RFKTWMDTRTDQVIIVGSLILGFWLIGSSIYLIVS |
| Ga0307469_118019652 | 3300031720 | Hardwood Forest Soil | RFRSWIDSHTDQVIIIGSFILGFWLIANSMYLVFT |
| Ga0318493_105334811 | 3300031723 | Soil | LARCRTWIEDHTDQVIIIGSLAIGFWLIASSIYLIVT |
| Ga0318554_100333301 | 3300031765 | Soil | RPGPAQELLARFRTRIDTHTDQVIIAGSLIIGLWLIANSLYLIVSQTAST |
| Ga0318554_106084902 | 3300031765 | Soil | IDAHTDQGITAGSLLIGLWLIANSIYLIVSQTAST |
| Ga0318554_108615521 | 3300031765 | Soil | QALLARFRTWINSHTDQVIIVGSLIIGFWLIANSIYLIVT |
| Ga0318498_101456384 | 3300031778 | Soil | LLNRARTWIDTHTDQVIIVGSLIIGFWLIGDSLYLIVS |
| Ga0318498_103652142 | 3300031778 | Soil | ELLARFRARIDTHTDQVIIAGSLLIGLWLIANSIYLIVSQTAST |
| Ga0318547_105067601 | 3300031781 | Soil | FLVRCRTWIEDHTDQVIIVGSLLIGFWLIGDSIYLAVT |
| Ga0318552_101077181 | 3300031782 | Soil | QSQALLARFRTWIDTHTDQVIIVGSLIIGFWLIANSIYLIVT |
| Ga0318550_105338542 | 3300031797 | Soil | FRARIDTHTDQVIIAGSLLIGLWLIANSLYLIVSQTAST |
| Ga0318565_101914102 | 3300031799 | Soil | VHAAVRPTQSRALLGRVRTWIDTHEDQVIIVGSLILGFWLIAHSIYLIVT |
| Ga0318568_103716272 | 3300031819 | Soil | LVRIRAWIEDHTDQVIIIGSLLIGFWLIGDSIYLLVT |
| Ga0318567_106476201 | 3300031821 | Soil | PAETQAFLVRCRTWIEDHTDQVIIIGSLLIGFWLIGNSVYLIVQ |
| Ga0318564_104226742 | 3300031831 | Soil | LNRARTWIDTHTDQVIIVGSLIIGFWLIGDSLYLIVS |
| Ga0310917_101305101 | 3300031833 | Soil | GPAQELLARFRTRIDTHTDQVIIAGSLIIGLWLIANSLYLIVSQTAST |
| Ga0318512_106828721 | 3300031846 | Soil | ALLARFRTWIDTHTDQVIISGSLILGIWLIANSLYLILT |
| Ga0306919_108500021 | 3300031879 | Soil | ELLARFRARIDTHTDQVIIAGSLLIGLWLIANSLYLIVSQTAST |
| Ga0318544_101635392 | 3300031880 | Soil | LARFRKWIDSHTDQVIIWGSLIVGFWLIANSLYVIFS |
| Ga0306925_110203221 | 3300031890 | Soil | LVRFRTWLDTHTDQVIIAGSLLLGFWLIAKSIYLIIT |
| Ga0318536_105529121 | 3300031893 | Soil | RFRTWMDTHTDQVIIVVSLVLGLWLIAKSTYLIIT |
| Ga0318522_101690312 | 3300031894 | Soil | QSQAFLVRFRTWMDTHTDQVIIVVSLVLGLWLIAKSTYLIIIT |
| Ga0310916_106099011 | 3300031942 | Soil | TGFRTWIDDHTDQFIIWGSLIIGLWLIGNSLYLVTS |
| Ga0310916_109163171 | 3300031942 | Soil | TQAFLVRCRAWINDHTDQVIIVGSLLIGFWLIGDSIYLAVT |
| Ga0310916_115793021 | 3300031942 | Soil | LAMFRNWIDTHTDQVIIVGSLALGVWLIANSIYLIE |
| Ga0310913_103611961 | 3300031945 | Soil | RFRKWIDSHTDQVIIWGSLIVGFWLIANSLYVIFS |
| Ga0310910_111101381 | 3300031946 | Soil | LVRCRTWIEDHTDQVIIIGSLLIGFWLIGDSIYLLVT |
| Ga0310910_114721931 | 3300031946 | Soil | SQALLARVRGWIDSHTEQVIILGSLIIGLWLIANSIYLIVS |
| Ga0306926_112802341 | 3300031954 | Soil | ARFRAWIDHHTDQVIIVGSLLIGFWLIGNSIYLAVT |
| Ga0318530_101661713 | 3300031959 | Soil | LLARIREWIDTHTDQLIIWVSLVVGCWLIGKSIYLIVT |
| Ga0306922_106686632 | 3300032001 | Soil | AFLTRLRAWIDGHTDQVITLGSLIVGLWLIADSTYLIVSQTSG |
| Ga0306922_108601711 | 3300032001 | Soil | VARPGPARDLLVRFRTRIDTHTDQVIIAGSLIIGLWLIANSLYLIVSQASST |
