Basic Information | |
---|---|
Family ID | F021107 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 220 |
Average Sequence Length | 41 residues |
Representative Sequence | MITLLLIVVGFAGGFYAGVKNAKSAKVEKAVDILKALKGK |
Number of Associated Samples | 106 |
Number of Associated Scaffolds | 220 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 10.00 % |
% of genes near scaffold ends (potentially truncated) | 23.64 % |
% of genes from short scaffolds (< 2000 bps) | 70.00 % |
Associated GOLD sequencing projects | 86 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.42 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (64.545 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (41.818 % of family members) |
Environment Ontology (ENVO) | Unclassified (68.636 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (73.182 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 54.41% β-sheet: 0.00% Coil/Unstructured: 45.59% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 220 Family Scaffolds |
---|---|---|
PF01391 | Collagen | 1.36 |
PF13481 | AAA_25 | 0.91 |
PF01343 | Peptidase_S49 | 0.91 |
PF13384 | HTH_23 | 0.91 |
PF12684 | DUF3799 | 0.91 |
PF05136 | Phage_portal_2 | 0.91 |
PF04404 | ERF | 0.91 |
PF01464 | SLT | 0.91 |
PF05876 | GpA_ATPase | 0.45 |
PF00149 | Metallophos | 0.45 |
PF07921 | Fibritin_C | 0.45 |
PF14743 | DNA_ligase_OB_2 | 0.45 |
PF04851 | ResIII | 0.45 |
PF03837 | RecT | 0.45 |
PF04275 | P-mevalo_kinase | 0.45 |
COG ID | Name | Functional Category | % Frequency in 220 Family Scaffolds |
---|---|---|---|
COG0616 | Periplasmic serine protease, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 1.82 |
COG5511 | Phage capsid protein | Mobilome: prophages, transposons [X] | 0.91 |
COG3723 | Recombinational DNA repair protein RecT | Replication, recombination and repair [L] | 0.45 |
COG5525 | Phage terminase, large subunit GpA | Mobilome: prophages, transposons [X] | 0.45 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 79.55 % |
Unclassified | root | N/A | 20.45 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002091|JGI24028J26656_1001139 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6370 | Open in IMG/M |
3300002098|JGI24219J26650_1010366 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1554 | Open in IMG/M |
3300002098|JGI24219J26650_1017582 | Not Available | 1012 | Open in IMG/M |
3300003277|JGI25908J49247_10059298 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 979 | Open in IMG/M |
3300003277|JGI25908J49247_10128106 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 599 | Open in IMG/M |
3300003277|JGI25908J49247_10154727 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 534 | Open in IMG/M |
3300003393|JGI25909J50240_1017381 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1682 | Open in IMG/M |
3300005580|Ga0049083_10002050 | All Organisms → cellular organisms → Bacteria | 7632 | Open in IMG/M |
3300005580|Ga0049083_10022604 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2263 | Open in IMG/M |
3300005580|Ga0049083_10034608 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1799 | Open in IMG/M |
3300005584|Ga0049082_10001075 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8420 | Open in IMG/M |
3300006037|Ga0075465_10016184 | All Organisms → cellular organisms → Bacteria | 1438 | Open in IMG/M |
3300006037|Ga0075465_10043332 | Not Available | 941 | Open in IMG/M |
3300006484|Ga0070744_10046488 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1275 | Open in IMG/M |
3300006484|Ga0070744_10065667 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1056 | Open in IMG/M |
3300006803|Ga0075467_10653177 | Not Available | 536 | Open in IMG/M |
3300006805|Ga0075464_10028864 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 2941 | Open in IMG/M |
3300006805|Ga0075464_10041441 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2508 | Open in IMG/M |
3300006805|Ga0075464_10072345 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 1943 | Open in IMG/M |
3300006805|Ga0075464_10159427 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1328 | Open in IMG/M |
3300006805|Ga0075464_10191120 | Not Available | 1214 | Open in IMG/M |
3300006805|Ga0075464_10199171 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 1189 | Open in IMG/M |
3300006805|Ga0075464_10259439 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1041 | Open in IMG/M |
3300006805|Ga0075464_10661037 | Not Available | 645 | Open in IMG/M |
3300006805|Ga0075464_10690078 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 631 | Open in IMG/M |
3300006805|Ga0075464_11039768 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 515 | Open in IMG/M |
3300006920|Ga0070748_1105875 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1069 | Open in IMG/M |
3300006920|Ga0070748_1174789 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 792 | Open in IMG/M |
3300007559|Ga0102828_1000513 | All Organisms → cellular organisms → Bacteria | 6864 | Open in IMG/M |
3300007559|Ga0102828_1025362 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1310 | Open in IMG/M |
3300007708|Ga0102859_1037215 | Not Available | 1323 | Open in IMG/M |
3300007734|Ga0104986_1391 | Not Available | 14575 | Open in IMG/M |
3300008114|Ga0114347_1008621 | Not Available | 5285 | Open in IMG/M |
3300008266|Ga0114363_1174794 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 687 | Open in IMG/M |
3300008448|Ga0114876_1000487 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 30875 | Open in IMG/M |
3300008448|Ga0114876_1012128 | All Organisms → Viruses → Predicted Viral | 4832 | Open in IMG/M |
3300009026|Ga0102829_1057176 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1176 | Open in IMG/M |
3300009068|Ga0114973_10249109 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 958 | Open in IMG/M |
3300009151|Ga0114962_10034440 | Not Available | 3449 | Open in IMG/M |
3300009151|Ga0114962_10172408 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1284 | Open in IMG/M |
3300009151|Ga0114962_10172409 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1284 | Open in IMG/M |
3300009151|Ga0114962_10383917 | Not Available | 764 | Open in IMG/M |
3300009151|Ga0114962_10715691 | Not Available | 511 | Open in IMG/M |
3300009152|Ga0114980_10003115 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 11454 | Open in IMG/M |
3300009152|Ga0114980_10004222 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9697 | Open in IMG/M |
3300009152|Ga0114980_10005073 | All Organisms → cellular organisms → Bacteria | 8792 | Open in IMG/M |
3300009152|Ga0114980_10022039 | Not Available | 3974 | Open in IMG/M |
3300009152|Ga0114980_10027710 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3512 | Open in IMG/M |
3300009152|Ga0114980_10031561 | Not Available | 3272 | Open in IMG/M |
3300009152|Ga0114980_10060619 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2283 | Open in IMG/M |
3300009152|Ga0114980_10125436 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1528 | Open in IMG/M |
3300009152|Ga0114980_10141392 | Not Available | 1429 | Open in IMG/M |
3300009152|Ga0114980_10145211 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1408 | Open in IMG/M |
3300009152|Ga0114980_10145395 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1407 | Open in IMG/M |
3300009152|Ga0114980_10150087 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1382 | Open in IMG/M |
3300009152|Ga0114980_10162031 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 1324 | Open in IMG/M |
3300009152|Ga0114980_10165217 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1310 | Open in IMG/M |
3300009152|Ga0114980_10186533 | Not Available | 1223 | Open in IMG/M |
3300009152|Ga0114980_10187681 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1218 | Open in IMG/M |
3300009152|Ga0114980_10195704 | All Organisms → Viruses → Predicted Viral | 1190 | Open in IMG/M |
3300009152|Ga0114980_10384087 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 807 | Open in IMG/M |
3300009152|Ga0114980_10606225 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 618 | Open in IMG/M |
3300009155|Ga0114968_10747040 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 510 | Open in IMG/M |
3300009158|Ga0114977_10064386 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2254 | Open in IMG/M |
3300009159|Ga0114978_10093348 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1995 | Open in IMG/M |
3300009159|Ga0114978_10093587 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1992 | Open in IMG/M |
3300009159|Ga0114978_10191575 | Not Available | 1296 | Open in IMG/M |
3300009159|Ga0114978_10213614 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1214 | Open in IMG/M |
3300009160|Ga0114981_10744383 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 518 | Open in IMG/M |
3300009161|Ga0114966_10082802 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2189 | Open in IMG/M |
3300009161|Ga0114966_10110915 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1831 | Open in IMG/M |
3300009161|Ga0114966_10704775 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 552 | Open in IMG/M |
3300009161|Ga0114966_10740926 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 534 | Open in IMG/M |
3300009163|Ga0114970_10032842 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3440 | Open in IMG/M |
3300009163|Ga0114970_10070939 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 2204 | Open in IMG/M |
3300009163|Ga0114970_10089545 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1917 | Open in IMG/M |
3300009163|Ga0114970_10472628 | Not Available | 687 | Open in IMG/M |
3300009164|Ga0114975_10773706 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 504 | Open in IMG/M |
3300009180|Ga0114979_10009194 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6444 | Open in IMG/M |
3300009181|Ga0114969_10040710 | Not Available | 3156 | Open in IMG/M |
3300009181|Ga0114969_10469476 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 709 | Open in IMG/M |
3300009182|Ga0114959_10438812 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 635 | Open in IMG/M |
3300009183|Ga0114974_10162816 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1388 | Open in IMG/M |
3300009183|Ga0114974_10289245 | Not Available | 967 | Open in IMG/M |
3300009183|Ga0114974_10769604 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 518 | Open in IMG/M |
3300009183|Ga0114974_10812069 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 501 | Open in IMG/M |
3300009184|Ga0114976_10052923 | All Organisms → Viruses → Predicted Viral | 2389 | Open in IMG/M |
3300009184|Ga0114976_10489789 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 635 | Open in IMG/M |
3300009185|Ga0114971_10000338 | All Organisms → cellular organisms → Bacteria | 30107 | Open in IMG/M |
3300009185|Ga0114971_10044459 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 2805 | Open in IMG/M |
3300010370|Ga0129336_10262749 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 967 | Open in IMG/M |
3300010885|Ga0133913_12466005 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1269 | Open in IMG/M |
3300010970|Ga0137575_10018198 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1166 | Open in IMG/M |
3300011115|Ga0151514_10263 | All Organisms → cellular organisms → Bacteria | 25469 | Open in IMG/M |
3300012352|Ga0157138_1066537 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 566 | Open in IMG/M |
3300012663|Ga0157203_1005318 | Not Available | 2466 | Open in IMG/M |
3300012663|Ga0157203_1014356 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1234 | Open in IMG/M |
3300013285|Ga0136642_1042069 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1268 | Open in IMG/M |
3300013285|Ga0136642_1062145 | Not Available | 1003 | Open in IMG/M |
3300013295|Ga0170791_15785994 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1336 | Open in IMG/M |
3300013372|Ga0177922_10722143 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 504 | Open in IMG/M |
3300013372|Ga0177922_10769322 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 651 | Open in IMG/M |
3300013372|Ga0177922_10987160 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 507 | Open in IMG/M |
3300017716|Ga0181350_1058260 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1012 | Open in IMG/M |
3300017723|Ga0181362_1028245 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1196 | Open in IMG/M |
3300017736|Ga0181365_1072450 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 848 | Open in IMG/M |
3300017736|Ga0181365_1158476 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 534 | Open in IMG/M |
3300017761|Ga0181356_1223034 | Not Available | 548 | Open in IMG/M |
3300017766|Ga0181343_1167028 | Not Available | 609 | Open in IMG/M |
3300017774|Ga0181358_1208655 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 635 | Open in IMG/M |
3300017774|Ga0181358_1271186 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 526 | Open in IMG/M |
3300017774|Ga0181358_1288051 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 504 | Open in IMG/M |
3300017777|Ga0181357_1016132 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2971 | Open in IMG/M |
3300017777|Ga0181357_1039436 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1856 | Open in IMG/M |
3300017777|Ga0181357_1105468 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1066 | Open in IMG/M |
3300017777|Ga0181357_1267999 | Not Available | 588 | Open in IMG/M |
3300017780|Ga0181346_1002666 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7885 | Open in IMG/M |
3300017784|Ga0181348_1046002 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1796 | Open in IMG/M |
3300017784|Ga0181348_1074451 | Not Available | 1355 | Open in IMG/M |
3300017784|Ga0181348_1082342 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1275 | Open in IMG/M |
3300017784|Ga0181348_1189527 | Not Available | 745 | Open in IMG/M |
3300017785|Ga0181355_1094833 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1238 | Open in IMG/M |
3300019784|Ga0181359_1052219 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1575 | Open in IMG/M |
3300019784|Ga0181359_1248813 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 540 | Open in IMG/M |
3300020048|Ga0207193_1076460 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3225 | Open in IMG/M |
3300020048|Ga0207193_1616742 | Not Available | 721 | Open in IMG/M |
3300020160|Ga0211733_10591552 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1054 | Open in IMG/M |
3300021438|Ga0213920_1095102 | Not Available | 571 | Open in IMG/M |
3300021519|Ga0194048_10019920 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2923 | Open in IMG/M |
3300021519|Ga0194048_10083619 | Not Available | 1242 | Open in IMG/M |
3300021519|Ga0194048_10128777 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 961 | Open in IMG/M |
3300021519|Ga0194048_10273123 | Not Available | 612 | Open in IMG/M |
3300021600|Ga0194059_1083930 | Not Available | 1005 | Open in IMG/M |
3300021956|Ga0213922_1124704 | Not Available | 505 | Open in IMG/M |
3300021961|Ga0222714_10093044 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 1928 | Open in IMG/M |
3300021962|Ga0222713_10184786 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 1408 | Open in IMG/M |
3300021962|Ga0222713_10472356 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 756 | Open in IMG/M |
3300024343|Ga0244777_10081129 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2088 | Open in IMG/M |
3300024346|Ga0244775_10333054 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1255 | Open in IMG/M |
3300024346|Ga0244775_10524042 | Not Available | 966 | Open in IMG/M |
3300024346|Ga0244775_10571801 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 919 | Open in IMG/M |
3300024348|Ga0244776_10017844 | All Organisms → cellular organisms → Bacteria | 5921 | Open in IMG/M |
3300024348|Ga0244776_10167558 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 1587 | Open in IMG/M |
3300024537|Ga0255225_1062623 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 631 | Open in IMG/M |
3300025451|Ga0208426_1020370 | Not Available | 990 | Open in IMG/M |
3300025451|Ga0208426_1027628 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 859 | Open in IMG/M |
3300025645|Ga0208643_1154104 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 579 | Open in IMG/M |
3300025896|Ga0208916_10039201 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1923 | Open in IMG/M |
3300025896|Ga0208916_10077812 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → Pedobacter → Pedobacter schmidteae | 1386 | Open in IMG/M |
3300025896|Ga0208916_10121470 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1114 | Open in IMG/M |
3300025896|Ga0208916_10128077 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1084 | Open in IMG/M |
3300026415|Ga0256298_1063303 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 508 | Open in IMG/M |
3300027193|Ga0208800_1000798 | All Organisms → cellular organisms → Bacteria | 3965 | Open in IMG/M |
3300027193|Ga0208800_1003383 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1971 | Open in IMG/M |
3300027193|Ga0208800_1056364 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 535 | Open in IMG/M |
3300027586|Ga0208966_1002205 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6052 | Open in IMG/M |
3300027586|Ga0208966_1024814 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1762 | Open in IMG/M |
3300027621|Ga0208951_1000377 | All Organisms → cellular organisms → Bacteria | 20580 | Open in IMG/M |
3300027621|Ga0208951_1014832 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2542 | Open in IMG/M |
3300027707|Ga0209443_1125947 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 951 | Open in IMG/M |
3300027708|Ga0209188_1045441 | Not Available | 1983 | Open in IMG/M |
3300027708|Ga0209188_1297168 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 539 | Open in IMG/M |
3300027732|Ga0209442_1169333 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 828 | Open in IMG/M |
3300027733|Ga0209297_1000501 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 24980 | Open in IMG/M |
3300027733|Ga0209297_1003904 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7925 | Open in IMG/M |
3300027733|Ga0209297_1005543 | All Organisms → cellular organisms → Bacteria | 6462 | Open in IMG/M |
3300027733|Ga0209297_1038695 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2195 | Open in IMG/M |
3300027733|Ga0209297_1042342 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 2083 | Open in IMG/M |
3300027733|Ga0209297_1071491 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1530 | Open in IMG/M |
3300027733|Ga0209297_1121532 | Not Available | 1099 | Open in IMG/M |
3300027734|Ga0209087_1338336 | Not Available | 524 | Open in IMG/M |
3300027736|Ga0209190_1004479 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9055 | Open in IMG/M |
3300027736|Ga0209190_1073710 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1642 | Open in IMG/M |
3300027746|Ga0209597_1024007 | Not Available | 3291 | Open in IMG/M |
3300027746|Ga0209597_1025103 | All Organisms → Viruses → Predicted Viral | 3201 | Open in IMG/M |
3300027746|Ga0209597_1051606 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2034 | Open in IMG/M |
3300027749|Ga0209084_1005159 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8943 | Open in IMG/M |
3300027749|Ga0209084_1028693 | Not Available | 2884 | Open in IMG/M |
3300027749|Ga0209084_1047214 | Not Available | 2091 | Open in IMG/M |
3300027749|Ga0209084_1100775 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1273 | Open in IMG/M |
3300027754|Ga0209596_1002495 | All Organisms → cellular organisms → Bacteria | 15200 | Open in IMG/M |
3300027754|Ga0209596_1002791 | Not Available | 14254 | Open in IMG/M |
3300027754|Ga0209596_1005728 | Not Available | 9114 | Open in IMG/M |
3300027759|Ga0209296_1063271 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1882 | Open in IMG/M |
3300027759|Ga0209296_1072772 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1716 | Open in IMG/M |
3300027759|Ga0209296_1088978 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1501 | Open in IMG/M |
3300027759|Ga0209296_1113088 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1277 | Open in IMG/M |
3300027759|Ga0209296_1129854 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1160 | Open in IMG/M |
3300027759|Ga0209296_1129855 | Not Available | 1160 | Open in IMG/M |
3300027759|Ga0209296_1136719 | Not Available | 1119 | Open in IMG/M |
3300027763|Ga0209088_10011049 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4866 | Open in IMG/M |
3300027764|Ga0209134_10155365 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 788 | Open in IMG/M |
3300027764|Ga0209134_10196345 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 695 | Open in IMG/M |
3300027782|Ga0209500_10018098 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4150 | Open in IMG/M |
3300027782|Ga0209500_10023331 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3573 | Open in IMG/M |
3300027782|Ga0209500_10027937 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3209 | Open in IMG/M |
3300027785|Ga0209246_10280491 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 642 | Open in IMG/M |
3300027798|Ga0209353_10166819 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 976 | Open in IMG/M |
3300027808|Ga0209354_10123262 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1058 | Open in IMG/M |
3300027899|Ga0209668_10930665 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 586 | Open in IMG/M |
3300027900|Ga0209253_10214181 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1531 | Open in IMG/M |
3300027969|Ga0209191_1001748 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 14083 | Open in IMG/M |
3300027973|Ga0209298_10002453 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 11518 | Open in IMG/M |
3300027973|Ga0209298_10004498 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8102 | Open in IMG/M |
3300027973|Ga0209298_10009500 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 5245 | Open in IMG/M |
3300027973|Ga0209298_10020177 | Not Available | 3345 | Open in IMG/M |
3300031707|Ga0315291_10457788 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1196 | Open in IMG/M |
3300031885|Ga0315285_10837998 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 571 | Open in IMG/M |
3300031951|Ga0315904_10173092 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2155 | Open in IMG/M |
3300031997|Ga0315278_11350956 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 692 | Open in IMG/M |
3300032046|Ga0315289_10834187 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 805 | Open in IMG/M |
3300032173|Ga0315268_10518479 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1177 | Open in IMG/M |
3300033992|Ga0334992_0050286 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2376 | Open in IMG/M |
3300033992|Ga0334992_0120225 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1382 | Open in IMG/M |
3300034050|Ga0335023_0134806 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1410 | Open in IMG/M |
3300034051|Ga0335024_0441474 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 643 | Open in IMG/M |
3300034064|Ga0335001_0649454 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 552 | Open in IMG/M |
3300034105|Ga0335035_0333760 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 883 | Open in IMG/M |
3300034117|Ga0335033_0085744 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1842 | Open in IMG/M |
3300034356|Ga0335048_0478412 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 601 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 41.82% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 14.55% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 10.00% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 4.55% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 4.09% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 3.64% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.64% |
Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 2.27% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 2.27% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 2.27% |
Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic | 1.36% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 1.36% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.36% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.91% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 0.91% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.91% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 0.91% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.91% |
Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.91% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.45% |
Pond Fresh Water | Environmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water | 0.45% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.45% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002091 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-F8 metagenome | Environmental | Open in IMG/M |
3300002098 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-B7 metagenome | Environmental | Open in IMG/M |
3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
3300003393 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD | Environmental | Open in IMG/M |
3300005580 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF | Environmental | Open in IMG/M |
3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
3300006037 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_>0.8_DNA | Environmental | Open in IMG/M |
3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
3300006803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA | Environmental | Open in IMG/M |
3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
3300007708 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 | Environmental | Open in IMG/M |
3300007734 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015Jan | Environmental | Open in IMG/M |
3300008114 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA | Environmental | Open in IMG/M |
3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
3300009182 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG | Environmental | Open in IMG/M |
3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
3300009185 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG | Environmental | Open in IMG/M |
3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
3300010970 | Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV1, april 2016 | Environmental | Open in IMG/M |
3300011115 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2016May | Environmental | Open in IMG/M |
3300012352 | Freshwater microbial communities from Baxter Creek, Ontario, Canada - S37 | Environmental | Open in IMG/M |
3300012663 | Freshwater microbial communities from Indian River, Ontario, Canada - S50 | Environmental | Open in IMG/M |
3300013285 | Freshwater microbial communities from Lower Cathedral Lake, Yosemite National Park, California, USA - 13028-31Y | Environmental | Open in IMG/M |
3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
3300021438 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17 MG | Environmental | Open in IMG/M |
3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
3300021600 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L626-11m | Environmental | Open in IMG/M |
3300021956 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MG | Environmental | Open in IMG/M |
3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
3300024343 | Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction | Environmental | Open in IMG/M |
3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
3300024537 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300025451 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025645 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes) | Environmental | Open in IMG/M |
3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300026415 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300027193 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 (SPAdes) | Environmental | Open in IMG/M |
3300027586 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027621 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027707 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD (SPAdes) | Environmental | Open in IMG/M |
3300027708 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027732 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes) | Environmental | Open in IMG/M |
3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027746 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027749 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027764 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
3300027899 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes) | Environmental | Open in IMG/M |
3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027973 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
3300031885 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36 | Environmental | Open in IMG/M |
3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
3300032046 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40 | Environmental | Open in IMG/M |
3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
3300033992 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035 | Environmental | Open in IMG/M |
3300034050 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07May2013-rr0095 | Environmental | Open in IMG/M |
3300034051 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13May2013-rr0097 | Environmental | Open in IMG/M |
3300034064 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME14Nov2013-rr0054 | Environmental | Open in IMG/M |
3300034105 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127 | Environmental | Open in IMG/M |
3300034117 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jun2014-rr0124 | Environmental | Open in IMG/M |
3300034356 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI24028J26656_10011394 | 3300002091 | Lentic | MIYLILIVLGFAGGFYAGVKNASSSKVEKAVDILKALKGK* |
JGI24219J26650_10103663 | 3300002098 | Lentic | MIYILCIVLGFLGGFYAGVKNANSAKVEKAVDILKALKGK* |
JGI24219J26650_10175823 | 3300002098 | Lentic | MIYIICIVLGFLGGFFAGVKNANSAKVEKAVDILKALKGK* |
JGI25908J49247_100592983 | 3300003277 | Freshwater Lake | MIYILCIVLGFAGGFYAGLKNAKSAKVEKAVDILKALKGK* |
JGI25908J49247_101281062 | 3300003277 | Freshwater Lake | RRAETCHRQGWPDRRQMIYILCIVLGFAGGFYAGLKNAKSAKVEKAVDILKALKGK* |
JGI25908J49247_101547273 | 3300003277 | Freshwater Lake | MIYILCIVLGFAGGFYAGVKNAKSAKVEKAVDILKALKGK* |
JGI25909J50240_10173812 | 3300003393 | Freshwater Lake | MIYILCIVLGFAGGFYAGLKNAKSAKVEKAVDILKALKKGP* |
Ga0049083_100020508 | 3300005580 | Freshwater Lentic | MITLLLIAVAFAGGFYAGYKNAKSAKVEKAVDILKALKGK* |
Ga0049083_100226043 | 3300005580 | Freshwater Lentic | MITILLIVVAFAGGFYAGIKNAKSAKVEKAVDILKALKGK* |
Ga0049083_100346082 | 3300005580 | Freshwater Lentic | MITLLLIAIAFAGGFYAGVRNAKSAKVEKARSILDVLKGK* |
Ga0049082_100010758 | 3300005584 | Freshwater Lentic | MITLLLIVIAFAGGFYAGVKNADSSKLSKGKELLEALKGKK* |
Ga0075465_100161844 | 3300006037 | Aqueous | MTTLILVGVALFLGFCGGFYAGIKNASSSKVEKAKSILDQLKGR* |
Ga0075465_100433322 | 3300006037 | Aqueous | MITILVSLLIGFIGGFIAGLKNAKSAKVEKAKTILDALKGK* |
Ga0070744_100464882 | 3300006484 | Estuarine | MITLLLIVVAFTGGFYAGIKNAKSAKVEKAKSILDALKGK* |
Ga0070744_100656672 | 3300006484 | Estuarine | MITILVCTLIGFVGGFYAGIKNAKSAKVEKAKSILDQLKGK* |
Ga0075467_106531773 | 3300006803 | Aqueous | MITIIVSVLIGFIGGFIAGLKNASSSKVEKAKSILDALKGR* |
Ga0075464_100288643 | 3300006805 | Aqueous | MITLLLIAVAFAGGFYAGVRNAKSAKVEKAVDILKALKSKD* |
Ga0075464_100414415 | 3300006805 | Aqueous | MITLLLIAVAFAGGFYVGLKNASSSKVEKARSILDILKGR* |
Ga0075464_100723452 | 3300006805 | Aqueous | MITIALILIAFAGGFYAGIKNAKSAKVEKAVDILKALKGK* |
Ga0075464_101594272 | 3300006805 | Aqueous | MITLLLIVIAFAGGFYAGIKNAKSAKVEKAVDILKALKGK* |
Ga0075464_101911203 | 3300006805 | Aqueous | MITILVSLLVGFIGGFIAGIKNAKSAKVEKAVDILKALKGK* |
Ga0075464_101991713 | 3300006805 | Aqueous | MITILVSLLIGFISGFIAGIKNAKSAKVEKAVDILKALKGK* |
Ga0075464_102594392 | 3300006805 | Aqueous | MITLLLIAVAFAGGFYAGVRNAKSAKVEKARSILDVLKGR* |
Ga0075464_106610371 | 3300006805 | Aqueous | MITILVSLLIGFIGGFIAGIKNAKSAKVEKAVDILNALKGK* |
Ga0075464_106900782 | 3300006805 | Aqueous | SYPIAMITILVSLLIGFIGGFIAGLKNAKSAKVEKAVDILKALKGK* |
Ga0075464_110397682 | 3300006805 | Aqueous | LAFVPLNMITILVCTLIGFVGGFYAGLKNAKSAKVEKAKSILDALKGK* |
Ga0070748_11058753 | 3300006920 | Aqueous | LLIGFIGGFIAGLKNAKSAKVEKAVDILKALKGK* |
Ga0070748_11747892 | 3300006920 | Aqueous | MITLLLIVIAFAGGFYAGIKNAKSAKVEKAVDILKALKSKD* |
Ga0102828_10005138 | 3300007559 | Estuarine | MITILVSLLIGFIGGFIAGLKNASSAKVEKARSILDALKGK* |
Ga0102828_10253623 | 3300007559 | Estuarine | MITLLLIVVAFAGGFYAGIKNAKSAKVEKAKSILDALKGK* |
Ga0102859_10372152 | 3300007708 | Estuarine | MITLLLIVVAFAGGFYAGLKNASSSKVEKAKTILDALKGK* |
Ga0104986_139111 | 3300007734 | Freshwater | MTYLLCIAVGFAGGFVAGLKNAKSAKVEKAKSILDVLKGR* |
Ga0114347_10086219 | 3300008114 | Freshwater, Plankton | MTYLLCIALGFAGGFYAGVRNAKSAKVEKAKSILDVLKGR* |
Ga0114363_11747941 | 3300008266 | Freshwater, Plankton | PMTYLLCIALGFAGGFYAGVRNAKSAKVEKAKSILDVLKGR* |
Ga0114876_100048728 | 3300008448 | Freshwater Lake | MITTLILIALAFAVGFYAGVKNSASSKIAKAKDILDAIKK* |
Ga0114876_10121286 | 3300008448 | Freshwater Lake | MITTLILIALAFAGGFYAGVKNAASSKIAKAKDILDAIKK* |
Ga0102829_10571763 | 3300009026 | Estuarine | MITLLLIVVAFTGGFYAGIKNAKSAKVEKAKSILDQLKG |
Ga0114973_102491092 | 3300009068 | Freshwater Lake | MITILVSLLIGFIGGFIAGVKNAKSAKVEKAVDILKALKGK* |
Ga0114962_100344403 | 3300009151 | Freshwater Lake | MITIIVSLLIGFIGGFIAGIKNAKSAKVEKAVDILKALKGKD* |
Ga0114962_101724082 | 3300009151 | Freshwater Lake | MIYLILIVLGFAGGFYAGVKNASSKKVDKAIDILKALKGK* |
Ga0114962_101724092 | 3300009151 | Freshwater Lake | MIYFILIVLGFAGGFYAGVKNASSKKVDKAIDILKALKGK* |
Ga0114962_103839171 | 3300009151 | Freshwater Lake | MITILVSLLIGFIGGFYAGVKNAKSAKVEKAVDILKALKGK* |
Ga0114962_107156912 | 3300009151 | Freshwater Lake | VSILIGFLGGFYAGVKNAKSAKVEKAVDILKALKGK* |
Ga0114980_1000311521 | 3300009152 | Freshwater Lake | MITLILIVVAFAGGFYAGVKNAKSAKVEKAVDILKALKGK* |
Ga0114980_100042229 | 3300009152 | Freshwater Lake | MITILVCTLIGFLGGFYAGVKNAKSAKVEKAKSILDQLKGK* |
Ga0114980_100050731 | 3300009152 | Freshwater Lake | MITFLVSVLIGFIGGFIAGIKNAKSAKVEKVVDILKALKSKD* |
Ga0114980_100220393 | 3300009152 | Freshwater Lake | MITLLLIVVAFAGGFIAGIKNAKSAKVEKAVDILKALKGK* |
Ga0114980_100277101 | 3300009152 | Freshwater Lake | MITLFLIVVAFAGGFYAGVRNAKSAKVEKARSILDVLKGR* |
Ga0114980_100315618 | 3300009152 | Freshwater Lake | MITLLLIVVAFAGGFYAGVKNAKSAKVEKAVDILKALKGK* |
Ga0114980_100606194 | 3300009152 | Freshwater Lake | MIYIICIVLGFAGGFYAGVKNASSAKVEKALDILKALKGK* |
Ga0114980_101254362 | 3300009152 | Freshwater Lake | MITLLLIVVAFAGGFYAGVKNAKSAKVEKAVDILKALKSKD* |
Ga0114980_101413924 | 3300009152 | Freshwater Lake | MITILGSLLIGLLIGFIAGVKNAKSAKVEKAVDILKALKSKD* |
Ga0114980_101452112 | 3300009152 | Freshwater Lake | MITILVSLLIGFLGGFYAGIKNAKSAKVEKAVDILKALKSKD* |
Ga0114980_101453952 | 3300009152 | Freshwater Lake | MITILVSLLIGFIGGFIAGIKNAKSAKVEKAVDILKALKGK* |
Ga0114980_101500873 | 3300009152 | Freshwater Lake | MITLLLIVVAFAGGFYAGIKNAKSAKVEKAVDILKALKGKD* |
Ga0114980_101620312 | 3300009152 | Freshwater Lake | MITILVSLLIGFIGGFIAGIKNAKSAKVEKAVDILKALKSKD* |
Ga0114980_101652172 | 3300009152 | Freshwater Lake | MILALICIAVGFAGGFYAGLKNANSSKVEKAKTILDALKGK* |
Ga0114980_101865333 | 3300009152 | Freshwater Lake | MITILVSLLIGFLGGFYAGVKNANSAKVEKAVDILKALKGK* |
Ga0114980_101876813 | 3300009152 | Freshwater Lake | MITLLLIVVAFAGGFYAGIKNAKSAKVEKAVDILKALKGK* |
Ga0114980_101957041 | 3300009152 | Freshwater Lake | MITLLLIVVAFAGGFYAGVKNAKSAKVERAVDILKALKSKD* |
Ga0114980_103840872 | 3300009152 | Freshwater Lake | MITILVSLLIGFIGGFIAGLKNAKSAKVEKAVDIIKALKSKD* |
Ga0114980_106062251 | 3300009152 | Freshwater Lake | TILVSLLIGFLGGFYAGVKNANSAKVEKAVDILKALKGK* |
Ga0114968_107470402 | 3300009155 | Freshwater Lake | MITLLLIVVGFAGGFYAGVKNAKSAKVEKAVDILKALKGK* |
Ga0114977_100643863 | 3300009158 | Freshwater Lake | MITFLIGILIGFLGGFYAGIKNAKSAKVEKAVDILKALKGK* |
Ga0114978_100933483 | 3300009159 | Freshwater Lake | MTTLVLIGVSLVLGFLGGFYAGVKNAKSAKVEKAVDILSALKGK* |
Ga0114978_100935873 | 3300009159 | Freshwater Lake | MTTLVLIGVSLVLGFAGGFYAGVKNAKSAKVEKAVDILSALKGK* |
Ga0114978_101915753 | 3300009159 | Freshwater Lake | MITILVSILIGFIGGFIAGIKNAKSAKVEKAVDILKALKSKD* |
Ga0114978_102136143 | 3300009159 | Freshwater Lake | MITILVCTLIGFLGGFYAGVKNAKSAKVEKAKSILDALKGK* |
Ga0114981_107443831 | 3300009160 | Freshwater Lake | LLLIVVAFAGGFYAGIKNAKSAKVEKAVDILKALKGK* |
Ga0114966_100828022 | 3300009161 | Freshwater Lake | MITFLIGLLIGFIGGFIGGIKNAKSAKVEKAVDILKALKGK* |
Ga0114966_101109153 | 3300009161 | Freshwater Lake | MITLLLIVVAFAGGFYAGIKNAKSAKVEKAVDIIRALKGK* |
Ga0114966_107047753 | 3300009161 | Freshwater Lake | MITLLLIVVAFAGGFYAGIKNAKSAKVEKAVDILKALKSKD* |
Ga0114966_107409261 | 3300009161 | Freshwater Lake | MITIIVSLLIGFIGGFIAGVKNAKSAKVEKAVDILKALKGK* |
Ga0114970_100328425 | 3300009163 | Freshwater Lake | MITLILIAVAFAGGFYAGVKNAKSSKVEKAVDIIRALKGK* |
Ga0114970_100709392 | 3300009163 | Freshwater Lake | MITILLIVVAFAGGFYAGIKNAKSAKVEKAVDILKALKSKD* |
Ga0114970_100895452 | 3300009163 | Freshwater Lake | MITLILIVVAFAGGFYAGVKNAKSSKVEKAVDILKALKGK* |
Ga0114970_104726283 | 3300009163 | Freshwater Lake | MITLLFIVVAFAGGFYAGVKNAKSAKVEKTVDILKALKGK* |
Ga0114975_107737061 | 3300009164 | Freshwater Lake | LVSLLIGFIGGFIAGVKNAKSAKVEKAVDILKALKGK* |
Ga0114979_100091949 | 3300009180 | Freshwater Lake | MITLILIVVAFAGGFYAGVKNAKSAKVEKAKSILDALKGK* |
Ga0114969_100407107 | 3300009181 | Freshwater Lake | MITLLFIVVAFAGGFYAGVKNAKSAKVEKAVDILKALKGK* |
Ga0114969_104694761 | 3300009181 | Freshwater Lake | MITLLLIVVAFAGGFYAGIKNAKSAKVEKAVDILKALKRGK* |
Ga0114959_104388123 | 3300009182 | Freshwater Lake | MIYLILIVLGFAGGFYAGVKNASSKKVDKAIDILKAL |
Ga0114974_101628162 | 3300009183 | Freshwater Lake | MITILVSLLIGFLGGFYAGIKNAKSAKVEKAVDILKALKGKD* |
Ga0114974_102892453 | 3300009183 | Freshwater Lake | MITILVSLLIGFIGGFIAGVKNAKSAKVEKAVDILKAL |
Ga0114974_107696041 | 3300009183 | Freshwater Lake | HPMITILVSLLIGFIGGFIAGVKNAKSAKVEKAVDILKALKGK* |
Ga0114974_108120691 | 3300009183 | Freshwater Lake | MITILVSILIGFIGGFISGIKNAKSAKVEKVVDILKAL |
