Basic Information | |
---|---|
Family ID | F021090 |
Family Type | Metagenome |
Number of Sequences | 220 |
Average Sequence Length | 48 residues |
Representative Sequence | MITINEQQIKELEAFINTIPTAYGLPLLQFLGKLNAEQNPPVEEAKEV |
Number of Associated Samples | 156 |
Number of Associated Scaffolds | 219 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 15.91 % |
% of genes from short scaffolds (< 2000 bps) | 59.09 % |
Associated GOLD sequencing projects | 141 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.49 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (69.091 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (21.818 % of family members) |
Environment Ontology (ENVO) | Unclassified (59.091 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (64.545 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 43.42% β-sheet: 0.00% Coil/Unstructured: 56.58% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 219 Family Scaffolds |
---|---|---|
PF13884 | Peptidase_S74 | 25.57 |
PF13482 | RNase_H_2 | 3.20 |
PF08299 | Bac_DnaA_C | 1.83 |
PF08291 | Peptidase_M15_3 | 1.83 |
PF13392 | HNH_3 | 1.37 |
PF04883 | HK97-gp10_like | 1.37 |
PF04404 | ERF | 1.37 |
PF06199 | Phage_tail_2 | 1.37 |
PF14090 | HTH_39 | 0.91 |
PF00386 | C1q | 0.91 |
PF00959 | Phage_lysozyme | 0.91 |
PF05135 | Phage_connect_1 | 0.91 |
PF16754 | Pesticin | 0.91 |
PF10108 | DNA_pol_B_exo2 | 0.91 |
PF13730 | HTH_36 | 0.46 |
PF00149 | Metallophos | 0.46 |
PF05521 | Phage_H_T_join | 0.46 |
PF07460 | NUMOD3 | 0.46 |
PF14550 | Peptidase_S78_2 | 0.46 |
PF03237 | Terminase_6N | 0.46 |
PF02195 | ParBc | 0.46 |
PF11367 | DUF3168 | 0.46 |
COG ID | Name | Functional Category | % Frequency in 219 Family Scaffolds |
---|---|---|---|
COG0593 | Chromosomal replication initiation ATPase DnaA | Replication, recombination and repair [L] | 1.83 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 79.55 % |
Unclassified | root | N/A | 20.45 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000756|JGI12421J11937_10002921 | Not Available | 6886 | Open in IMG/M |
3300000882|FwDRAFT_10224019 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 616 | Open in IMG/M |
3300000929|NpDRAFT_10250595 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1010 | Open in IMG/M |
3300001266|B570J13884_100305 | Not Available | 4419 | Open in IMG/M |
3300002092|JGI24218J26658_1042073 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 523 | Open in IMG/M |
3300002297|B570J29603_102128 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1542 | Open in IMG/M |
3300002387|B570J29608_1010944 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 552 | Open in IMG/M |
3300002408|B570J29032_109866615 | All Organisms → Viruses → Predicted Viral | 1780 | Open in IMG/M |
3300002835|B570J40625_100030725 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8459 | Open in IMG/M |
3300002835|B570J40625_100043030 | Not Available | 6654 | Open in IMG/M |
3300002835|B570J40625_100141163 | Not Available | 2783 | Open in IMG/M |
3300002835|B570J40625_100352867 | All Organisms → Viruses → Predicted Viral | 1456 | Open in IMG/M |
3300003393|JGI25909J50240_1096876 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 586 | Open in IMG/M |
3300003852|Ga0031655_10243413 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 677 | Open in IMG/M |
3300004155|Ga0066600_10440528 | Not Available | 625 | Open in IMG/M |
3300004240|Ga0007787_10001920 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7400 | Open in IMG/M |
3300004240|Ga0007787_10033158 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2241 | Open in IMG/M |
3300004448|Ga0065861_1002215 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 12956 | Open in IMG/M |
3300004448|Ga0065861_1016079 | Not Available | 3785 | Open in IMG/M |
3300004461|Ga0066223_1037049 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 503 | Open in IMG/M |
3300004481|Ga0069718_15630099 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 558 | Open in IMG/M |
3300005580|Ga0049083_10000127 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 22058 | Open in IMG/M |
3300005581|Ga0049081_10212723 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 689 | Open in IMG/M |
3300005662|Ga0078894_10892438 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 771 | Open in IMG/M |
3300006641|Ga0075471_10509854 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 596 | Open in IMG/M |
3300006802|Ga0070749_10127673 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1490 | Open in IMG/M |
3300006805|Ga0075464_10619850 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 667 | Open in IMG/M |
3300006920|Ga0070748_1137376 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 914 | Open in IMG/M |
3300006920|Ga0070748_1159281 | Not Available | 837 | Open in IMG/M |
3300007545|Ga0102873_1003880 | All Organisms → Viruses → Predicted Viral | 4679 | Open in IMG/M |
3300007546|Ga0102874_1130603 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 786 | Open in IMG/M |
3300007548|Ga0102877_1088594 | Not Available | 885 | Open in IMG/M |
3300007667|Ga0102910_1116108 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 624 | Open in IMG/M |
3300007708|Ga0102859_1130029 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 734 | Open in IMG/M |
3300007716|Ga0102867_1214355 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 532 | Open in IMG/M |
3300007735|Ga0104988_10230 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 12259 | Open in IMG/M |
3300007861|Ga0105736_1062087 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 765 | Open in IMG/M |
3300007973|Ga0105746_1067927 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1140 | Open in IMG/M |
3300007974|Ga0105747_1158148 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 734 | Open in IMG/M |
3300008107|Ga0114340_1005301 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 13750 | Open in IMG/M |
3300008113|Ga0114346_1045694 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division WWE3 → candidate division WWE3 bacterium GW2011_GWC2_44_9 | 2534 | Open in IMG/M |
3300008114|Ga0114347_1026879 | Not Available | 2639 | Open in IMG/M |
3300008114|Ga0114347_1046486 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3285 | Open in IMG/M |
3300008114|Ga0114347_1130263 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 929 | Open in IMG/M |
3300008114|Ga0114347_1203499 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 656 | Open in IMG/M |
3300008116|Ga0114350_1024637 | Not Available | 2450 | Open in IMG/M |
3300008116|Ga0114350_1070001 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1200 | Open in IMG/M |
3300008117|Ga0114351_1119058 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1506 | Open in IMG/M |
3300008121|Ga0114356_1401565 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 764 | Open in IMG/M |
3300008122|Ga0114359_1004730 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8490 | Open in IMG/M |
3300008122|Ga0114359_1061752 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1344 | Open in IMG/M |
3300008259|Ga0114841_1070046 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1626 | Open in IMG/M |
3300008266|Ga0114363_1007892 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5207 | Open in IMG/M |
3300008266|Ga0114363_1018700 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3091 | Open in IMG/M |
3300008266|Ga0114363_1165910 | Not Available | 717 | Open in IMG/M |
3300008266|Ga0114363_1180535 | Not Available | 670 | Open in IMG/M |
3300008266|Ga0114363_1190982 | Not Available | 819 | Open in IMG/M |
3300008339|Ga0114878_1211581 | Not Available | 639 | Open in IMG/M |
3300008450|Ga0114880_1010866 | Not Available | 4491 | Open in IMG/M |
3300008450|Ga0114880_1204458 | Not Available | 658 | Open in IMG/M |
3300008450|Ga0114880_1241495 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 571 | Open in IMG/M |
3300008996|Ga0102831_1053169 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1357 | Open in IMG/M |
3300009009|Ga0105105_10508721 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 690 | Open in IMG/M |
3300009037|Ga0105093_10858921 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 531 | Open in IMG/M |
3300009068|Ga0114973_10000388 | Not Available | 32842 | Open in IMG/M |
3300009082|Ga0105099_10690951 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 632 | Open in IMG/M |
3300009082|Ga0105099_10774511 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 599 | Open in IMG/M |
3300009085|Ga0105103_10554951 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 649 | Open in IMG/M |
3300009151|Ga0114962_10133851 | Not Available | 1505 | Open in IMG/M |
3300009151|Ga0114962_10237086 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1046 | Open in IMG/M |
3300009151|Ga0114962_10350231 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 810 | Open in IMG/M |
3300009152|Ga0114980_10006086 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7950 | Open in IMG/M |
3300009152|Ga0114980_10376724 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 816 | Open in IMG/M |
3300009155|Ga0114968_10095106 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1829 | Open in IMG/M |
3300009158|Ga0114977_10001297 | Not Available | 16301 | Open in IMG/M |
3300009158|Ga0114977_10050294 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 2580 | Open in IMG/M |
3300009158|Ga0114977_10056083 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2433 | Open in IMG/M |
3300009159|Ga0114978_10001415 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 20208 | Open in IMG/M |
3300009159|Ga0114978_10031014 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3819 | Open in IMG/M |
3300009161|Ga0114966_10002992 | Not Available | 14979 | Open in IMG/M |
3300009161|Ga0114966_10259312 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1069 | Open in IMG/M |
3300009163|Ga0114970_10176119 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1271 | Open in IMG/M |
3300009168|Ga0105104_10506956 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 680 | Open in IMG/M |
3300009181|Ga0114969_10004939 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10517 | Open in IMG/M |
3300009181|Ga0114969_10022316 | Not Available | 4450 | Open in IMG/M |
3300009181|Ga0114969_10091362 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1970 | Open in IMG/M |
3300009181|Ga0114969_10127299 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1619 | Open in IMG/M |
3300009182|Ga0114959_10157404 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1203 | Open in IMG/M |
3300009183|Ga0114974_10002981 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 12910 | Open in IMG/M |
3300009183|Ga0114974_10030617 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3721 | Open in IMG/M |
3300009183|Ga0114974_10046387 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2930 | Open in IMG/M |
3300009183|Ga0114974_10069285 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2317 | Open in IMG/M |
3300009433|Ga0115545_1171870 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 748 | Open in IMG/M |
3300010157|Ga0114964_10165570 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1071 | Open in IMG/M |
3300010157|Ga0114964_10219425 | Not Available | 910 | Open in IMG/M |
3300010157|Ga0114964_10533715 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 551 | Open in IMG/M |
3300010160|Ga0114967_10408258 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 676 | Open in IMG/M |
3300010160|Ga0114967_10637513 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 509 | Open in IMG/M |
3300010885|Ga0133913_10120667 | Not Available | 7027 | Open in IMG/M |
3300011114|Ga0151515_10501 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 17021 | Open in IMG/M |
3300011116|Ga0151516_11259 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10520 | Open in IMG/M |
3300011183|Ga0136713_1025057 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 766 | Open in IMG/M |
3300011184|Ga0136709_1036206 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 682 | Open in IMG/M |
3300011336|Ga0153703_1542 | Not Available | 12382 | Open in IMG/M |
3300011995|Ga0153800_1004429 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → Candidatus Nomurabacteria → Candidatus Nomurabacteria bacterium RIFCSPLOWO2_01_FULL_41_12 | 1311 | Open in IMG/M |
3300012012|Ga0153799_1011463 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1940 | Open in IMG/M |
3300012266|Ga0136712_1010054 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1014 | Open in IMG/M |
3300012667|Ga0157208_10003289 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2893 | Open in IMG/M |
3300013005|Ga0164292_10508249 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 789 | Open in IMG/M |
3300013006|Ga0164294_10076572 | All Organisms → Viruses → Predicted Viral | 2522 | Open in IMG/M |
3300013006|Ga0164294_10090547 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2284 | Open in IMG/M |
3300017701|Ga0181364_1011992 | Not Available | 1458 | Open in IMG/M |
3300017716|Ga0181350_1002998 | All Organisms → Viruses → Predicted Viral | 4902 | Open in IMG/M |
3300017736|Ga0181365_1013953 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2009 | Open in IMG/M |
3300017754|Ga0181344_1005732 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4157 | Open in IMG/M |
3300017754|Ga0181344_1040866 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1398 | Open in IMG/M |
3300017754|Ga0181344_1227129 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 520 | Open in IMG/M |
3300018041|Ga0181601_10662539 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 529 | Open in IMG/M |
3300020048|Ga0207193_1044932 | All Organisms → cellular organisms → Bacteria | 4745 | Open in IMG/M |
3300020159|Ga0211734_10252399 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 713 | Open in IMG/M |
3300020159|Ga0211734_11079161 | Not Available | 708 | Open in IMG/M |
3300020160|Ga0211733_10894102 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2900 | Open in IMG/M |
3300020161|Ga0211726_10713623 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2844 | Open in IMG/M |
3300020172|Ga0211729_11250677 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3458 | Open in IMG/M |
3300020205|Ga0211731_11723568 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 627 | Open in IMG/M |
3300020533|Ga0208364_1000456 | Not Available | 9496 | Open in IMG/M |
3300020546|Ga0208853_1003096 | All Organisms → Viruses → Predicted Viral | 4120 | Open in IMG/M |
3300020546|Ga0208853_1007967 | All Organisms → Viruses → Predicted Viral | 2361 | Open in IMG/M |
3300020548|Ga0208856_1010592 | All Organisms → Viruses → Predicted Viral | 1525 | Open in IMG/M |
3300020549|Ga0207942_1012949 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1097 | Open in IMG/M |
3300020550|Ga0208600_1004468 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2224 | Open in IMG/M |
3300020550|Ga0208600_1029431 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 862 | Open in IMG/M |
3300020554|Ga0208599_1062544 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 515 | Open in IMG/M |
3300020568|Ga0208598_1005150 | Not Available | 2429 | Open in IMG/M |
3300020572|Ga0207909_1000124 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 29031 | Open in IMG/M |
3300021131|Ga0214206_1000050 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 31493 | Open in IMG/M |
3300021354|Ga0194047_10007940 | Not Available | 5547 | Open in IMG/M |
3300021354|Ga0194047_10185237 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 834 | Open in IMG/M |
3300021516|Ga0194045_1022099 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1682 | Open in IMG/M |
3300021519|Ga0194048_10000188 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 28601 | Open in IMG/M |
3300021519|Ga0194048_10178703 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 790 | Open in IMG/M |
3300021600|Ga0194059_1020975 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2284 | Open in IMG/M |
3300021600|Ga0194059_1060205 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1228 | Open in IMG/M |
3300021956|Ga0213922_1026411 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1428 | Open in IMG/M |
3300021961|Ga0222714_10617718 | Not Available | 539 | Open in IMG/M |
3300021962|Ga0222713_10133847 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1732 | Open in IMG/M |
3300021963|Ga0222712_10076979 | Not Available | 2395 | Open in IMG/M |
3300024343|Ga0244777_10001512 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 16654 | Open in IMG/M |
3300024346|Ga0244775_11233816 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 581 | Open in IMG/M |
3300025445|Ga0208424_1037620 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 591 | Open in IMG/M |
3300025635|Ga0208147_1118053 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 634 | Open in IMG/M |
3300025645|Ga0208643_1162769 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 555 | Open in IMG/M |
3300025732|Ga0208784_1068802 | All Organisms → Viruses | 1075 | Open in IMG/M |
3300025889|Ga0208644_1060021 | All Organisms → Viruses | 2051 | Open in IMG/M |
3300025889|Ga0208644_1125769 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 1215 | Open in IMG/M |
3300027121|Ga0255074_1014575 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1023 | Open in IMG/M |
3300027127|Ga0255071_1016792 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1170 | Open in IMG/M |
3300027529|Ga0255077_1011351 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1586 | Open in IMG/M |
3300027697|Ga0209033_1072947 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1174 | Open in IMG/M |
3300027712|Ga0209499_1079677 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1275 | Open in IMG/M |
3300027721|Ga0209492_1195405 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 696 | Open in IMG/M |
3300027733|Ga0209297_1000674 | All Organisms → Viruses | 21153 | Open in IMG/M |
3300027733|Ga0209297_1017219 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3467 | Open in IMG/M |
3300027733|Ga0209297_1033463 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2386 | Open in IMG/M |
3300027746|Ga0209597_1000302 | Not Available | 32841 | Open in IMG/M |
3300027746|Ga0209597_1001492 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15230 | Open in IMG/M |
3300027749|Ga0209084_1086394 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 1409 | Open in IMG/M |
3300027754|Ga0209596_1000282 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 47590 | Open in IMG/M |
3300027754|Ga0209596_1000282 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 47590 | Open in IMG/M |
3300027754|Ga0209596_1025869 | All Organisms → Viruses → Predicted Viral | 3408 | Open in IMG/M |
3300027759|Ga0209296_1001068 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 22012 | Open in IMG/M |
3300027759|Ga0209296_1001855 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15526 | Open in IMG/M |
3300027759|Ga0209296_1031731 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2904 | Open in IMG/M |
3300027763|Ga0209088_10000491 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 27885 | Open in IMG/M |
3300027764|Ga0209134_10046008 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae → Zavarzinella → Zavarzinella formosa | 1442 | Open in IMG/M |
3300027764|Ga0209134_10084206 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1079 | Open in IMG/M |
3300027769|Ga0209770_10025500 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2585 | Open in IMG/M |
3300027777|Ga0209829_10129978 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1177 | Open in IMG/M |
3300027785|Ga0209246_10007867 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3947 | Open in IMG/M |
3300027797|Ga0209107_10000269 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 31732 | Open in IMG/M |
3300027797|Ga0209107_10000588 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 21107 | Open in IMG/M |
3300027798|Ga0209353_10094368 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1353 | Open in IMG/M |
3300027798|Ga0209353_10410637 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 554 | Open in IMG/M |
3300027841|Ga0209262_10361259 | Not Available | 707 | Open in IMG/M |
3300027900|Ga0209253_10884987 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 627 | Open in IMG/M |
3300027972|Ga0209079_10162432 | Not Available | 765 | Open in IMG/M |
3300027973|Ga0209298_10252333 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 702 | Open in IMG/M |
3300028025|Ga0247723_1070843 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 939 | Open in IMG/M |
3300028392|Ga0304729_1012110 | Not Available | 3965 | Open in IMG/M |
3300031758|Ga0315907_10028922 | Not Available | 5025 | Open in IMG/M |
3300031758|Ga0315907_10138140 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2071 | Open in IMG/M |
3300031784|Ga0315899_10068638 | Not Available | 3676 | Open in IMG/M |
3300031786|Ga0315908_10017063 | Not Available | 5288 | Open in IMG/M |
3300031786|Ga0315908_10372722 | Not Available | 1195 | Open in IMG/M |
3300031787|Ga0315900_10405955 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1073 | Open in IMG/M |
3300031857|Ga0315909_10072838 | Not Available | 3065 | Open in IMG/M |
3300031857|Ga0315909_10253657 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 1348 | Open in IMG/M |
3300031857|Ga0315909_10384841 | Not Available | 1011 | Open in IMG/M |
3300032116|Ga0315903_10619333 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 827 | Open in IMG/M |
3300033995|Ga0335003_0176595 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1042 | Open in IMG/M |
3300033995|Ga0335003_0246320 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon | 829 | Open in IMG/M |
3300034013|Ga0334991_0005471 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9091 | Open in IMG/M |
3300034018|Ga0334985_0067008 | All Organisms → Viruses → Predicted Viral | 2614 | Open in IMG/M |
3300034018|Ga0334985_0588216 | Not Available | 623 | Open in IMG/M |
3300034023|Ga0335021_0119046 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1521 | Open in IMG/M |
3300034061|Ga0334987_0000773 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 30074 | Open in IMG/M |
3300034092|Ga0335010_0542287 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 602 | Open in IMG/M |
3300034093|Ga0335012_0581180 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 520 | Open in IMG/M |
3300034104|Ga0335031_0006665 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8588 | Open in IMG/M |
3300034104|Ga0335031_0263657 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1137 | Open in IMG/M |
3300034104|Ga0335031_0394613 | Not Available | 871 | Open in IMG/M |
3300034105|Ga0335035_0345012 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 863 | Open in IMG/M |
3300034117|Ga0335033_0103084 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1645 | Open in IMG/M |
3300034279|Ga0335052_0113071 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1630 | Open in IMG/M |
3300034280|Ga0334997_0429949 | Not Available | 834 | Open in IMG/M |
3300034283|Ga0335007_0012274 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6806 | Open in IMG/M |
3300034284|Ga0335013_0264503 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1109 | Open in IMG/M |
3300034356|Ga0335048_0281653 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 872 | Open in IMG/M |
3300034356|Ga0335048_0413309 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 666 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 21.82% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 10.45% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 8.18% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 7.73% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 7.73% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 5.00% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 5.00% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 4.55% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 3.64% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 3.64% |
Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 3.18% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.82% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 1.36% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 1.36% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 1.36% |
Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 1.36% |
Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 1.36% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.36% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.91% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 0.91% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.91% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.91% |
Freshwater | Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater | 0.91% |
Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.45% |
Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic | 0.45% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 0.45% |
Freshwater And Marine | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater And Marine | 0.45% |
Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.45% |
Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.45% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.45% |
Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 0.45% |
Freshwater And Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine | 0.45% |
Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.45% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000756 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 | Environmental | Open in IMG/M |
3300000882 | Freshwater microbial communities from the Columbia River | Environmental | Open in IMG/M |
3300000929 | Marine plume microbial communities from the Columbia River - 15 PSU | Environmental | Open in IMG/M |
3300001266 | Freshwater microbial communities from Lake Mendota, WI - 05MAY2010 deep hole epilimnion | Environmental | Open in IMG/M |
3300002092 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-B6 metagenome | Environmental | Open in IMG/M |
3300002297 | Freshwater microbial communities from Lake Mendota, WI - 17AUG2012 deep hole epilimnion | Environmental | Open in IMG/M |
3300002387 | Freshwater microbial communities from Lake Mendota, WI - 22JUN2012 deep hole epilimnion | Environmental | Open in IMG/M |
3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
3300003393 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD | Environmental | Open in IMG/M |
3300003852 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB | Environmental | Open in IMG/M |
3300004155 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Low cellulose week 11 | Environmental | Open in IMG/M |
3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
3300004448 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
3300004461 | Marine viral communities from Newfoundland, Canada BC-2 | Environmental | Open in IMG/M |
3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
3300005580 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF | Environmental | Open in IMG/M |
3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
3300007545 | Estuarine microbial communities from the Columbia River estuary - metaG 1547B-3 | Environmental | Open in IMG/M |
3300007546 | Estuarine microbial communities from the Columbia River estuary - metaG 1547A-02 | Environmental | Open in IMG/M |
3300007548 | Estuarine microbial communities from the Columbia River estuary - metaG 1548B-3 | Environmental | Open in IMG/M |
3300007667 | Estuarine microbial communities from the Columbia River estuary - metaG 1558A-3 | Environmental | Open in IMG/M |
3300007708 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 | Environmental | Open in IMG/M |
3300007716 | Estuarine microbial communities from the Columbia River estuary - metaG 1546B-3 | Environmental | Open in IMG/M |
3300007735 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea ? 2014Oct | Environmental | Open in IMG/M |
3300007861 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1372B_3um | Environmental | Open in IMG/M |
3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
3300007974 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um | Environmental | Open in IMG/M |
3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
3300008114 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA | Environmental | Open in IMG/M |
3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
3300008117 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008121 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample HABS-E2014-0110-100-LTR | Environmental | Open in IMG/M |
3300008122 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample HABS-E2014-0124-100-LTR | Environmental | Open in IMG/M |
3300008259 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA | Environmental | Open in IMG/M |
3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008339 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Sept 29, 2014 all contigs | Environmental | Open in IMG/M |
3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
3300008996 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 | Environmental | Open in IMG/M |
3300009009 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
3300009037 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
3300009082 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