| Ga0318562_106513581 | 3300032008 | Soil | QAFLGSFRKWIDSHTDQVIIWGSLIVGFWLIANSLYVIFS |
| Ga0318563_103484432 | 3300032009 | Soil | VRCRAWINDHTDQVIIVGSLLIGFWLIGDSIYLAVT |
| Ga0310911_102726373 | 3300032035 | Soil | RIDTHTDQVIIAGSLIIGLWLIANSLYLIVSQTAST |
| Ga0318549_102993081 | 3300032041 | Soil | FRTRIDAHTDQVIIAGSLIIGLWLIANSLYLIVSQTSST |
| Ga0318558_103843452 | 3300032044 | Soil | PARDLLARFRTRIDAHTDQVIIAGSLIIGLWLIANSLYLIVSQTSST |
| Ga0318558_104994581 | 3300032044 | Soil | MPLFWTGQSQASLARIRTWIDSHTDWLIIAGSLILGFWLIGKSIYLIVS |
| Ga0318532_102174522 | 3300032051 | Soil | RFQAWINTHTDQVIIAGSLILGLWLMGNSIYLIVTQTSG |
| Ga0318506_102688422 | 3300032052 | Soil | TQAFLVRCRTWIEDHTDQVIIIGSLLIGFWLIGDSIYLIVT |
| Ga0318506_103396552 | 3300032052 | Soil | GQAFLARFRTWTDAHTGQIIIAGSLLLGCWLIAKSSYLLLT |
| Ga0318570_103539602 | 3300032054 | Soil | SQVLLARFRAWINTHTDQLIIAGSLILGLWLIANSIYLIVT |
| Ga0318570_105066951 | 3300032054 | Soil | VFLAKFRAWMDTHTDQVIIAGSLLLGLWLIAKSIYLIVS |
| Ga0318504_102914232 | 3300032063 | Soil | DPGQSQAFLARVRTWIDAHTDQVIIAGSLILGFRLIGYGSYLVVT |
| Ga0318518_105323821 | 3300032090 | Soil | ARFRTRIDAHTDQVIIAGSLIIGLWLIANSLYLIVSQTSST |
| Ga0311301_103983503 | 3300032160 | Peatlands Soil | QPAQAFLARLRHWIDTHTDQVIVIVSLVLGFWLVANSIYYIVT |
| Ga0311301_110565092 | 3300032160 | Peatlands Soil | LARFRTWMETHTDQVIIVGSLILGFWLIANSIYLIVT |
| Ga0348332_103059283 | 3300032515 | Plant Litter | VRPDQSQAFLARFRAWMNTHTDQVIIWGSLILGFWLIANSLYLIVT |
| Ga0335085_100620781 | 3300032770 | Soil | SQVLLARFRTWIGTHTQPVIIWGSLVIGLWLVADSIYLIVT |
| Ga0335085_104638512 | 3300032770 | Soil | ALLARLKSWIEAHTDQVIIVGSLILGIWLIARDIYLIVS |
| Ga0335078_101281224 | 3300032805 | Soil | GFRTWIDAHTDQVIIWGSLILGFWLIANGIDLIVS |
| Ga0335080_102875181 | 3300032828 | Soil | QSLLARFRTWIDTHTDQVIIVGSLIIGFWLIANSIYLIVT |
| Ga0335080_107682643 | 3300032828 | Soil | AMVRPSQSQQMLARFRAWIDAHTDQAIIGGSLIIGLYLIAKDIYLIVT |
| Ga0335081_122542431 | 3300032892 | Soil | RVRAWIDAYTDQVIIAENLILGFWLIGYSTYLVVT |
| Ga0335071_100382571 | 3300032897 | Soil | VFLARFRTWIDSHTDQLIIAGSLIVGLWLIGKSIYLIVS |
| Ga0335071_116477222 | 3300032897 | Soil | SQSQQMLARFRAWIDAHTDQAIIGGSLIIGLYLIAKDIYLIVT |
| Ga0335083_113438801 | 3300032954 | Soil | SQSQQMLARFRIWIDAHTDQVIIFGSLILGIWLIAEDIYLIVT |
| Ga0335073_110475152 | 3300033134 | Soil | SLARFRTWIDSHTDQLIIAGSLIVGFWLIGKSIYLIVS |
| Ga0335073_120246221 | 3300033134 | Soil | ALLNRIRAWIDNNTDQVIIIGALVVGFWLIGNSIYLIVT |
| Ga0335077_113436882 | 3300033158 | Soil | GIQTWTDTHTDQVIIVGSLVLGLWLIANSIYLIVS |
| Ga0310914_100157929 | 3300033289 | Soil | RFRTRIDTHTDQVIIAGSLIIGLWLIANSLYLIVSQTAST |
| Ga0314866_065276_489_614 | 3300033807 | Peatland | ARFRAWIDTHTDQAITAGSLIIGLWLIANSIYLIVSQTTST |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |