Metagenome / Metatranscriptome Family F021111

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F021111
Family Type	Metagenome / Metatranscriptome
Number of Sequences	220
Average Sequence Length	40 residues
Representative Sequence	MENLNQPSIQTDGGTIKETDAMGREKFWEDLGRPDDGK
Number of Associated Samples	136
Number of Associated Scaffolds	220

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Viruses
% of genes with valid RBS motifs	76.50 %
% of genes near scaffold ends (potentially truncated)	16.82 %
% of genes from short scaffolds (< 2000 bps)	70.45 %
Associated GOLD sequencing projects	128
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.19

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Duplodnaviria (52.273 % of family members)
NCBI Taxonomy ID	2731341
Taxonomy	All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (20.000 % of family members)
Environment Ontology (ENVO)	Unclassified (55.000 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Water (non-saline) (66.364 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 0.00% β-sheet: 9.09% Coil/Unstructured: 90.91%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.19
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.19
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 220 Family Scaffolds
PF01464	SLT	18.64
PF00534	Glycos_transf_1	4.55
PF01391	Collagen	1.82
PF00296	Bac_luciferase	1.82
PF13692	Glyco_trans_1_4	0.91
PF13640	2OG-FeII_Oxy_3	0.91
PF02945	Endonuclease_7	0.91
PF01844	HNH	0.91
PF01521	Fe-S_biosyn	0.45
PF02075	RuvC	0.45
PF13385	Laminin_G_3	0.45
PF02867	Ribonuc_red_lgC	0.45
PF05065	Phage_capsid	0.45
PF00366	Ribosomal_S17	0.45
PF06067	DUF932	0.45

COG ID	Name	Functional Category	% Frequency in 220 Family Scaffolds
COG2141	Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)	Coenzyme transport and metabolism [H]	1.82
COG0186	Ribosomal protein S17	Translation, ribosomal structure and biogenesis [J]	0.45
COG0209	Ribonucleotide reductase alpha subunit	Nucleotide transport and metabolism [F]	0.45
COG0316	Fe-S cluster assembly iron-binding protein IscA	Posttranslational modification, protein turnover, chaperones [O]	0.45
COG0817	Holliday junction resolvasome RuvABC endonuclease subunit RuvC	Replication, recombination and repair [L]	0.45
COG4653	Predicted phage phi-C31 gp36 major capsid-like protein	Mobilome: prophages, transposons [X]	0.45
COG4841	Uncharacterized conserved protein YneR, related to HesB/YadR/YfhF family	Function unknown [S]	0.45

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	56.36 %
Unclassified	root	N/A	43.64 %

Name	Rank	Taxonomy	Distribution
Viruses	superkingdom	All Organisms → Viruses	53.18 %
Unclassified	root	N/A	43.64 %
cellular organisms	root	All Organisms → cellular organisms	3.18 %

Name	Rank	Taxonomy	Distribution
Duplodnaviria	clade	All Organisms → Viruses → Duplodnaviria	52.27 %
Unclassified	root	N/A	43.64 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	3.18 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.45 %

Name	Rank	Taxonomy	Distribution
Heunggongvirae	kingdom	All Organisms → Viruses → Duplodnaviria → Heunggongvirae	52.27 %
Unclassified	root	N/A	43.64 %
unclassified Bacteria	no rank	All Organisms → cellular organisms → Bacteria → unclassified Bacteria	0.45 %
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	0.45 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.45 %

Name	Rank	Taxonomy	Distribution
Uroviricota	phylum	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota	52.27 %
Unclassified	root	N/A	43.64 %
Bacteroidetes/Chlorobi group	clade	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group	0.45 %
bacterium G20	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium G20	0.45 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.45 %

Name	Rank	Taxonomy	Distribution
Caudoviricetes	class	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	52.27 %
Unclassified	root	N/A	43.64 %
Balneolaeota	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota	0.45 %
bacterium G20	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium G20	0.45 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.45 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	43.64 %
environmental samples	no rank	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples	42.73 %
Balneolia	class	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia	0.45 %
Vilmaviridae	family	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Vilmaviridae	0.45 %
bacterium G20	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium G20	0.45 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.45 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	43.64 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	42.73 %
Wildcatvirus	genus	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Vilmaviridae → Wildcatvirus	0.45 %
Balneolales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales	0.45 %
bacterium G20	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium G20	0.45 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.45 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	43.64 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	42.73 %
Mycobacterium virus Wildcat	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Vilmaviridae → Wildcatvirus → Mycobacterium virus Wildcat	0.45 %
Balneolaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae	0.45 %
bacterium G20	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium G20	0.45 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.45 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	43.64 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	42.73 %
Balneola	genus	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola	0.45 %
Mycobacterium virus Wildcat	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Vilmaviridae → Wildcatvirus → Mycobacterium virus Wildcat	0.45 %
bacterium G20	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium G20	0.45 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.45 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	43.64 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	42.73 %
unclassified Balneola	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola	0.45 %
Mycobacterium virus Wildcat	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Vilmaviridae → Wildcatvirus → Mycobacterium virus Wildcat	0.45 %
bacterium G20	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium G20	0.45 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.45 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	43.64 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	42.73 %
Balneola sp.	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp.	0.45 %
Mycobacterium virus Wildcat	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Vilmaviridae → Wildcatvirus → Mycobacterium virus Wildcat	0.45 %
bacterium G20	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium G20	0.45 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.45 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000736\|JGI12547J11936_1002732	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	4951	Open in IMG/M
3300000756\|JGI12421J11937_10039547	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1617	Open in IMG/M
3300000882\|FwDRAFT_10036086	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	5104	Open in IMG/M
3300001851\|RCM31_10188658	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	520	Open in IMG/M
3300001968\|GOS2236_1051225	Not Available	1565	Open in IMG/M
3300002161\|JGI24766J26685_10000172	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	16804	Open in IMG/M
3300002408\|B570J29032_108909419	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	538	Open in IMG/M
3300002835\|B570J40625_101633755	Not Available	526	Open in IMG/M
3300004096\|Ga0066177_10199557	Not Available	820	Open in IMG/M
3300004112\|Ga0065166_10096678	Not Available	1067	Open in IMG/M
3300004112\|Ga0065166_10215419	Not Available	761	Open in IMG/M
3300004112\|Ga0065166_10237599	Not Available	729	Open in IMG/M
3300005069\|Ga0071350_1092733	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	1423	Open in IMG/M
3300005525\|Ga0068877_10403380	Not Available	771	Open in IMG/M
3300005527\|Ga0068876_10044952	Not Available	2707	Open in IMG/M
3300005527\|Ga0068876_10095603	All Organisms → cellular organisms → Bacteria	1775	Open in IMG/M
3300005527\|Ga0068876_10106602	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Vilmaviridae → Wildcatvirus → Mycobacterium virus Wildcat	1668	Open in IMG/M
3300005527\|Ga0068876_10157792	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1331	Open in IMG/M
3300005527\|Ga0068876_10168612	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1281	Open in IMG/M
3300005527\|Ga0068876_10190567	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1192	Open in IMG/M
3300005527\|Ga0068876_10233351	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1059	Open in IMG/M
3300005527\|Ga0068876_10269334	Not Available	973	Open in IMG/M
3300005527\|Ga0068876_10279163	Not Available	952	Open in IMG/M
3300005527\|Ga0068876_10321142	Not Available	876	Open in IMG/M
3300005527\|Ga0068876_10388576	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	779	Open in IMG/M
3300005527\|Ga0068876_10659103	Not Available	562	Open in IMG/M
3300005527\|Ga0068876_10676193	Not Available	553	Open in IMG/M
3300005527\|Ga0068876_10729806	Not Available	527	Open in IMG/M
3300005528\|Ga0068872_10551533	Not Available	614	Open in IMG/M
3300005581\|Ga0049081_10020462	Not Available	2511	Open in IMG/M
3300005581\|Ga0049081_10118664	Not Available	979	Open in IMG/M
3300005582\|Ga0049080_10028628	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1944	Open in IMG/M
3300005582\|Ga0049080_10041694	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1592	Open in IMG/M
3300005582\|Ga0049080_10045008	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1529	Open in IMG/M
3300005584\|Ga0049082_10110239	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	963	Open in IMG/M
3300005585\|Ga0049084_10024304	All Organisms → cellular organisms → Bacteria	2395	Open in IMG/M
3300005662\|Ga0078894_10076328	Not Available	2906	Open in IMG/M
3300005662\|Ga0078894_10457951	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1148	Open in IMG/M
3300005662\|Ga0078894_10481253	Not Available	1116	Open in IMG/M
3300005662\|Ga0078894_10579086	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1001	Open in IMG/M
3300005662\|Ga0078894_10774580	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	841	Open in IMG/M
3300005662\|Ga0078894_10881746	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	777	Open in IMG/M
3300005662\|Ga0078894_10892758	Not Available	771	Open in IMG/M
3300005662\|Ga0078894_11086433	Not Available	684	Open in IMG/M
3300005662\|Ga0078894_11526621	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	553	Open in IMG/M
3300005662\|Ga0078894_11691447	Not Available	519	Open in IMG/M
3300005758\|Ga0078117_1000952	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1130	Open in IMG/M
3300005805\|Ga0079957_1022373	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	4374	Open in IMG/M
3300005805\|Ga0079957_1047033	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2676	Open in IMG/M
3300005805\|Ga0079957_1064281	All Organisms → cellular organisms → Bacteria	2156	Open in IMG/M
3300005805\|Ga0079957_1125856	All Organisms → Viruses → Predicted Viral	1346	Open in IMG/M
3300006030\|Ga0075470_10000281	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	17032	Open in IMG/M
3300006484\|Ga0070744_10010719	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2723	Open in IMG/M
3300006639\|Ga0079301_1004716	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	5621	Open in IMG/M
3300006641\|Ga0075471_10016889	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	4383	Open in IMG/M
3300006862\|Ga0079299_1004685	Not Available	3319	Open in IMG/M
3300007165\|Ga0079302_1005510	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3491	Open in IMG/M
3300007304\|Ga0102689_1044532	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	700	Open in IMG/M
3300007974\|Ga0105747_1006197	Not Available	3058	Open in IMG/M
3300008055\|Ga0108970_10018460	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	762	Open in IMG/M
3300008107\|Ga0114340_1053352	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1760	Open in IMG/M
3300008107\|Ga0114340_1079449	Not Available	1358	Open in IMG/M
3300008107\|Ga0114340_1127031	Not Available	977	Open in IMG/M
3300008107\|Ga0114340_1132770	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	944	Open in IMG/M
3300008107\|Ga0114340_1164938	Not Available	797	Open in IMG/M
3300008107\|Ga0114340_1175562	Not Available	756	Open in IMG/M
3300008107\|Ga0114340_1187271	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	714	Open in IMG/M
3300008107\|Ga0114340_1198781	Not Available	675	Open in IMG/M
3300008107\|Ga0114340_1215045	Not Available	627	Open in IMG/M
3300008108\|Ga0114341_10209360	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1083	Open in IMG/M
3300008110\|Ga0114343_1169243	Not Available	672	Open in IMG/M
3300008110\|Ga0114343_1177759	Not Available	644	Open in IMG/M
3300008110\|Ga0114343_1181306	Not Available	633	Open in IMG/M
3300008110\|Ga0114343_1218400	Not Available	535	Open in IMG/M
3300008114\|Ga0114347_1053776	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1703	Open in IMG/M
3300008116\|Ga0114350_1106968	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	871	Open in IMG/M
3300008116\|Ga0114350_1139152	Not Available	697	Open in IMG/M
3300008258\|Ga0114840_1032325	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	853	Open in IMG/M
3300008259\|Ga0114841_1146841	Not Available	941	Open in IMG/M
3300008261\|Ga0114336_1012963	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	5973	Open in IMG/M
3300008261\|Ga0114336_1132575	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2269	Open in IMG/M
3300008962\|Ga0104242_1003266	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3089	Open in IMG/M
3300008962\|Ga0104242_1056264	Not Available	660	Open in IMG/M
3300009059\|Ga0102830_1074658	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1013	Open in IMG/M
3300009183\|Ga0114974_10034518	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3472	Open in IMG/M
3300009239\|Ga0103858_10020226	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1466	Open in IMG/M
3300010354\|Ga0129333_10008450	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	9717	Open in IMG/M
3300010354\|Ga0129333_10038188	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	4533	Open in IMG/M
3300010354\|Ga0129333_10067774	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	3318	Open in IMG/M
3300010354\|Ga0129333_10159515	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2068	Open in IMG/M
3300010354\|Ga0129333_10492616	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1075	Open in IMG/M
3300010354\|Ga0129333_10602772	Not Available	953	Open in IMG/M
3300010354\|Ga0129333_10878195	Not Available	760	Open in IMG/M
3300010354\|Ga0129333_11021942	Not Available	694	Open in IMG/M
3300011011\|Ga0139556_1043294	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	665	Open in IMG/M
3300011995\|Ga0153800_1017554	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	724	Open in IMG/M
3300012666\|Ga0157498_1027760	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	878	Open in IMG/M
3300012730\|Ga0157602_1001593	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	828	Open in IMG/M
3300013004\|Ga0164293_10173657	All Organisms → cellular organisms → Bacteria	1580	Open in IMG/M
3300013004\|Ga0164293_10422614	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium G20	893	Open in IMG/M
3300013004\|Ga0164293_10726283	Not Available	635	Open in IMG/M
3300013005\|Ga0164292_10386986	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	936	Open in IMG/M
3300013087\|Ga0163212_1094202	Not Available	966	Open in IMG/M
(restricted) 3300013122\|Ga0172374_1342572	Not Available	527	Open in IMG/M
(restricted) 3300013132\|Ga0172372_10047646	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	4199	Open in IMG/M
(restricted) 3300014720\|Ga0172376_10039339	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3930	Open in IMG/M
3300017736\|Ga0181365_1118111	Not Available	636	Open in IMG/M
3300017761\|Ga0181356_1099917	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	946	Open in IMG/M
3300017780\|Ga0181346_1060250	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	1523	Open in IMG/M
3300017785\|Ga0181355_1361078	Not Available	532	Open in IMG/M
3300017788\|Ga0169931_10047404	All Organisms → cellular organisms → Bacteria	4694	Open in IMG/M
3300017788\|Ga0169931_10049406	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	4556	Open in IMG/M
3300017788\|Ga0169931_10157803	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	2022	Open in IMG/M
3300019784\|Ga0181359_1088860	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1148	Open in IMG/M
3300020048\|Ga0207193_1074295	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3293	Open in IMG/M
3300020048\|Ga0207193_1797385	Not Available	596	Open in IMG/M
3300020074\|Ga0194113_10141861	Not Available	2011	Open in IMG/M
3300020074\|Ga0194113_10727905	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	686	Open in IMG/M
3300020083\|Ga0194111_10385344	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp.	933	Open in IMG/M
3300020141\|Ga0211732_1334252	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	612	Open in IMG/M
3300020141\|Ga0211732_1595319	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2031	Open in IMG/M
3300020151\|Ga0211736_10945994	Not Available	872	Open in IMG/M
3300020159\|Ga0211734_10693217	Not Available	641	Open in IMG/M
3300020160\|Ga0211733_10945808	Not Available	1019	Open in IMG/M
3300020161\|Ga0211726_10321226	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	1924	Open in IMG/M
3300020161\|Ga0211726_10537079	Not Available	572	Open in IMG/M
3300020172\|Ga0211729_10664081	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	943	Open in IMG/M
3300020172\|Ga0211729_10941720	Not Available	503	Open in IMG/M
3300020200\|Ga0194121_10074579	Not Available	2378	Open in IMG/M
3300020205\|Ga0211731_10117134	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	3168	Open in IMG/M
3300020498\|Ga0208050_1000665	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	5231	Open in IMG/M
3300020514\|Ga0208202_1022787	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	723	Open in IMG/M
3300020528\|Ga0208224_1002186	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3506	Open in IMG/M
3300020548\|Ga0208856_1001369	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	7476	Open in IMG/M
3300020573\|Ga0208485_1006238	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	2884	Open in IMG/M
3300021141\|Ga0214163_1003484	Not Available	6122	Open in IMG/M
3300021961\|Ga0222714_10499921	Not Available	624	Open in IMG/M
3300021962\|Ga0222713_10009561	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	8820	Open in IMG/M
3300021962\|Ga0222713_10772018	Not Available	539	Open in IMG/M
3300021963\|Ga0222712_10000238	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	78281	Open in IMG/M
3300021963\|Ga0222712_10249194	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1137	Open in IMG/M
3300021963\|Ga0222712_10668172	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	590	Open in IMG/M
3300022179\|Ga0181353_1029756	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1447	Open in IMG/M
3300022407\|Ga0181351_1024819	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2544	Open in IMG/M
3300022752\|Ga0214917_10099556	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1697	Open in IMG/M
3300023184\|Ga0214919_10021611	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	7152	Open in IMG/M
3300024289\|Ga0255147_1008289	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2320	Open in IMG/M
3300024346\|Ga0244775_10135297	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2084	Open in IMG/M
3300024346\|Ga0244775_10748032	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	785	Open in IMG/M
3300024346\|Ga0244775_11332478	Not Available	554	Open in IMG/M
3300024346\|Ga0244775_11345871	Not Available	551	Open in IMG/M
3300024351\|Ga0255141_1026883	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	871	Open in IMG/M
3300024351\|Ga0255141_1068671	Not Available	514	Open in IMG/M
3300024354\|Ga0255171_1056847	Not Available	728	Open in IMG/M
3300024356\|Ga0255169_1056759	Not Available	664	Open in IMG/M
3300024500\|Ga0255143_1023849	Not Available	1024	Open in IMG/M
3300024531\|Ga0255228_1010461	Not Available	1685	Open in IMG/M
3300024559\|Ga0255284_1045480	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	952	Open in IMG/M
3300024849\|Ga0255230_1078983	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	597	Open in IMG/M
3300025585\|Ga0208546_1016570	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1886	Open in IMG/M
3300025732\|Ga0208784_1222223	Not Available	547	Open in IMG/M
3300025848\|Ga0208005_1191339	Not Available	635	Open in IMG/M
3300025872\|Ga0208783_10248512	Not Available	721	Open in IMG/M
3300027114\|Ga0208009_1003533	Not Available	4272	Open in IMG/M
3300027114\|Ga0208009_1032295	Not Available	1082	Open in IMG/M
3300027121\|Ga0255074_1002377	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2768	Open in IMG/M
3300027121\|Ga0255074_1005315	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1791	Open in IMG/M
3300027121\|Ga0255074_1012773	Not Available	1105	Open in IMG/M
3300027147\|Ga0255113_1079192	Not Available	595	Open in IMG/M
3300027518\|Ga0208787_1132738	Not Available	570	Open in IMG/M
3300027608\|Ga0208974_1039350	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1394	Open in IMG/M
3300027608\|Ga0208974_1121193	Not Available	683	Open in IMG/M
3300027710\|Ga0209599_10004305	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	5214	Open in IMG/M
3300027710\|Ga0209599_10182568	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	564	Open in IMG/M
(restricted) 3300027730\|Ga0247833_1076944	Not Available	1594	Open in IMG/M
3300027754\|Ga0209596_1027621	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	3265	Open in IMG/M
3300027769\|Ga0209770_10108381	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1139	Open in IMG/M
3300027769\|Ga0209770_10211155	Not Available	763	Open in IMG/M
3300027782\|Ga0209500_10008103	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	6614	Open in IMG/M
3300027793\|Ga0209972_10009317	All Organisms → Viruses	6702	Open in IMG/M
3300027793\|Ga0209972_10046752	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2382	Open in IMG/M
3300027804\|Ga0209358_10082246	Not Available	1823	Open in IMG/M
3300027805\|Ga0209229_10000004	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	91329	Open in IMG/M
3300027805\|Ga0209229_10451121	Not Available	553	Open in IMG/M
3300027892\|Ga0209550_10084325	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2429	Open in IMG/M
3300028025\|Ga0247723_1022197	Not Available	2118	Open in IMG/M
3300028025\|Ga0247723_1034523	Not Available	1560	Open in IMG/M
3300028025\|Ga0247723_1039510	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1415	Open in IMG/M
3300028025\|Ga0247723_1046295	Not Available	1266	Open in IMG/M
(restricted) 3300028557\|Ga0247832_1136962	Not Available	965	Open in IMG/M
3300029930\|Ga0119944_1048467	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	512	Open in IMG/M
3300031758\|Ga0315907_10152312	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1958	Open in IMG/M
3300031758\|Ga0315907_11284914	Not Available	506	Open in IMG/M
3300031787\|Ga0315900_10263164	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1462	Open in IMG/M
3300031951\|Ga0315904_10383274	Not Available	1280	Open in IMG/M
3300031951\|Ga0315904_10571929	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	979	Open in IMG/M
3300031951\|Ga0315904_10721336	Not Available	834	Open in IMG/M
3300032093\|Ga0315902_11107249	Not Available	581	Open in IMG/M
3300032116\|Ga0315903_10330976	Not Available	1271	Open in IMG/M
3300032116\|Ga0315903_10563723	Not Available	883	Open in IMG/M
3300033557\|Ga0316617_102474907	Not Available	538	Open in IMG/M
3300033816\|Ga0334980_0299888	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	624	Open in IMG/M
3300033978\|Ga0334977_0200332	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1005	Open in IMG/M
3300033981\|Ga0334982_0188551	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1026	Open in IMG/M
3300034018\|Ga0334985_0158664	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1536	Open in IMG/M
3300034019\|Ga0334998_0079105	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2226	Open in IMG/M
3300034020\|Ga0335002_0625967	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	553	Open in IMG/M
3300034063\|Ga0335000_0081113	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	2250	Open in IMG/M
3300034066\|Ga0335019_0000065	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	60076	Open in IMG/M
3300034073\|Ga0310130_0019280	Not Available	2196	Open in IMG/M
3300034073\|Ga0310130_0097676	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	882	Open in IMG/M
3300034073\|Ga0310130_0265112	Not Available	543	Open in IMG/M
3300034102\|Ga0335029_0366150	Not Available	883	Open in IMG/M
3300034111\|Ga0335063_0006743	Not Available	7345	Open in IMG/M
3300034200\|Ga0335065_0034659	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	3549	Open in IMG/M
3300034280\|Ga0334997_0907781	Not Available	524	Open in IMG/M
3300034283\|Ga0335007_0217798	Not Available	1311	Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	99.55%
Host-Associated	Host-Associated	0.45%

Habitat	Taxonomy	Distribution
Aquatic	Environmental → Aquatic	91.82%
Terrestrial	Environmental → Terrestrial	7.73%
Plants	Host-Associated → Plants	0.45%

Habitat	Taxonomy	Distribution
Freshwater	Environmental → Aquatic → Freshwater	78.64%
Marine	Environmental → Aquatic → Marine	13.18%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface	6.82%
Soil	Environmental → Terrestrial → Soil	0.91%
Leaf	Host-Associated → Plants → Leaf	0.45%

Habitat	Taxonomy	Distribution
Lake	Environmental → Aquatic → Freshwater → Lake	35.91%
Lentic	Environmental → Aquatic → Freshwater → Lentic	30.45%
Coastal	Environmental → Aquatic → Marine → Coastal	7.27%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified	6.82%
River	Environmental → Aquatic → Freshwater → River	5.91%
Unclassified	Environmental → Aquatic → Marine → Unclassified	5.00%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified	4.55%
Lotic	Environmental → Aquatic → Freshwater → Lotic	1.36%
Intertidal Zone	Environmental → Aquatic → Marine → Intertidal Zone	0.91%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	0.91%
Drinking Water	Environmental → Aquatic → Freshwater → Drinking Water	0.45%
Unclassified	Host-Associated → Plants → Leaf → Unclassified	0.45%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	35.00%
Unclassified	Environmental → Aquatic → Freshwater → Lentic → Unclassified	27.27%
Unclassified	Environmental → Aquatic → Marine → Coastal → Unclassified	7.27%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified	6.82%
Unclassified	Environmental → Aquatic → Freshwater → River → Unclassified	5.91%
Unclassified	Environmental → Aquatic → Marine → Unclassified → Unclassified	5.00%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified → Unclassified	4.55%
Epilimnion	Environmental → Aquatic → Freshwater → Lentic → Epilimnion	2.73%
Unclassified	Environmental → Aquatic → Freshwater → Lotic → Unclassified	1.36%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	0.91%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	0.91%
Hypolimnion	Environmental → Aquatic → Freshwater → Lentic → Hypolimnion	0.45%
Unclassified	Environmental → Aquatic → Freshwater → Drinking Water → Unclassified	0.45%
Unclassified	Environmental → Aquatic → Marine → Intertidal Zone → Unclassified	0.45%
Estuary	Environmental → Aquatic → Marine → Intertidal Zone → Estuary	0.45%
Unclassified	Host-Associated → Plants → Leaf → Unclassified → Unclassified	0.45%

Habitat	Taxonomy	Distribution
Freshwater Lake	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake	20.00%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	13.18%
Freshwater, Plankton	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton	9.55%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	6.36%
Freshwater	Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater	5.91%
Freshwater Lentic	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic	4.09%
Freshwater	Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater	4.09%
Freshwater To Marine Saline Gradient	Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient	3.64%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface	3.64%
Aqueous	Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous	3.18%
Estuarine Water	Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water	2.73%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater	2.27%
Estuarine	Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine	2.27%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater	1.82%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	1.82%
Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake	1.82%
Deep Subsurface Sediment	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment	1.82%
Freshwater And Sediment	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment	1.36%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	1.36%
Fracking Water	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water	1.36%
Freshwater Lake Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment	0.91%
Marine Plankton	Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton	0.91%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	0.91%
Freshwater And Sediment	Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment	0.45%
Freshwater And Sediment	Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment	0.45%
Lake Water	Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake Water	0.45%
Freshwater, Surface Ice	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Surface Ice	0.45%
Freshwater And Marine	Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater And Marine	0.45%
Aquatic	Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic	0.45%
River Water	Environmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water	0.45%
Estuary Water	Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water	0.45%
Marine	Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine	0.45%
Estuarine	Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine	0.45%
Estuary	Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary	0.45%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000736	Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011	Environmental	Open in IMG/M
3300000756	Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011	Environmental	Open in IMG/M
3300000882	Freshwater microbial communities from the Columbia River	Environmental	Open in IMG/M
3300001839	Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM40, ROCA_DNA238_2.0um_Ob_C_3b	Environmental	Open in IMG/M
3300001851	Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM31, ROCA_DNA206_0.2um_MCP-S_C_3b	Environmental	Open in IMG/M
3300001968	Marine microbial communities from Lake Gatun, Panama - GS020	Environmental	Open in IMG/M
3300002161	Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA	Environmental	Open in IMG/M
3300002408	Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123)	Environmental	Open in IMG/M
3300002835	Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)	Environmental	Open in IMG/M
3300004096	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 2)	Environmental	Open in IMG/M
3300004112	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2)	Environmental	Open in IMG/M