3300009182 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG | Environmental | Open in IMG/M |
3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
3300009433 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 | Environmental | Open in IMG/M |
3300010157 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG | Environmental | Open in IMG/M |
3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
3300011114 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2016Feb | Environmental | Open in IMG/M |
3300011116 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015Nov | Environmental | Open in IMG/M |
3300011183 | Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA - JTO22cm metaG | Environmental | Open in IMG/M |
3300011184 | Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA - Floc-Cal metaG | Environmental | Open in IMG/M |
3300011336 | Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Paldang | Environmental | Open in IMG/M |
3300011995 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 880 - Top - Depth 1m | Environmental | Open in IMG/M |
3300012012 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m | Environmental | Open in IMG/M |
3300012266 | Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA to study Microbial Dark Matter (Phase II) - JTO19cm metaG | Environmental | Open in IMG/M |
3300012667 | Freshwater microbial communities from Maskinonge River, Ontario, Canada - S15 | Environmental | Open in IMG/M |
3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
3300013006 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaG | Environmental | Open in IMG/M |
3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
3300018041 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041407BS metaG (megahit assembly) | Environmental | Open in IMG/M |
3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
3300020533 | Freshwater microbial communities from Lake Mendota, WI - 08JUN2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020546 | Freshwater microbial communities from Lake Mendota, WI - 03OCT2011 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020548 | Freshwater microbial communities from Lake Mendota, WI - 13JUL2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020549 | Freshwater microbial communities from Lake Mendota, WI - 12OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020550 | Freshwater microbial communities from Lake Mendota, WI - 08OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020554 | Freshwater microbial communities from Lake Mendota, WI - 17AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020568 | Freshwater microbial communities from Lake Mendota, WI - 22JUN2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020572 | Freshwater microbial communities from Lake Mendota, WI - 05MAY2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300021131 | Freshwater microbial communities from Trout Bog Lake, WI - 07JUL2009 epilimnion | Environmental | Open in IMG/M |
3300021354 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L221-5m | Environmental | Open in IMG/M |
3300021516 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L626-11m | Environmental | Open in IMG/M |
3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
3300021600 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L626-11m | Environmental | Open in IMG/M |
3300021956 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MG | Environmental | Open in IMG/M |
3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
3300024343 | Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction | Environmental | Open in IMG/M |
3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
3300025445 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025635 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025645 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes) | Environmental | Open in IMG/M |
3300025732 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
3300027121 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepC_8h | Environmental | Open in IMG/M |
3300027127 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepC_8h | Environmental | Open in IMG/M |
3300027529 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepC_8h | Environmental | Open in IMG/M |
3300027697 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (SPAdes) | Environmental | Open in IMG/M |
3300027712 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027721 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes) | Environmental | Open in IMG/M |
3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027746 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027749 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027764 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
3300027769 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes) | Environmental | Open in IMG/M |
3300027777 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_140205_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
3300027841 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Low cellulose week 11 (SPAdes) | Environmental | Open in IMG/M |
3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
3300027972 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 (SPAdes) | Environmental | Open in IMG/M |
3300027973 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
3300028392 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG (v2) | Environmental | Open in IMG/M |
3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
3300031786 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA124 | Environmental | Open in IMG/M |
3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
3300033995 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056 | Environmental | Open in IMG/M |
3300034013 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Jun2018-rr0034 | Environmental | Open in IMG/M |
3300034018 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME04Jul2014-rr0021 | Environmental | Open in IMG/M |
3300034023 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Oct2016-rr0090 | Environmental | Open in IMG/M |
3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
3300034093 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072 | Environmental | Open in IMG/M |
3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
3300034105 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127 | Environmental | Open in IMG/M |
3300034117 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jun2014-rr0124 | Environmental | Open in IMG/M |
3300034279 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2014-rr0163 | Environmental | Open in IMG/M |
3300034280 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME10Aug2009-rr0048 | Environmental | Open in IMG/M |
3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
3300034284 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075 | Environmental | Open in IMG/M |
3300034356 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12421J11937_100029218 | 3300000756 | Freshwater And Sediment | MITISEQQLKDLEAFINTIPTAYGLPLLQFLGKLNAEQNPPIEEAKEI* |
FwDRAFT_102240191 | 3300000882 | Freshwater And Marine | KINTMITINEQQIKDLEAFINTIPTAYGLPLLQFLGKLNVEQNPPIEEAKEV* |
NpDRAFT_102505952 | 3300000929 | Freshwater And Marine | MITINQEQIKELEAFINTIPTAYGLPLLQFLGKLNAEQNPPQESTEA* |
B570J13884_1003055 | 3300001266 | Freshwater | MITINQDQIKELEAFINTIPTAYGLPLLQFLGKLNAEQNPPQVQELQTED* |
JGI24218J26658_10420732 | 3300002092 | Lentic | MITINEQQIKELEAFINTIPTAYGLPLLQFLGKLNAEQNPPVEEAKLD* |
B570J29603_1021281 | 3300002297 | Freshwater | MITINEQQIKELEAFINTIPTAYGLPLLQFLGKLNAEQNPPIEEAKVD* |
B570J29608_10109441 | 3300002387 | Freshwater | MIQLNETQIKELEAFINTIPTAYGLPLLQFLGKLNAEQNPPQESTEA* |
B570J29032_1098666152 | 3300002408 | Freshwater | MITINEQQLKDLEAFINQIPTQYGLPLLQFLGKLNAEQNPPVEEVKEV* |
B570J40625_1000307252 | 3300002835 | Freshwater | MITINQEQIKELEAFINTIPTAYGLPLLQFLGKLNAEQNPPQETTEA* |
B570J40625_1000430303 | 3300002835 | Freshwater | MITLNEQQVKELEQFINTIPTAYGLPLLQFLGKLNAEQNPQTELTED* |
B570J40625_1001411632 | 3300002835 | Freshwater | MITINEQQIKELEAFINQIPTQYGLPLLQFLGKLNAEQNPPIEEAK |
B570J40625_1003528672 | 3300002835 | Freshwater | MITINEQQLKDLEAFINQIPTQYGLPLLQFLGKLNAEQNPP |
JGI25909J50240_10968762 | 3300003393 | Freshwater Lake | MITINEQQIKELEAFINQIPTIYGLPLLQFLGKLNAEQNPLVEEAKEV* |
Ga0031655_102434133 | 3300003852 | Freshwater Lake Sediment | MITINEQQLKDLEAFINTIPTAYGLPLVQFLGKLNAEQNPPVEEAKEV* |
Ga0066600_104405282 | 3300004155 | Freshwater | MIQLSETQVKELEAFINTIPTAYGLPLLQFLGKLNAEQNPPQEVKKD* |
Ga0007787_100019206 | 3300004240 | Freshwater Lake | MITLNETQIKELEAFINTIPTAYGLPLLQFLGKLNAEQNPPTESTEA* |
Ga0007787_100331583 | 3300004240 | Freshwater Lake | MITINNDQIKDLEAFINTIPTAYGLPLLQFLGKLNAEQNPPIEEAKEV* |
Ga0065861_10022152 | 3300004448 | Marine | MITINEQQLKDLEAFINTIPTAYGLPLVQFLGKLNAEQNPLVEEVKAD* |
Ga0065861_10160799 | 3300004448 | Marine | MITINEQQLKDLEAFINTIPTAYGLPLVQFLGKLNAEQNPPVEEVKAD* |
Ga0066223_10370493 | 3300004461 | Marine | ITINNDQLKDLEAFINTIPTAYGLPLVQFLGKLNAEQNPPVEETKEV* |
Ga0069718_156300991 | 3300004481 | Sediment | MLQLNETQVKELEAYINQIPTAYGLPLLQFLGKLNAEQNPPQEVKED* |
Ga0049083_100001273 | 3300005580 | Freshwater Lentic | MITINEQQIKDLEAFINTIPTAYGLPLLQFLGKLNAEQNPPIEEAKEV* |
Ga0049081_102127233 | 3300005581 | Freshwater Lentic | MLNLSDENLKELEAFINTIPTAYGLPLLQFLGKLNAEQNPPIEEAKEV* |
Ga0078894_108924381 | 3300005662 | Freshwater Lake | MITINQEQIKELEAFINTIPTAYGLPLLQFLGKLNAEQNPPTESTEA* |
Ga0075471_105098543 | 3300006641 | Aqueous | MITLNEQHLKDLEAYINKIPTEFGLPLIQFLGKLNAEQNPQPAPEVPTEG* |
Ga0070749_101276732 | 3300006802 | Aqueous | MITLNEQHLKDLEAYINKIPTEFGLPLIQFLGKLNAEQNPQPAPEVQTEG* |
Ga0075464_106198501 | 3300006805 | Aqueous | MITISEAQLKELEAFINTIPTAYGLPLVQFLVKLNAEQNPPVEEAKVD* |
Ga0070748_11373762 | 3300006920 | Aqueous | MITINEQQIKDLEAFINTIPTIYGLPLLQFLGKLNAEQNPPIEEAKVD* |
Ga0070748_11592813 | 3300006920 | Aqueous | MITINNDQIKELEAFINQIPTQYGLPLLQFLGKLNAEQNPPVEEAKEV* |
Ga0102873_10038802 | 3300007545 | Estuarine | MISINEQQLKDLEAFINQIPTQYGLPLLQFLGKLNAEQNPPVEEVNAD* |
Ga0102874_11306032 | 3300007546 | Estuarine | MISINEQQLKDLEAFINQIPTQYGLPLLQFLGKLNAEQNPP |
Ga0102877_10885942 | 3300007548 | Estuarine | MITINQDQIKELEAFINTIPTAYGLPLLQFLGKLNAEQNPPQESTEA* |
Ga0102910_11161083 | 3300007667 | Estuarine | MITINQEQIKELEAFINTIPTAYGLPLLQYLGKLNAEQNPPQESTEA* |
Ga0102859_11300293 | 3300007708 | Estuarine | MIQINNDQLKELEAFINTIPTAYGLPLLQFLGKLNAEQNPPIEEAKVD* |
Ga0102867_12143551 | 3300007716 | Estuarine | IFVYKIKTMITINQDQIKELEAFINTIPTAYGLPLLQFLGKLNAEQNPPQESTEA* |
Ga0104988_1023021 | 3300007735 | Freshwater | MITINQEQIKELEAFINTIPTAYGLPLLQFLGKLNAEQNPPSEVKED* |
Ga0105736_10620873 | 3300007861 | Estuary Water | MITINETQIKELEAFINTIPTAYGLPLLQFLGKLNAEQNPPQEVTED* |
Ga0105746_10679271 | 3300007973 | Estuary Water | MITINQEQIKELEAFINTIPTAYGLPLLQFLGKLNAEQNPPQEVKED* |
Ga0105747_11581482 | 3300007974 | Estuary Water | MITINEQQIKDLEAFINTIPTAYGLPLLQFLGKLNAEQNPPVEEAKEV* |
Ga0114340_100530117 | 3300008107 | Freshwater, Plankton | MITINEQQIKELEAFINTIPTAYGLPLLQFLGKLNAEQNPPIEEAKEI* |
Ga0114346_10456942 | 3300008113 | Freshwater, Plankton | MITINETQIKELEAFINTIPTAYGLPLLQFLGKLNAEQNPTTEVTED* |
Ga0114347_10268796 | 3300008114 | Freshwater, Plankton | MITLNETQIKELEAFINTIPTAYGLPLLQFLGKLNAEQNPPQESTEA* |
Ga0114347_10464867 | 3300008114 | Freshwater, Plankton | MITINQEQIKELEAFINTIPTAYGLPLLQFLGKLNAEQNPQTEVTED* |
Ga0114347_11302633 | 3300008114 | Freshwater, Plankton | MITINQDQIKELEAFINTIPTAYGLPLLQFLGKLNAEQNPQTESTEA* |
Ga0114347_12034991 | 3300008114 | Freshwater, Plankton | QIKELEAFINTIPTAYGLPLLQFLGKLNAEQNPPQEVKED* |
Ga0114350_10246371 | 3300008116 | Freshwater, Plankton | IKTMITINQEQIKELEAFINTIPTAYGLPLLQFLGKLNAEQNPPQETTEA* |
Ga0114350_10700014 | 3300008116 | Freshwater, Plankton | IKTMITINQEQIKELEAFINTIPTAYGLPLLQFLGKLNAEQNPPQESTEA* |
Ga0114351_11190583 | 3300008117 | Freshwater, Plankton | MITINETQLKELEAFINQIPTAYGLPLLQFLGKLNAEQNPQTESTEA* |
Ga0114356_14015653 | 3300008121 | Freshwater, Plankton | MITLNETQIKELEAFINTIPTAYGLPLLQFLGKLNAEQNPTTEVTEN* |
Ga0114359_10047304 | 3300008122 | Freshwater, Plankton | MITINQEQIKELEAFINTIPTAYGLPLLQFLGKLNDKG* |
Ga0114359_10617521 | 3300008122 | Freshwater, Plankton | MITINQEQIKELEAFINTIPTAYGLPLLQFLGKLN |
Ga0114841_10700463 | 3300008259 | Freshwater, Plankton | MITINETQIKELEAFINTIPTAYGLPLLQFLGKLNAEQNPPQESTEA* |
Ga0114363_10078921 | 3300008266 | Freshwater, Plankton | IKTMITINQEQIKELEAFINTIPTAYGLPLLQFLGKLNAEQNQPQESTEA* |
Ga0114363_10187002 | 3300008266 | Freshwater, Plankton | MITINQDQLKELEAFINQIPTAYGLPLLQFLGKLNAEQNPPTESTEA* |
Ga0114363_11659102 | 3300008266 | Freshwater, Plankton | MITLNETQIKELEAFINTIPTAYGLPLLQFLGKLNAEQNPQTESTEA* |
Ga0114363_11805351 | 3300008266 | Freshwater, Plankton | MITINETQIKELEAFINTIPTAYGLPLLQFLGKLNAEQNPPQ |
Ga0114363_11909823 | 3300008266 | Freshwater, Plankton | MITLNETQIKELEAFINTIPTAYGLPLLQFLGKLNAEQNPPQSCKILHQSD* |
Ga0114878_12115813 | 3300008339 | Freshwater Lake | MITLNETQIKELEAFINTIPTAYGLPLLQFLGKLNAEQNPPQ |
Ga0114880_101086613 | 3300008450 | Freshwater Lake | MITINQEQLKELEAFINQIPTAYGLPLLQFLGKLNAEQNPQTEVTED* |
Ga0114880_12044582 | 3300008450 | Freshwater Lake | MITLNEQQVKELEQFINTIPTAYGLPLLQFLGKLNAEQNPQTEVKED* |
Ga0114880_12414952 | 3300008450 | Freshwater Lake | MITINQDQIKELEAFINTIPTAYGLPLLQFLGKLNAEQNPPQEVKED* |
Ga0102831_10531695 | 3300008996 | Estuarine | NTMISINEQQLKDLEAFINQIPTQYGLPLLQFLGKLNAEQNPPVEEVNAD* |
Ga0105105_105087211 | 3300009009 | Freshwater Sediment | MITINQEQIKELEAFINTIPTAYGLPLLQFLGKLNAEQNPQTEVKED* |
Ga0105093_108589212 | 3300009037 | Freshwater Sediment | MITINQDQIKELEAFINTIPTAYGLPLLQFLGKLNAEQNPPQESTES* |
Ga0114973_100003882 | 3300009068 | Freshwater Lake | MITINEQQLKDLEAFINTIPTAYGLPLLQFLGKLNAEQNPKEDAKVVNLKED* |
Ga0105099_106909511 | 3300009082 | Freshwater Sediment | MITLNEQQIKELEAFINTIPTAYGLPLLQFLGKLNAEQNPQEVKED* |
Ga0105099_107745113 | 3300009082 | Freshwater Sediment | MITLNETQIKELEAFINTIPTAYGLPLLQFLGKLNAEQNPQTPTESTEA* |
Ga0105103_105549513 | 3300009085 | Freshwater Sediment | MITINQEQIKELEAFINTIPTAYGLPLLQFLGKLNAEQNPPQESTES* |
Ga0114962_101338512 | 3300009151 | Freshwater Lake | MITINNDQLKELEAFINQIPTAYGLPLLQFLGKLNAEQNPPVEDANQV* |
Ga0114962_102370863 | 3300009151 | Freshwater Lake | MITINEQQLKDLEAFINTIPTAYGVPLVQFLGKLNAEQNPPVEEVKEV* |
Ga0114962_103502313 | 3300009151 | Freshwater Lake | MITINEQQLKDLEAFINTIPTAYGLPLIQFLGKLNAEQNPPVEEAKEV* |
Ga0114980_100060862 | 3300009152 | Freshwater Lake | MITINEQQLKDLEAFINTIPTAYGLPLVQFLGKLNAEQNPPIEEAKEV* |
Ga0114980_103767242 | 3300009152 | Freshwater Lake | MITINNDQIKELEAFINQIPTIYGLPLLQFLGKLNAEQNPQAPEAEVVEG* |
Ga0114980_104184891 | 3300009152 | Freshwater Lake | LEAFINTIPTAYGLPLLQFLGKLNAEQNPKEDAKVVNINED* |
Ga0114968_100951062 | 3300009155 | Freshwater Lake | MISINEQQLKDLEAFINTIPTAYGLPLLQFLGKLNAEQNPPVEEAKLD* |
Ga0114977_1000129735 | 3300009158 | Freshwater Lake | MITINEQQLKDLESFINTIPTAYGLPLLQFLGKLNAEQNPKEDAKVIDIKED* |