Ga0114976_100529231 | 3300009184 | Freshwater Lake | MITILVCTLIGFLGGFYAGVKNAKSAKVEKAKSILDQLKG |
Ga0114976_104897891 | 3300009184 | Freshwater Lake | TILVSILIGFIGGFIAGIKNAKSAKVEKAVDILKALKSKD* |
Ga0114971_1000033845 | 3300009185 | Freshwater Lake | ITILVSLLIGFIGGFYAGVKNAKSAKVEKAVDILKALKGK* |
Ga0114971_100444593 | 3300009185 | Freshwater Lake | MITILVSLLIGFIGGFYAGVKNAKSAKVEKAVDILKALKG |
Ga0129336_102627492 | 3300010370 | Freshwater To Marine Saline Gradient | MTYLLCIALGFAGGFYAGVRNAKSAKVEKAKTILDVLKGR* |
Ga0133913_124660053 | 3300010885 | Freshwater Lake | MITLLLIVVAFAGGFYAGIKNAKSAKVEKAVDILK |
Ga0137575_100181983 | 3300010970 | Pond Fresh Water | MIAFILCIAVGFAGGFYAGIKNANSAKVEKAKSLLDIFKGR* |
Ga0151514_1026320 | 3300011115 | Freshwater | MIAYLLCIAVGFAGGFVAGLKNASSAKVEKAKSILDVLKGR* |
Ga0157138_10665373 | 3300012352 | Freshwater | MIYLLCIALGFAGGFYAGLKNASSSKVEKAKSILDALKGR* |
Ga0157203_10053183 | 3300012663 | Freshwater | MITLLLILVAFAGGCYAGYKNAKSAKVEKAKSILDALKGK* |
Ga0157203_10143563 | 3300012663 | Freshwater | MITLLLIVVAFAGGFYAGIKNAKSAKVEKAKSIVDALKGK* |
Ga0136642_10420692 | 3300013285 | Freshwater | MIIIILSIIAAFAGGFYAGVKNASSSKVEKAVDILKALKGK* |
Ga0136642_10621452 | 3300013285 | Freshwater | MIALFIAAITGFIGGFYAGVKNASSSKVEKAVDILKALKGK* |
Ga0170791_157859943 | 3300013295 | Freshwater | MITLILIVVAFAGGFYAGVKNAKSAKVEKAVDILKALKSKD* |
Ga0177922_107221431 | 3300013372 | Freshwater | MIYILCIVLGFAGGFYAGLKNAKSAKVEKAVDILK |
Ga0177922_107693223 | 3300013372 | Freshwater | MTTLVLIGVSLVLGFAGGFYAGVKNAKSAKVEKAVDILSALKKGR* |
Ga0177922_109871601 | 3300013372 | Freshwater | MIYILCIVLGFAGGFYAGLKNAKSAKVEKAVDILKA |
Ga0181350_10582601 | 3300017716 | Freshwater Lake | MITILLIVVAFAGGFYAGIKNAKSAKGENAVDSLKALKGK |
Ga0181362_10282453 | 3300017723 | Freshwater Lake | MITILFIVVAFAGGFYAGIKNAKSAKVEKAVDILKALKGK |
Ga0181365_10724502 | 3300017736 | Freshwater Lake | MIYILCIVLGFAGGFYAGVKNAKSAKVEKAVDILKALKGK |
Ga0181365_11584761 | 3300017736 | Freshwater Lake | GWPDRRQMIYILCIVLGFAGGFYAGLKNAKSAKVEKAVDILKALKGK |
Ga0181356_12230342 | 3300017761 | Freshwater Lake | IVLGFAGGFYAGLKNAKSAKVEKAVDILKALKKGP |
Ga0181343_11670282 | 3300017766 | Freshwater Lake | MITLVLIGVSLVLGFLGGFYAGVKNAKSAKVEKAVDILSALKGK |
Ga0181358_12086551 | 3300017774 | Freshwater Lake | ILCIVLGFAGGFYAGLKNAKSAKVEKAVDILKALKKGP |
Ga0181358_12711863 | 3300017774 | Freshwater Lake | MIYILCIVLGFAGGFYAGIKNAKSAKVEKAVDILKALKKGP |
Ga0181358_12880511 | 3300017774 | Freshwater Lake | LIVVAFAGGFYAGIKNAKSAKVEKAVDILKALKGK |
Ga0181357_10161324 | 3300017777 | Freshwater Lake | MITILVCTLIGFAGGFYAGLKNANSSKVEKAKSILDQLKGK |
Ga0181357_10394363 | 3300017777 | Freshwater Lake | MITLLLIVVAFAGGCYAGYKNAKSAKVEKAVDILMALKGK |
Ga0181357_11054683 | 3300017777 | Freshwater Lake | MITLLLIAVAFAGGFYAGVRNAKSAKVEKARSILDVLKG |
Ga0181357_12679991 | 3300017777 | Freshwater Lake | SGGRTIPMITLLLIVVAFAGGFYAGVRNAKSAKVEKARSILDVLKGK |
Ga0181346_100266617 | 3300017780 | Freshwater Lake | DSRPSSFQPLNMITILVCTLIGFAGGFYAGLKNANSSKVEKAKSILDQLKGK |
Ga0181348_10460022 | 3300017784 | Freshwater Lake | MITLLLIVVAFAGGFYAGVRNAKSAKVEKARSILDVLKGK |
Ga0181348_10744513 | 3300017784 | Freshwater Lake | MITILLIVVAFAGGFYAGIKNAKSAKVEKAVDILKA |
Ga0181348_10823422 | 3300017784 | Freshwater Lake | MITLLLIAVAFAGGFYAGVRNAKSAKGEKARSILDVLKGK |
Ga0181348_11895271 | 3300017784 | Freshwater Lake | MTTLVLIGVSLVLGFLGGFYAGVKNAKSAKVEKAVDILSALKKGR |
Ga0181355_10948334 | 3300017785 | Freshwater Lake | DRRQMIYILCIVLGFAGGFYAGLKNAKSAKVEKAVDILKALKGK |
Ga0181359_10522193 | 3300019784 | Freshwater Lake | MITILLIVVAFAGGFYAGIKNAKSAKVEKAVDILKALKGK |
Ga0181359_12488131 | 3300019784 | Freshwater Lake | MIYILCIVLGFAGGFYAGLKNAKSAKVEKAVDILKALKKGP |
Ga0207193_10764609 | 3300020048 | Freshwater Lake Sediment | MIYLLCIALGFAGGFYAGLKNASSSKVEKAKSILDALKGK |
Ga0207193_16167423 | 3300020048 | Freshwater Lake Sediment | MTTLVIGGIALLLGFLGGFYAGVKNAKSAKVEKAVDILSALKGK |
Ga0211733_105915523 | 3300020160 | Freshwater | MITLLLIAVAFAGGFYVGLKNASSSKIEKARSILDILKGR |
Ga0213920_10951022 | 3300021438 | Freshwater | MIAFLIGLAIGAIGGFIAGVKNASSSKVEKAVDILKALKGK |
Ga0194048_100199204 | 3300021519 | Anoxic Zone Freshwater | MIYLILIVLGFAGGFYAGVKNASSKKVEKAVDILKALKGK |
Ga0194048_100836192 | 3300021519 | Anoxic Zone Freshwater | MTTLVLIGVSLVLGFLGGFYAGVKNASSKKVEKAVDILKALKGK |
Ga0194048_101287772 | 3300021519 | Anoxic Zone Freshwater | MITLLLIVVAFAGGFYAGVKNAKSAKVEKAKTILDALKGK |
Ga0194048_102731231 | 3300021519 | Anoxic Zone Freshwater | MITLLLIVVAFAGGFYAGVKNAKSAKVEKAVDILKALKSKD |
Ga0194059_10839301 | 3300021600 | Anoxic Zone Freshwater | MTTLILIGLSLVLGFIGGFYAGVKNASSKKVDKAIDILKALKGK |
Ga0213922_11247042 | 3300021956 | Freshwater | MISFLIGLLIGAIGGFIAGLKNASSSKVEKAVDILKALKGK |
Ga0222714_100930442 | 3300021961 | Estuarine Water | MTTLLLIAVSLVLGFAGGFYAGLKNASSAKVEKAKSILDVLKGR |
Ga0222713_101847863 | 3300021962 | Estuarine Water | MTTLLLIAVSLVLGFAGGFYAGLKNASSAKVEKAKSIL |
Ga0222713_104723563 | 3300021962 | Estuarine Water | MTTLLLIAVSLVLGFAGGFYAGLKNASSAKVEKAKSI |
Ga0244777_100811291 | 3300024343 | Estuarine | MITILVCTLIGFVGGFYAGIKNAKSAKVEKAKSILDQLKGK |
Ga0244775_103330543 | 3300024346 | Estuarine | MITLLLIVVAFAGGFYAGIKNAKSAKVEKAKSILDALKGK |
Ga0244775_105240421 | 3300024346 | Estuarine | MITILVSLLIGFIGGFIAGLKNASSAKVEKARSILDALKGK |
Ga0244775_105718012 | 3300024346 | Estuarine | MITLLLIVVAFTGGFYAGIKNAKSAKVEKAKSILDALKGK |
Ga0244776_100178441 | 3300024348 | Estuarine | MITILVCTLIGFVGGFYAGIKNAKSAKVEKAKSIL |
Ga0244776_101675582 | 3300024348 | Estuarine | MITLLLIVVAFAGGFYAGLKNASSSKVEKAKTILDALKGK |
Ga0255225_10626232 | 3300024537 | Freshwater | MIYLLCIAVGLAVGFYAGIKNANSAKVEKAKSILDILKGR |
Ga0208426_10203703 | 3300025451 | Aqueous | MITILVSLLIGFIGGFIAGLKNAKSAKVEKAKTILDALKGK |
Ga0208426_10276282 | 3300025451 | Aqueous | MTTLILVGVALFLGFCGGFYAGIKNASSSKVEKAKSILDQLKGR |
Ga0208643_11541043 | 3300025645 | Aqueous | MITLLLIVIAFAGGFYAGIKNAKSAKVEKAVDILKALKGK |
Ga0208916_100392013 | 3300025896 | Aqueous | MITILVSLLIGFIGGFIAGLKNAKSAKVEKAVDILKALKGK |
Ga0208916_100778123 | 3300025896 | Aqueous | MITILVSLLIGFISGFIAGIKNAKSAKVEKAVDILKALKGK |
Ga0208916_101214702 | 3300025896 | Aqueous | MITLLLIAVAFAGGFYVGLKNASSSKVEKARSILDILKGR |
Ga0208916_101280771 | 3300025896 | Aqueous | MITIALILIAFAGGFFAGIKNAKSAKVEKAVDILKALKGK |
Ga0256298_10633031 | 3300026415 | Freshwater | MIYLLCIAVGLAVGFYAGIKNANSAKVEKAKSILDILK |
Ga0208800_10007981 | 3300027193 | Estuarine | PMITILVCTLIGFVGGFYAGIKNAKSAKVEKAKSILDQLKGK |