3300005069	Metagenomes from Harmful Algal Blooms in Lake Erie, HABS-E2014-0024	Environmental	Open in IMG/M
3300005525	Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG	Environmental	Open in IMG/M
3300005527	Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG	Environmental	Open in IMG/M
3300005528	Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG	Environmental	Open in IMG/M
3300005581	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF	Environmental	Open in IMG/M
3300005582	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF	Environmental	Open in IMG/M
3300005584	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF	Environmental	Open in IMG/M
3300005585	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF	Environmental	Open in IMG/M
3300005662	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)	Environmental	Open in IMG/M
3300005758	Cyanobacteria communities in tropical freswater systems - freshwater lake in Singapore	Environmental	Open in IMG/M
3300005805	Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA	Environmental	Open in IMG/M
3300006030	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA	Environmental	Open in IMG/M
3300006484	Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535	Environmental	Open in IMG/M
3300006639	Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11	Environmental	Open in IMG/M
3300006641	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA	Environmental	Open in IMG/M
3300006862	Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series LW 2014_7_11	Environmental	Open in IMG/M
3300007165	Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16	Environmental	Open in IMG/M
3300007304	Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaT (Metagenome Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300007363	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA	Environmental	Open in IMG/M
3300007974	Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um	Environmental	Open in IMG/M
3300008055	Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393	Host-Associated	Open in IMG/M
3300008107	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA	Environmental	Open in IMG/M
3300008108	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA	Environmental	Open in IMG/M
3300008110	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA	Environmental	Open in IMG/M
3300008114	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA	Environmental	Open in IMG/M
3300008116	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA	Environmental	Open in IMG/M
3300008258	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample HABS-E2014-0110-3-NA	Environmental	Open in IMG/M
3300008259	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA	Environmental	Open in IMG/M
3300008261	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA	Environmental	Open in IMG/M
3300008962	Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT5	Environmental	Open in IMG/M
3300009059	Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703	Environmental	Open in IMG/M
3300009183	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG	Environmental	Open in IMG/M
3300009239	Microbial communities of water from Amazon river, Brazil - RCM11	Environmental	Open in IMG/M
3300010354	Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA	Environmental	Open in IMG/M
3300011011	Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Top - Depth 1m	Environmental	Open in IMG/M
3300011995	Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 880 - Top - Depth 1m	Environmental	Open in IMG/M
3300012666	Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Surface Ice version 2	Environmental	Open in IMG/M
3300012730	Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES126 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300013004	Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG	Environmental	Open in IMG/M
3300013005	Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG	Environmental	Open in IMG/M
3300013087	Freshwater microbial communities from Lake Malawi, Central Region, Malawi to study Microbial Dark Matter (Phase II) - Malawi_45m_30L	Environmental	Open in IMG/M
3300013122 (restricted)	Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10.3m	Environmental	Open in IMG/M
3300013132 (restricted)	Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5m	Environmental	Open in IMG/M
3300014720 (restricted)	Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35m	Environmental	Open in IMG/M
3300017736	Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N	Environmental	Open in IMG/M
3300017761	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N	Environmental	Open in IMG/M
3300017780	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N	Environmental	Open in IMG/M
3300017785	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N	Environmental	Open in IMG/M
3300017788	Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L	Environmental	Open in IMG/M
3300019784	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D	Environmental	Open in IMG/M
3300020048	Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915	Environmental	Open in IMG/M
3300020074	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200m	Environmental	Open in IMG/M
3300020083	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015033 Kigoma Deep Cast 300m	Environmental	Open in IMG/M
3300020141	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1	Environmental	Open in IMG/M
3300020151	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1	Environmental	Open in IMG/M
3300020159	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1	Environmental	Open in IMG/M
3300020160	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1	Environmental	Open in IMG/M
3300020161	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1	Environmental	Open in IMG/M
3300020172	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1	Environmental	Open in IMG/M
3300020200	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015020 Mahale Deep Cast 50m	Environmental	Open in IMG/M
3300020205	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1	Environmental	Open in IMG/M