Ga0114977_100502942 | 3300009158 | Freshwater Lake | MITINNDQIKELEAFINTIPTAYGLPLLQFLGKLNAEQNPPIEEAKEV* |
Ga0114977_100560833 | 3300009158 | Freshwater Lake | MITINNDQLKELEAFINQIPTAYGLPLLQFLGKLNAEQNPPVEDVTEA* |
Ga0114978_1000141514 | 3300009159 | Freshwater Lake | MITINEQQIKELEAFINTIPTAYGLPLLQFLGKLNAEQNPQVEEAKVD* |
Ga0114978_100310143 | 3300009159 | Freshwater Lake | MITINEQQLKDLESFINTIPTAYGLPLLQFLGKLNAEQNPKEDAKVVNINED* |
Ga0114966_1000299213 | 3300009161 | Freshwater Lake | MITINNDQIKELEAFINTIPTAYGLPLLQFLGKLNAEQNPPVEEAKEV* |
Ga0114966_102593121 | 3300009161 | Freshwater Lake | MITINNDQLKELEAFINQIPTAYGLPLLQFLGKLNAEQNPQAPEAEVVEG* |
Ga0114970_101761191 | 3300009163 | Freshwater Lake | INTMISINEQQLKDLEAFIYTIPTAYGLPLLQFLGKLNAEQNPPVEEAKLD* |
Ga0105104_105069561 | 3300009168 | Freshwater Sediment | MITLNETQLKELEAYINQIPTAYGLPLLQFLGKIAQDQNPPQEVKED* |
Ga0114969_100049393 | 3300009181 | Freshwater Lake | MITINNDQLKELEAFINQIPTAYGLPLLQFLGKLNAEQNPPVEEVTEE* |
Ga0114969_100223168 | 3300009181 | Freshwater Lake | MITINNDQLKELEAFINQIPTAYGLPLIQFLGKLNAEQNPPVEEVTEA* |
Ga0114969_100913622 | 3300009181 | Freshwater Lake | MITINEQQIKELEAFINTIPTAYGLPLLQFLGKLNAEQNPPIEEAKEV* |
Ga0114969_101272992 | 3300009181 | Freshwater Lake | MITINEQQIKELEAFINTIPTAYGLPLLQFLGKLNAEQNPPVEEAKEV* |
Ga0114959_101574042 | 3300009182 | Freshwater Lake | MITINEQQLKDLEAFINTIPTAYGLPLVQFLGKLNAEQSPPVEEVKEV* |
Ga0114974_100029818 | 3300009183 | Freshwater Lake | MITINETQIKELEAFINTIPTAYGLPLLQFLGKLNAEQNPPQETTEA* |
Ga0114974_100306177 | 3300009183 | Freshwater Lake | MITINEQQLKDLEAFINTIPTAYGLPLLQFLGKLNAEQNPPVEEAKEV* |
Ga0114974_100463875 | 3300009183 | Freshwater Lake | MITINEQQIKDLESFINTIPTAYGLPLLQFLGKLNAEQNPPIEEAKEV* |
Ga0114974_100692853 | 3300009183 | Freshwater Lake | MITLNEQQVKELEQFINTIPTAYGLPLLQFLGKLAEDQKPKEQAKVVDLKED* |
Ga0115545_11718702 | 3300009433 | Pelagic Marine | MITINQEQIKELEAFINTIPTAYGLPLLQFLGKLNAEQNPPQEVTQD* |
Ga0114964_101655702 | 3300010157 | Freshwater Lake | MITINEQQLKDLEAFINQIPTQYGLPLLQFLGKLNAEQNPPVEEVKVD* |
Ga0114964_102194252 | 3300010157 | Freshwater Lake | MITINNDQLKELEAFINQIPTQYGLPLLQFLGKLNAEQNPPVEEAKVD* |
Ga0114964_105337152 | 3300010157 | Freshwater Lake | MITINEQQLKDLEAFINQIPTQYGLPLIQFLGKLNAEQNPPVEEVTEA* |
Ga0114967_104082583 | 3300010160 | Freshwater Lake | MITINEQQLKDLESFINTIPTAYGLPLLQFLGKLNAEQKPKEDAKVIDIKED* |
Ga0114967_106375132 | 3300010160 | Freshwater Lake | MITINNDQLKELEAFINQIPTAYGLPLIQFLGKLNAEQNPPVEE |
Ga0133913_101206671 | 3300010885 | Freshwater Lake | EQQLKDLESFINTIPTAYGLPLLQFLGKLNAEQNPKEDAKVVNINED* |
Ga0151515_1050117 | 3300011114 | Freshwater | MITINEQQLKDLEAFINQIPTAYGLPLLQFLGKLNAEQNPPVEEVNAE* |
Ga0151516_112593 | 3300011116 | Freshwater | MITINEQQIKELEAFINTIPTAYGLPLLQYFGKLNAEQNPPVEEAKVD* |
Ga0136713_10250573 | 3300011183 | Freshwater | MITINETQLKELEAFINQIPTAYGLPLLQFLGKLNAEQNPPTESTEA* |
Ga0136709_10362061 | 3300011184 | Freshwater | MLTLNETQIKELEAFINTIPTAYGLPLLQFLGKLNAEQNPPQEVKED* |
Ga0153703_15427 | 3300011336 | Freshwater | MITINNDQLKELEAFINQIPTQYGLPLLQFLGKLNAEQNPPIEEAKEV* |
Ga0153800_10044292 | 3300011995 | Freshwater | MITINEQQLKDLEAFINTIPTAYGLPLLQFLGKLNAEQNPKEDAKVVDLKED* |
Ga0153799_10114631 | 3300012012 | Freshwater | MITINNDQIKELEAFINQIPTQYGLPLLQFLGKLNAEQNPPIEEAKEV* |
Ga0136712_10100542 | 3300012266 | Freshwater | MITINQDQIKELEAFINTIPTAYGLPLLQFLGKLNAEQNPPTESTEA* |
Ga0157208_100032895 | 3300012667 | Freshwater | MITLSADQVKELEQFINTIPTAYGLPLLQFLGKIAQEQNTQTEVKED* |
Ga0164292_105082493 | 3300013005 | Freshwater | MLTLNEQQIKELEAFINTIPTAYGLPLLQFLGKLNAEQNPPQEVKED* |
Ga0164294_100765722 | 3300013006 | Freshwater | MISINEQQLKDLEAFINQIPTQYGLPLLQFLGKLNAEQNPPVEEAKVD* |
Ga0164294_100905472 | 3300013006 | Freshwater | MITINEQQLKDLEAFINSIPTAYGLPLLQFLGKLNAEQNPKEDAKVVNLKED* |
Ga0181364_10119923 | 3300017701 | Freshwater Lake | MITLNETQVKELEQFINTIPTAYWLPLFQFLGKLPQDQNPQQ |
Ga0181350_10029985 | 3300017716 | Freshwater Lake | MITSNEQQIKELEAFINQIPTIYGLPLLQFLGKLNAEQNPLVEEAKEV |
Ga0181365_10139532 | 3300017736 | Freshwater Lake | MITINEQQIKELEAFINQIPTIYGLPLLQFLGKLNAEQNPLVEEAKEV |
Ga0181344_10057323 | 3300017754 | Freshwater Lake | MITINEQQIKELEAFINTIPTAYGLPLLQFLGKLNAEQNPPVEEVKEV |
Ga0181344_10408661 | 3300017754 | Freshwater Lake | MITLNETQIKELEAFINTIPTAYGLPLLQFLGKLNAEQNPQTE |
Ga0181344_12271292 | 3300017754 | Freshwater Lake | MISINEQQLKDLEAFINTIPTAYGLPLLQFLGKLNAEQNPPIEEAKVD |
Ga0181601_106625392 | 3300018041 | Salt Marsh | MITINEQQIKELEAFINTIPTAYGLPLLQFLGKLNAEQNPQVEEAKVD |
Ga0207193_10449321 | 3300020048 | Freshwater Lake Sediment | MITLNEQQIKELEAFINTIPTAYGLPLLQFLGKLNAEQNPPQESTEA |
Ga0211734_102523991 | 3300020159 | Freshwater | MITINEQQIKELEAFINTIPTAYGLPLLQFLGKLNAEQNPPVEEAKLD |
Ga0211734_110791612 | 3300020159 | Freshwater | MITINQEQIKELEAFINTIPTAYGLPLLQFLGKLNAEQNPPQEVTQD |
Ga0211733_108941022 | 3300020160 | Freshwater | MKKIELNEEHLKSLEAFINTIPTAYGLPLLQFLGKLNAEQNPPQEATQD |
Ga0211726_107136239 | 3300020161 | Freshwater | MITINEQQIKDLEAFINTIPTAYGLPLLQFLGKLNAEQNPPIEEAKEV |
Ga0211729_112506773 | 3300020172 | Freshwater | MITINEQQIKELEAFINTIPTAYGLPLLQFLGKLNAEQNPPVEEAKEV |
Ga0211731_117235681 | 3300020205 | Freshwater | MITINEQQLKDLETFINTIPTAYGLPLLQFLGKLNAEQNPK |
Ga0208364_10004563 | 3300020533 | Freshwater | MITLNEQQVKELEQFINTIPTAYGLPLLQFLGKLNAEQNPQTELTED |
Ga0208853_10030964 | 3300020546 | Freshwater | MITLNEQQIKELEAFINTIPTAYGLPLLQFLGKLNAEQNPPQETKED |
Ga0208853_10079673 | 3300020546 | Freshwater | MITINETQIKELEAFINTIPTAYGLPLLQFLGKLNAEQNPPQESTEA |
Ga0208856_10105923 | 3300020548 | Freshwater | MITINEQQLKDLEAFINQIPTQYGLPLLQFLGKLNAEQNPPVEEVKEV |
Ga0207942_10129494 | 3300020549 | Freshwater | MITINEQQIKELEAFINQIPTQYGLPLLQFLGKLNAEQNPPIEEAKEV |
Ga0208600_10044682 | 3300020550 | Freshwater | MITINEQQIKELEAFINQIPTQYGLPLLQFLGKLNAEQNPPIEEAKVD |
Ga0208600_10294313 | 3300020550 | Freshwater | VYKIKTMITINQEQIKELEAFINTIPTAYGLPLLQFLGKLNAEQNPPQETTEA |
Ga0208599_10625441 | 3300020554 | Freshwater | MISINEQQLKDLEAFINTIPTAYGLPLLQFLGKLNAEQNPPIEEAKEV |
Ga0208598_10051503 | 3300020568 | Freshwater | MIQLNETQIKELEAFINTIPTAYGLPLLQFLGKLNAEQNPPQESTEA |
Ga0207909_10001247 | 3300020572 | Freshwater | MITINQDQIKELEAFINTIPTAYGLPLLQFLGKLNAEQNPPQVQELQTED |
Ga0214206_100005020 | 3300021131 | Freshwater | MITINEQQLKDLEAFINTIPTAYGLPLVQFLGKLNAEQNPPVEEAKEV |
Ga0194047_100079408 | 3300021354 | Anoxic Zone Freshwater | MITINNEQLKELEAFINQIPTIYGLPLLQFLGKLNAEQNPPIEEVTEA |
Ga0194047_101852371 | 3300021354 | Anoxic Zone Freshwater | INEQQLKDLEAFINTIPTAYGLPLVQFLAKLNAEQNPQVEEAKEV |
Ga0194045_10220993 | 3300021516 | Anoxic Zone Freshwater | MITINNDQLKELEAFINQIPTAYGLPLLQFLGKLNAEQNPPVEEANQD |
Ga0194048_100001882 | 3300021519 | Anoxic Zone Freshwater | MITINEQQLKDLEAFINTIPTAYGLPLLQFLGKLNAEQNPPVEDAKVD |
Ga0194048_101787032 | 3300021519 | Anoxic Zone Freshwater | MITINNEQLKELEAFINQIPTQYGLPLLQFLGKLNAEQNPPIEEVTEA |
Ga0194059_10209755 | 3300021600 | Anoxic Zone Freshwater | MITINEQQLKDLETFINQIPTQYGLPLLQFLGKLNAEQNPPVEEVTEA |
Ga0194059_10602051 | 3300021600 | Anoxic Zone Freshwater | MITINEQQLKDLESFINTIPTAYGLPLLQFLGKLNAEQNPPVEEAKEV |
Ga0213922_10264114 | 3300021956 | Freshwater | MITLSTEQLKELEAFINQMPTMYGLPLLQYLGKINAEQNPQTEEKTEA |
Ga0222714_106177182 | 3300021961 | Estuarine Water | MITINQDQIKELEAFINTIPTAYGLPLLQFLGKIAQEQNQSTESTEA |
Ga0222713_101338473 | 3300021962 | Estuarine Water | MITINQDQIKELEAFINTIPTAYGLPLLQFLGKIAQEQNQPTESTEA |
Ga0222712_100769797 | 3300021963 | Estuarine Water | INEQQLKDLETFINQIPTAYGLPLLQFLGKLVEEQKPKKEEIPTEDWINKLKKED |