Ga0208800_10033833 | 3300027193 | Estuarine | MITILVCTLIGFVGGFYAGIKNAKSAKVEKAKSILDQ |
Ga0208800_10563641 | 3300027193 | Estuarine | MITILVCTLIGFVGGFYAGIKNAKSAKVEKAKSILDQL |
Ga0208966_10022058 | 3300027586 | Freshwater Lentic | MITLLLIVIAFAGGFYAGVKNADSSKLSKGKELLEALKGKK |
Ga0208966_10248145 | 3300027586 | Freshwater Lentic | YILCIVLGFAGGFYAGLKNAKSAKVEKAVDILKALKKGP |
Ga0208951_100037725 | 3300027621 | Freshwater Lentic | MITLLLIAVAFAGGFYAGYKNAKSAKVEKAVDILKALKGK |
Ga0208951_10148325 | 3300027621 | Freshwater Lentic | MITLLLIAIAFAGGFYAGVRNAKSAKVEKARSILDVLKGK |
Ga0209443_11259472 | 3300027707 | Freshwater Lake | MITLLLIVVAFAGGCYAGYKNAKSAKVEKAVDILKALKGK |
Ga0209188_10454411 | 3300027708 | Freshwater Lake | LIVLGFAGGFYAGVKNASSKKVDKAIDILKALKGK |
Ga0209188_12971683 | 3300027708 | Freshwater Lake | MIYLILIVLGFAGGFYAGVKNASSKKVDKAIDILKALKGK |
Ga0209442_11693331 | 3300027732 | Freshwater Lake | PYRTQMIYILCIVLGFAGGFYAGLKNAKSAKVEKAVDILKALKGK |
Ga0209297_100050129 | 3300027733 | Freshwater Lake | MITILVCTLIGFLGGFYAGVKNAKSAKVEKAKSILDQLKGK |
Ga0209297_100390421 | 3300027733 | Freshwater Lake | MITILVSLLIGFLGGFYAGIKNAKSAKVEKAVDILKALKGKD |
Ga0209297_10055432 | 3300027733 | Freshwater Lake | MITFLIGILIGFLGGFYAGIKNAKSAKVEKAVDILKALKGK |
Ga0209297_10386954 | 3300027733 | Freshwater Lake | MIYIICIVLGFAGGFYAGVKNASSAKVEKALDILKALKGK |
Ga0209297_10423422 | 3300027733 | Freshwater Lake | MITILVSLLIGFIGGFIAGVKNAKSAKVEKAVDILKALKGK |
Ga0209297_10714912 | 3300027733 | Freshwater Lake | MILALICIAVGFAGGFYAGLKNANSSKVEKAKTILDALKGK |
Ga0209297_11215321 | 3300027733 | Freshwater Lake | MITILVSLLIGFIGGFIAGIKNAKSAKVEKAVDILKALK |
Ga0209087_13383361 | 3300027734 | Freshwater Lake | MITILVSILIGFIGGFIAGIKNAKSAKVEKAVDILKALKSKD |
Ga0209190_100447916 | 3300027736 | Freshwater Lake | MITLILIAVAFAGGFYAGVKNAKSSKVEKAVDIIRALKGK |
Ga0209190_10737103 | 3300027736 | Freshwater Lake | MITLILIVVAFAGGFYAGVKNAKSSKVEKAVDILKALKGK |
Ga0209597_10240074 | 3300027746 | Freshwater Lake | MITILVSLLIGFIGGFYAGVKNAKSAKVEKAVDILKALKGK |
Ga0209597_10251032 | 3300027746 | Freshwater Lake | MITLLFIVVAFAGGFYAGVKNAKSAKVEKAVDILKALKGK |
Ga0209597_10516063 | 3300027746 | Freshwater Lake | MITLLLIVVAFAGGFYAGIKNAKSAKVEKAVDILKALKSKD |
Ga0209084_10051593 | 3300027749 | Freshwater Lake | MITIIVSLLIGFIGGFIAGIKNAKSAKVEKAVDILKALKGKD |
Ga0209084_10286935 | 3300027749 | Freshwater Lake | MITILIGLLIGFIGGFYAGVKNAKSAKVEKAVDILKALKGK |
Ga0209084_10472143 | 3300027749 | Freshwater Lake | MITILVSLLIGFIGGFYAGIKNAKSAKVEKAVDILKALKGK |
Ga0209084_11007752 | 3300027749 | Freshwater Lake | MIYFILIVLGFAGGFYAGVKNASSKKVDKAIDILKALKGK |
Ga0209596_100249514 | 3300027754 | Freshwater Lake | MITLLLIVVGFAGGFYAGVKNAKSAKVEKAVDILKALKGK |
Ga0209596_100279113 | 3300027754 | Freshwater Lake | MITFLIGLLIGFIGGFIGGIKNAKSAKVEKAVDILKALKGK |
Ga0209596_10057286 | 3300027754 | Freshwater Lake | MITLLLIVVAFAGGFIAGIKNAKSAKVEKAVDILKALKGK |
Ga0209296_10632712 | 3300027759 | Freshwater Lake | MITLLLIVVAFAGGFYAGIKNAKSAKVEKAVDILKALKGKD |
Ga0209296_10727723 | 3300027759 | Freshwater Lake | MITILGSLLIGLLIGFIAGVKNAKSAKVEKAVDILKALKSKD |
Ga0209296_10889783 | 3300027759 | Freshwater Lake | MITILVSLLIGFIGGFIAGIKNAKSAKVEKAVDILKALKSKD |
Ga0209296_11130883 | 3300027759 | Freshwater Lake | MITILVSLLIGFLGGFYAGIKNAKSAKVEKAVDILKALKSKD |
Ga0209296_11298543 | 3300027759 | Freshwater Lake | MTTLVLIGVSLVLGFAGGFYAGVKNAKSAKVEKAVDILSALKGK |
Ga0209296_11298553 | 3300027759 | Freshwater Lake | MTTLVLIGVSLVLGFLGGFYAGVKNAKSAKVEKAVDILSALKGK |
Ga0209296_11367192 | 3300027759 | Freshwater Lake | MITILVSLLIGFIGGFIAGVKNAKSAKVEKAVDILKALKSKD |
Ga0209088_100110495 | 3300027763 | Freshwater Lake | MITLFLIVVAFAGGFYAGVRNAKSAKVEKARSILDVLKGR |
Ga0209134_101553653 | 3300027764 | Freshwater Lake | MITLLLIVVAFAGGFYAGIKNANSSKVEKAKSIVDALKGK |
Ga0209134_101963453 | 3300027764 | Freshwater Lake | MITLLLIAVAFAGGFYAGVRNANSAKVEKARSILDVLKGK |
Ga0209500_100180984 | 3300027782 | Freshwater Lake | MITFLVSVLIGFIGGFIAGIKNAKSAKVEKVVDILKALKSKD |
Ga0209500_100233312 | 3300027782 | Freshwater Lake | MITLLLIAVAFAGGFYAGVRNAKSAKVEKAVDILKALKSKD |
Ga0209500_100279379 | 3300027782 | Freshwater Lake | MITILVCTLIGFLGGFYAGVKNAKSAKVEKAKSILDALKGK |
Ga0209246_102804912 | 3300027785 | Freshwater Lake | IYILCIVLGFAGGFYAGLKNAKSAKVEKAVDILKALKGK |
Ga0209353_101668191 | 3300027798 | Freshwater Lake | QGWPDRRQMIYILCIVLGFAGGFYAGLKNAKSAKVEKAVDILKALKGK |
Ga0209354_101232621 | 3300027808 | Freshwater Lake | MITILVCTLIGFAGGFYAGLKNASSSKVEKAKSIIDQLKGK |
Ga0209668_109306652 | 3300027899 | Freshwater Lake Sediment | MITLVLIGVSLVLGFAGGFYAGVKNAKSAKVEKAVDILSALKGK |
Ga0209253_102141815 | 3300027900 | Freshwater Lake Sediment | MITLLLIVVAFAGGFYAGIKNAKSAKVEKAKTILDALKGK |
Ga0209191_100174824 | 3300027969 | Freshwater Lake | MITILVCTLIGFIGGFIAGIKNAKSAKVEKAKTILDQLKGK |
Ga0209298_1000245321 | 3300027973 | Freshwater Lake | MITLILIVVAFAGGFYAGVKNAKSAKVEKAVDILKALKGK |
Ga0209298_1000449813 | 3300027973 | Freshwater Lake | MITILVSLLIGFLGGFYAGVKNANSAKVEKAVDILKALKGK |
Ga0209298_100095008 | 3300027973 | Freshwater Lake | MITLLLIVVAFAGGFYAGVKNAKSAKVEKAVDILKALKGK |
Ga0209298_100201773 | 3300027973 | Freshwater Lake | MITLLLIVVAFAGGFYAGVKNAKSAKVERAVDILKALKSKD |
Ga0315291_104577881 | 3300031707 | Sediment | MITLLLIAVAFAGGFYAGVRNAKSAKVEKARSILDVLKGK |
Ga0315285_108379981 | 3300031885 | Sediment | MITLLLIAAVFAGGFYAGVRNAKSAKVEKARSILDVLKGK |
Ga0315904_101730923 | 3300031951 | Freshwater | MTYLLCIALGFAGGFYAGLRNAKSAKVEKARTILDVLKGR |
Ga0315278_113509562 | 3300031997 | Sediment | TPPMITLLLIAVAFAGGFYAGVRNAKSAKVEKARSILDVLKGK |
Ga0315289_108341872 | 3300032046 | Sediment | GDYFRRPRSMITLLLIAVAFAGGFYAGVRNAKSAKVEKARSILDVLKGK |
Ga0315268_105184791 | 3300032173 | Sediment | MITLLLIVVAFAGGFYAGIKNAKSAKVEKAKSILDALK |
Ga0334992_0050286_1960_2082 | 3300033992 | Freshwater | MITLLLIVVAFAGGFYAGIKNANSSKVEKAKSIIDQLKGK |
Ga0334992_0120225_1015_1137 | 3300033992 | Freshwater | MITLLLIVVAFAGGFYAGLKNANSSKVEKAKSIIDQLKGK |
Ga0335023_0134806_514_636 | 3300034050 | Freshwater | MITLLLIVVAFAGGFYAGLKNANSSKVEKAKSIIDALKGK |
Ga0335024_0441474_3_110 | 3300034051 | Freshwater | MITLLLIVVAFAGGFYAGIKNANSSKVEKAKSIIDQ |
Ga0335001_0649454_2_115 | 3300034064 | Freshwater | MITLLLIVVAFAGGFYAGIKNANSSKVEKAKSIIDQLK |
Ga0335035_0333760_76_198 | 3300034105 | Freshwater | MITLLLIVIGFAGGFYAGLKNANSSKVEKAKSIVDALKGK |
Ga0335033_0085744_1_117 | 3300034117 | Freshwater | MITLLLIVVAFAGGFYAGIKNANSSKVEKAKSIIDQLKG |
Ga0335048_0478412_15_137 | 3300034356 | Freshwater | MITLLLIVIGFAGGFYAGLKNANSSKVEKAKSIIDQLKGK |
⦗Top⦘ |