3300020498	Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300020514	Freshwater microbial communities from Lake Mendota, WI - 27AUG2008 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300020528	Freshwater microbial communities from Lake Mendota, WI - 26OCT2009 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300020548	Freshwater microbial communities from Lake Mendota, WI - 13JUL2012 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300020573	Freshwater microbial communities from Lake Mendota, WI - 17JUL2012 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300021141	Freshwater microbial communities from Lake Mendota, WI - Practice 15JUN2010 epilimnion	Environmental	Open in IMG/M
3300021961	Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D	Environmental	Open in IMG/M
3300021962	Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D	Environmental	Open in IMG/M
3300021963	Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D	Environmental	Open in IMG/M
3300022179	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N	Environmental	Open in IMG/M
3300022407	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D	Environmental	Open in IMG/M
3300022752	Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB	Environmental	Open in IMG/M
3300023184	Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503	Environmental	Open in IMG/M
3300024289	Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8h	Environmental	Open in IMG/M
3300024346	Whole water sample coassembly	Environmental	Open in IMG/M
3300024351	Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_0h	Environmental	Open in IMG/M
3300024354	Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepB_8d	Environmental	Open in IMG/M
3300024356	Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepC_8d	Environmental	Open in IMG/M
3300024500	Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_0h	Environmental	Open in IMG/M
3300024531	Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepA_8h (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300024559	Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepB_8d (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300024849	Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepA_8h (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300025585	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA (SPAdes)	Environmental	Open in IMG/M
3300025732	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes)	Environmental	Open in IMG/M
3300025848	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA (SPAdes)	Environmental	Open in IMG/M
3300025872	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA (SPAdes)	Environmental	Open in IMG/M
3300027114	Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16 (SPAdes)	Environmental	Open in IMG/M
3300027121	Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepC_8h	Environmental	Open in IMG/M
3300027147	Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Yuk_RepC_8h	Environmental	Open in IMG/M
3300027518	Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series HT 2014_7_11 (SPAdes)	Environmental	Open in IMG/M
3300027608	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes)	Environmental	Open in IMG/M
3300027710	Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes)	Environmental	Open in IMG/M
3300027730 (restricted)	Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_8m	Environmental	Open in IMG/M
3300027754	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027769	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes)	Environmental	Open in IMG/M
3300027782	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027793	Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes)	Environmental	Open in IMG/M
3300027804	Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (SPAdes)	Environmental	Open in IMG/M
3300027805	Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes)	Environmental	Open in IMG/M
3300027892	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes)	Environmental	Open in IMG/M
3300028025	Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC	Environmental	Open in IMG/M
3300028557 (restricted)	Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_4m	Environmental	Open in IMG/M
3300029930	Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727	Environmental	Open in IMG/M
3300031758	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123	Environmental	Open in IMG/M
3300031787	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114	Environmental	Open in IMG/M
3300031951	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120	Environmental	Open in IMG/M
3300032093	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117	Environmental	Open in IMG/M
3300032116	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119	Environmental	Open in IMG/M
3300033521	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B	Environmental	Open in IMG/M
3300033557	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_B	Environmental	Open in IMG/M
3300033816	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005	Environmental	Open in IMG/M
3300033978	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME28Sep2014-rr0002	Environmental	Open in IMG/M
3300033981	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011	Environmental	Open in IMG/M
3300034018	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME04Jul2014-rr0021	Environmental	Open in IMG/M
3300034019	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049	Environmental	Open in IMG/M
3300034020	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2015-rr0055	Environmental	Open in IMG/M
3300034063	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Oct2008D10-rr0053	Environmental	Open in IMG/M
3300034066	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087	Environmental	Open in IMG/M
3300034073	Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL	Environmental	Open in IMG/M
3300034102	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112	Environmental	Open in IMG/M
3300034111	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Oct2011-rr0186	Environmental	Open in IMG/M
3300034200	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190	Environmental	Open in IMG/M
3300034280	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME10Aug2009-rr0048	Environmental	Open in IMG/M
3300034283	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID	Sample Taxon ID	Habitat	Sequence
JGI12547J11936_10027328	3300000736	Freshwater And Sediment	MKDSKEPSIQINTDGGQIIETDQMGREKFWEDLGRPNDGK*
JGI12421J11937_100395473	3300000756	Freshwater And Sediment	MQNLKSASIETDGGQIKETDAMGREKFWEDLGRPDDGK*