Ga0244777_1000151211 | 3300024343 | Estuarine | MISINEQQLKDLEAFINQIPTQYGLPLLQFLGKLNAEQNPPVEEVNAD |
Ga0244775_112338163 | 3300024346 | Estuarine | NTMISINEQQLKDLEAFINQIPTQYGLPLLQFLGKLNAEQNPPVEEVNAD |
Ga0208424_10376201 | 3300025445 | Aqueous | LKDLEAYINKIPTEFGLPLIQFLGKLNAEQNPQPAPEVPTEG |
Ga0208147_11180532 | 3300025635 | Aqueous | MITLNEQHLKDLEAYINKIPTEFGLPLIQFLGKLNAEQNPQPAPEVPTEG |
Ga0208643_11627692 | 3300025645 | Aqueous | MITINEQQIKELEAFINTIPTAYGLPLLQFLGKLNAEQNPPIEEAKEV |
Ga0208784_10688022 | 3300025732 | Aqueous | MITLNEQHLKDLEAYINKIPTEFGLPLIQFLGKLNAEQNPQPAPEVQT |
Ga0208644_10600212 | 3300025889 | Aqueous | MITLNEQHLKDLEAYINKIPTEFGLPLIQFLGKLNAEQNPQPAPEVQTEG |
Ga0208644_11257691 | 3300025889 | Aqueous | MITLNEQHLKDLEAYINKIPTEFGLPLIQFLGKLNAEQNPQPAPEV |
Ga0255074_10145754 | 3300027121 | Freshwater | TMITINEQQLKDLEAFINQIPTQYGLPLLQFLGKLNAEQNPPVEEAKEV |
Ga0255071_10167924 | 3300027127 | Freshwater | MITINEQQLKDLEAFINQIPTQYGLPLLQFLGKLNAEQNPPVEEAKEV |
Ga0255077_10113511 | 3300027529 | Freshwater | ITINEQQLKDLEAFINQIPTQYGLPLLQFLGKLNAEQNPPVEEAKEV |
Ga0209033_10729473 | 3300027697 | Freshwater Lake | MITINNDQIKDLEAFINTIPTAYGLPLLQFLGKLNAEQNPPIEEAKEV |
Ga0209499_10796774 | 3300027712 | Freshwater Lake | MITINEQQLKDLEAFINTIPTAYGLPLVQFLGKLNAEQNPPVEEVKEV |
Ga0209492_11954051 | 3300027721 | Freshwater Sediment | KTMITINQEQIKELEAFINTIPTAYGLPLLQFLGKLNAEQNPPQESTES |
Ga0209297_100067412 | 3300027733 | Freshwater Lake | MITINEQQLKDLESFINTIPTAYGLPLLQFLGKLNAEQNPKEDAKVIDIKED |
Ga0209297_10172195 | 3300027733 | Freshwater Lake | MITINNDQIKELEAFINTIPTAYGLPLLQFLGKLNAEQNPPIEEAKEV |
Ga0209297_10334633 | 3300027733 | Freshwater Lake | MITINNDQLKELEAFINQIPTAYGLPLLQFLGKLNAEQNPPVEDVTEA |
Ga0209597_100030239 | 3300027746 | Freshwater Lake | MITINEQQLKDLEAFINTIPTAYGLPLLQFLGKLNAEQNPKEDAKVVNLKED |
Ga0209597_100149227 | 3300027746 | Freshwater Lake | MITINNDQLKELEAFINQIPTAYGLPLIQFLGKLNAEQNPPVEEVTEA |
Ga0209084_10863942 | 3300027749 | Freshwater Lake | MITINNDQLKELEAFINQIPTAYGLPLLQFLGKLNAEQNPPVEDANQV |
Ga0209596_100028214 | 3300027754 | Freshwater Lake | MITINNDQLKELEAFINQIPTAYGLPLLQFLGKLNAEQNPPVEEVTEE |
Ga0209596_100028264 | 3300027754 | Freshwater Lake | MITINNDQIKELEAFINTIPTAYGLPLLQFLGKLNAEQNPPVEEAKEV |
Ga0209596_10258692 | 3300027754 | Freshwater Lake | MISINEQQLKDLEAFINTIPTAYGLPLLQFLGKLNAEQNPPVEEAKLD |
Ga0209296_100106819 | 3300027759 | Freshwater Lake | MITINETQIKELEAFINTIPTAYGLPLLQFLGKLNAEQNPPQETTEA |
Ga0209296_10018558 | 3300027759 | Freshwater Lake | MITINEQQIKDLESFINTIPTAYGLPLLQFLGKLNAEQNPPIEEAKEV |
Ga0209296_10317312 | 3300027759 | Freshwater Lake | MITINEQQLKDLEAFINTIPTAYGLPLLQFLGKLNAEQNPPVEEAKEV |
Ga0209088_1000049112 | 3300027763 | Freshwater Lake | MITINEQQLKDLEAFINTIPTAYGLPLVQFLGKLNAEQNPPIEEAKEV |
Ga0209134_100460083 | 3300027764 | Freshwater Lake | MITINEQQIKDLEAFINTIPTAYGLPLLQFLGKLNAEQNPQIEEAKEV |
Ga0209134_100842062 | 3300027764 | Freshwater Lake | MITINQDQLKELEAFINQIPTAYGLPLLQFLGKLNAEQNPPQESTEA |
Ga0209770_100255001 | 3300027769 | Freshwater Lake | TMITINEQQIKELEAFINTIPTAYGLPLLQFLGKLNAEQNPPVEEVKEV |
Ga0209829_101299784 | 3300027777 | Freshwater Lake | MITINEQQLKDLEAFINQIPTQYGLPLIQFLGKLNAEQNPPVEEVTEA |
Ga0209246_100078677 | 3300027785 | Freshwater Lake | MITINETQIKELEAFINTIPTAYGLPLLQFLGKLNAEQNPQTEVKED |
Ga0209107_1000026912 | 3300027797 | Freshwater And Sediment | MLNLSDENLKELEAFINTIPTAYGLPLLQFLGKLNAEQNPPIEEAKEV |
Ga0209107_1000058828 | 3300027797 | Freshwater And Sediment | MITISEQQLKDLEAFINTIPTAYGLPLLQFLGKLNAEQNPPIEEAKEI |
Ga0209353_100943682 | 3300027798 | Freshwater Lake | MISINEQQLKDLEAFINQIPTQYGLPLLQFLGKLNAEQNPPIEEAKEV |
Ga0209353_104106371 | 3300027798 | Freshwater Lake | MITINEQQLKDLESFINTIPTAYGLPLLQFLGKLNAEQNPQTEVKED |
Ga0209262_103612592 | 3300027841 | Freshwater | MIQLSETQVKELEAFINTIPTAYGLPLLQFLGKLNAEQNPPQEVKKD |
Ga0209253_108849873 | 3300027900 | Freshwater Lake Sediment | INEQQIKDLEAFINTIPTAYGLPLLQFLGKLNAEQNPPIEEAKEV |
Ga0209079_101624322 | 3300027972 | Freshwater Sediment | MITINQEQIKELEAFINTIPTAYGLPLLQFLGKLNAEQNPPQETKED |
Ga0209298_102523332 | 3300027973 | Freshwater Lake | MITINNDQIKELEAFINQIPTIYGLPLLQFLGKLNAEQNPQAPEAEVVEG |
Ga0247723_10708431 | 3300028025 | Deep Subsurface Sediment | TINQEQIKELEAFINTIPTAYGLPLLQFLGKLNAEQNPQTEVTED |
Ga0304729_10121107 | 3300028392 | Freshwater Lake | MITINNDQLKELEAFINQIPTQYGLPLLQFLGKLNAEQNPPVEEAKVD |
Ga0315907_1002892214 | 3300031758 | Freshwater | MITLNETQIKELEAFINTIPTAYGLPLLQFLGKLNAEQNPPQESTEA |
Ga0315907_101381405 | 3300031758 | Freshwater | MITINETQLKELEAFINQIPTAYGLPLLQFLGKLNAEQNPQTESTEA |
Ga0315899_100686382 | 3300031784 | Freshwater | MITINQEQLKELEAFINQIPTAYGLPLLQFLGKLNAEQNPQTEVTED |
Ga0315908_100170633 | 3300031786 | Freshwater | MITINETQIKELEAFINTIPTAYGLPLLQFLGKLNAEQNPTTEVTED |
Ga0315908_103727223 | 3300031786 | Freshwater | MITLNETQIKELEAFINTIPTAYGLPLLQFLGKLNAEQNPTTEVTEN |
Ga0315900_104059553 | 3300031787 | Freshwater | MITINQEQIKELEAFINTIPTAYGLPLLQFLGKLNAEQNQPQESTEA |
Ga0315909_100728386 | 3300031857 | Freshwater | MITINQDQIKELEAFINTIPTAYGLPLLQFLGKLNAEQNPPTESTEA |
Ga0315909_102536573 | 3300031857 | Freshwater | MITINETQIKELEAFINTIPTAYGLPLLQFLGKLNAEQN |
Ga0315909_103848413 | 3300031857 | Freshwater | MITINQDQIKELEAFINTIPTAYGLPLLQFLGKLNAEQNPQTESTEA |
Ga0315903_106193333 | 3300032116 | Freshwater | MITINEQQIKELEAFINTIPNAYGLPLLQFLGKLNAEQNPPIEEAKEI |
Ga0335003_0176595_793_939 | 3300033995 | Freshwater | MIQINNDQLKELEAFINQIPTIYGLPLLQFLGKLNAEQNPPIEEAKEI |
Ga0335003_0246320_642_788 | 3300033995 | Freshwater | MITINEQQLKDLEAFINTIPTAYGLPLLQFLGKLNAEQNPPIEEAKEV |
Ga0334991_0005471_450_593 | 3300034013 | Freshwater | MITINQDQIKELEAFINTIPTAYGLPLLQFLGKLNAEQNPPQETTED |
Ga0334985_0067008_65_208 | 3300034018 | Freshwater | MITLNETQIKELEAFINTIPTAYGLPLLQFLGKLNAEQNPPQETKED |
Ga0334985_0588216_38_181 | 3300034018 | Freshwater | MITINQEQIKELEAFINTIPTAYGLPLLQFLGKLNAEQNPPQETTED |
Ga0335021_0119046_1390_1521 | 3300034023 | Freshwater | NQDQIKELEAFINTIPTAYGLPLLQFLGKLNAEQNPPQESTEA |
Ga0334987_0000773_27160_27312 | 3300034061 | Freshwater | MITINQEQIKELEAFINTIPTAYGLPLLQFLGKLNAEQNPPQVQELQTED |
Ga0335010_0542287_328_471 | 3300034092 | Freshwater | MITINQEQIKELEAFINTIPTAYGLPLLQFLGKLNAEQNPPQEATQD |
Ga0335012_0581180_334_477 | 3300034093 | Freshwater | MITINETQLKELEAFINQIPTVYGLPLLQFLGKLNAEQNPPQEVTQD |
Ga0335031_0006665_232_375 | 3300034104 | Freshwater | MITINQDQIKELEAFINTIPTAYGLPLLQFLGKLNAEQNPPQEATQD |
Ga0335031_0263657_818_961 | 3300034104 | Freshwater | MITLNEQQVKELEQFINTIPTAYGLPLLQFLGKLNAEQNPPQEVNQD |
Ga0335031_0394613_146_289 | 3300034104 | Freshwater | MITINQEQIKELEAFINQIPTQYGLPLLQFLGKLNAEQNPPQESTEA |
Ga0335035_0345012_534_680 | 3300034105 | Freshwater | MIQINNDQLKELEAFINQIPTIYGLPLLQFLGKLNAEQNPPIEEAKEV |
Ga0335033_0103084_1063_1209 | 3300034117 | Freshwater | MITLNEQQLKDLEAFINTIPTAYGLPLLQFLGKLNAEQNPPIEEAKEV |
Ga0335052_0113071_578_721 | 3300034279 | Freshwater | MITINQEQIKELEAFINTIPTAYGLQLLQFLGKLNAEQNPPQETTED |
Ga0334997_0429949_291_443 | 3300034280 | Freshwater | MITINQDQIKELEAFINTIPTAYGLPLLQFLGKLNAEQNPPQVQEPQTED |
Ga0335007_0012274_547_693 | 3300034283 | Freshwater | MIQIKNDQLKELEAFINTIPTAYGLPLLQFLGKLNAEQNPPIEEAKVD |
Ga0335013_0264503_341_484 | 3300034284 | Freshwater | MLTLNEQQIKELEAFINTIPTAYGLPLLQFLGKLNAEQNPPQEVKED |
Ga0335048_0281653_113_256 | 3300034356 | Freshwater | MITINETQVKELEAFINQIPTQYGLPLLQFLGKLNAEQNPPEETTEA |
Ga0335048_0413309_31_174 | 3300034356 | Freshwater | MITINQEQIKELEAFIQTIPTAYGLPLLQFLGKLNAEQNPQTEVTED |
⦗Top⦘ |