FwDRAFT_100360868	3300000882	Freshwater And Marine	MENLKSTSIETDGGQIVETDQMGREKFWEDLGRPNDRG*
RCM40_11091293	3300001839	Marine Plankton	MTELKKQLQQTPEIQTDGGQIKEIDQMGREKFWED
RCM31_101886581	3300001851	Marine Plankton	MIESKNPSDQIPEIQTDGGQIKETDQMGREKFWEDIGRPND*
GOS2236_10512257	3300001968	Marine	MIESKEPSEKIQTDGGQIKETDAMGQEKFWLDIGRPND*
JGI24766J26685_1000017214	3300002161	Freshwater And Sediment	MENSKDRLNHIETDGGTIKETDAMGREKFWEDLGRPND*
B570J29032_1089094192	3300002408	Freshwater	MTKLENPFKELQNESGAIKDTDAMGREKFWEDLGRPSDDG
B570J40625_1016337551	3300002835	Freshwater	MKDSKEPSIQINTDGGQIIETDQMGREKFWEDLGRPNDRG*
Ga0066177_101995571	3300004096	Freshwater Lake	MKDLNEPSIQINTDGGQIKETDQMGREKFWEDLGRPSDRG*
Ga0065166_100966785	3300004112	Freshwater Lake	DWNTMENLNQPSILTDGGTIKETDAMGREKFWEDLGRPDDDGK*
Ga0065166_102154191	3300004112	Freshwater Lake	METSKSPLIHTETDGGRIVETDAMGREKFWEDLGRPDGK*
Ga0065166_102375991	3300004112	Freshwater Lake	MEKSKEPSIQINTDGGQIKETDQMGREKFWEDLGRPDDGK*
Ga0071350_10927334	3300005069	Freshwater	MENLKNPLTEIQTDGGTIKETDAMGREKFWEDLGRPDDRK*
Ga0068877_104033802	3300005525	Freshwater Lake	MNNSENKLKDLTDPIKTDGGEIKETDAMGREKFWEDLGRPND*
Ga0068876_1004495210	3300005527	Freshwater Lake	MENLNQPSIQTDGGTIKETDSMGREIFWEDIGRPDDGK*
Ga0068876_100956035	3300005527	Freshwater Lake	MKESKEPSEKIQTDGGEIKETDAMGREKFWEDLGRPND*
Ga0068876_101066028	3300005527	Freshwater Lake	MTQLENPFKDIQTEGGTIKETDAMGREKFWEDLGRPDDGK*
Ga0068876_101577922	3300005527	Freshwater Lake	MENLNQPSIPTDGGTIKETDAMGREKFWEDLGRPDDDGK*
Ga0068876_101686124	3300005527	Freshwater Lake	MTELKKPSDDIQTDGGEIKETDQMGREKFWEDLGRPND*
Ga0068876_101905674	3300005527	Freshwater Lake	MEKSKEPSIQINTDGGQIKETDQMGREKFWEDLGRPDDRK*
Ga0068876_102333513	3300005527	Freshwater Lake	MEKSKEQLNQIQTDGGYIKETDQMGREKFWEDLGRPDDGK*
Ga0068876_102693344	3300005527	Freshwater Lake	MENLNQPSILTDGGTIKETDAMGREKFWEDLGRPDDDGK*
Ga0068876_102791635	3300005527	Freshwater Lake	MTQLENPFKDIQTEGGAIKETDAMGREKFWEDLGRPDDGK*
Ga0068876_103211422	3300005527	Freshwater Lake	MENLNQPSILTDGGAIKETDAMGREKFWEDLGRPDDSGE*
Ga0068876_103885762	3300005527	Freshwater Lake	MENLNQPSIQTDGGHIKETDAMGREKFWEDLGRPDDGK*
Ga0068876_106591032	3300005527	Freshwater Lake	MLDWNTMENLNQPSILTDGGTIKETDAMGREKFWEDLGRPNDGK*
Ga0068876_106761933	3300005527	Freshwater Lake	MLDWNIMENLNQPSILTDGGNIKETDAMGREKFWEDLGRPSDDGK*
Ga0068876_107298061	3300005527	Freshwater Lake	WGWKFMTELKKPSDDIQTDGGQIKETDQMGREKFWEDLGRPND*
Ga0068872_105515332	3300005528	Freshwater Lake	MENLNQPSILTDGGNIKETDAMGREKFWEDLGRPDDGK*
Ga0049081_100204623	3300005581	Freshwater Lentic	MTKLENPFKELQNESGAIKDTDAMGREKFWEDLGRPNDGK*
Ga0049081_101186645	3300005581	Freshwater Lentic	ENLNQPSILTDGGNIKETDAMGREKFWEDLGRPDDGK*
Ga0049080_100286282	3300005582	Freshwater Lentic	MENLNQPSILTDGGNIKETDAMGREKFWEDLGRPNDGK*
Ga0049080_100416945	3300005582	Freshwater Lentic	MQNLKSASIETDGGQIKETDSMGREKFWEDLGRPNDGE*
Ga0049080_100450081	3300005582	Freshwater Lentic	MTQLENPFKNIQTESGTIKETDAMGREKFWEDLGRPSDDGK*
Ga0049082_101102392	3300005584	Freshwater Lentic	MENLKSVLIETDGGQIKEIDSMGREKFWEDLGRPNDGE*
Ga0049084_100243045	3300005585	Freshwater Lentic	MTKLENPFKELQNESGAIKDTDAMGREKFWEDLGRPDDGK*
Ga0078894_100763283	3300005662	Freshwater Lake	MEKSKEPSIQINTDGGTIKETDQMGREKFWEDLGRPDDGK*
Ga0078894_104579514	3300005662	Freshwater Lake	MENSKNPWTEIQTNGGTIKETDAMGREKFWEDLGRPDDGK*
Ga0078894_104812534	3300005662	Freshwater Lake	MENLNQPLIQTDGGQIKETDQMGREKFWEDMGRPDDRK*
Ga0078894_105790861	3300005662	Freshwater Lake	MTQLENPFKDFQNESGAIKDTDAMGREKFWEDLGRPSDDGK*
Ga0078894_107745803	3300005662	Freshwater Lake	MDNSKNPWTEIQTNGGTIKETDAMGREKFWEDLGRPDDGK*
Ga0078894_108817462	3300005662	Freshwater Lake	MENLNQPSIQTDGGTIKETDAMGREKFWEDLGRPDDGK*
Ga0078894_108927584	3300005662	Freshwater Lake	LVWSYMEKSKEPSIQINTDGGQIKETDQMGREKFWEDLGRPDDGK*
Ga0078894_110864333	3300005662	Freshwater Lake	MENLKNPLTEIQTDGGNIKETDAMGREKFWEDLGRPDDRK*
Ga0078894_115266211	3300005662	Freshwater Lake	MQTSKEPLNQIQTDGGQIKETDQMGREKFWEDLGRPDDGK*
Ga0078894_116914473	3300005662	Freshwater Lake	MENLNQPSIQTDGGQIKETDQMGREKFWEDMGRPDDRK*
Ga0078117_10009522	3300005758	Lake Water	MTTSNDKSKDTPNKIETDGGVIKETDAMGREIFWQDMGRPND*
Ga0079957_10223737	3300005805	Lake	MKELKEPSEKIQTDGGQIKETDAMGREKFWEDLGRPND*
Ga0079957_10470333	3300005805	Lake	MTELKKPSDDIQTDGGQIKETDQMGREKFWEDLGRP*
Ga0079957_10642817	3300005805	Lake	MTQLENPFKDIQTESGTIKETDAMGREKFWEDLGRPDDGK*
Ga0079957_11258564	3300005805	Lake	MTQLESPFKEIQTESGAIKDTDAMGREKFWEDLGRPNDGK*
Ga0075470_1000028155	3300006030	Aqueous	MNEWKKPSEISEIQTDGGQIKETDAMGREKFWEDLGRPND*
Ga0070744_100107193	3300006484	Estuarine	MDNSKDQLTHTQTDGGTIIETDAMGREKFWEDLGRPDDRK*
Ga0079301_10047163	3300006639	Deep Subsurface	METSKEPSIQINTDGGQIKETDQMGREKFWEDLGRPSDRG*
Ga0075471_100168893	3300006641	Aqueous	MEKSKEPSTQINTDGGKIKETDQMGREKFWEDLGRPDDGK*
Ga0079299_10046859	3300006862	Deep Subsurface	MENLNQPSILTDGGTIKETDAMGREKFWEDLGRPNDGK*
Ga0079302_100551010	3300007165	Deep Subsurface	MENLNQPSILTDGGTIKETDAMGREKFWEDLGRPDDSGE*
Ga0102689_10445321	3300007304	Freshwater Lake	MDNSKNLWTEIQTNGGIIKETDAMGREKFWEDLGRPD
Ga0075458_102261432	3300007363	Aqueous	MTELKKPSEPTFEEIQTDGGQIKETDQMGREKFWEDLGRPNE*
Ga0105747_10061972	3300007974	Estuary Water	MTQLESPFKEIQTEGGTIKETDAMGREKFWEDLGRPDDGK*
Ga0108970_100184602	3300008055	Estuary	MDNSKDLLIQIQTDGGTIKETDQMGREKFWEDLGRPDDRK*
Ga0114340_10533522	3300008107	Freshwater, Plankton	MENSRSPLIHTQTDGGTIIETDAMGREKFWEDLGRPNDGK*
Ga0114340_10794497	3300008107	Freshwater, Plankton	MLDWNTMENLNQPSILTDGGTIKETDAMGREKFWEDLGRPDDGK*
Ga0114340_11270311	3300008107	Freshwater, Plankton	MLDWNIMENLNQPSILTDGGTIKETDAMGREKFWEDLGRPDDGK*
Ga0114340_11327702	3300008107	Freshwater, Plankton	MENLNQPSIQTDGGQIKETDQMGREKFWEDMGRPDDGK*
Ga0114340_11649381	3300008107	Freshwater, Plankton	MEKSKEPLIQINTDGGQIKETDQMGREKFWEDLGRPDDRK*
Ga0114340_11755625	3300008107	Freshwater, Plankton	MTQLENPFKDIQTEGGAIKETDAMGREKFWEDLGRPSDDGK*
Ga0114340_11872712	3300008107	Freshwater, Plankton	MDNSKNLWTEIQTNGGTIKETDAMGREKFWEDLGRPSDDEK*
Ga0114340_11987811	3300008107	Freshwater, Plankton	MENLKDRLTHTETDGGKIVETDAMGREKFWEDLGRPDDRK*
Ga0114340_12150451	3300008107	Freshwater, Plankton	MTKLENPFKDIQTESGTIKETDAMGREKFWEDLGRPSDDGK*
Ga0114341_102093603	3300008108	Freshwater, Plankton	MDNSKNLWTEIQTNGGTIKETDAMGREKFWEDLGRPSDDGK*
Ga0114343_11692433	3300008110	Freshwater, Plankton	MDNSKNPWTEIQTNGGTIKETDAMGREKFWEDLGRPDEGK*
Ga0114343_11777591	3300008110	Freshwater, Plankton	MEKSKEPSIQINTDGGQIKETDQMGREKFWEDLGRPYDRK*
Ga0114343_11813061	3300008110	Freshwater, Plankton	MENLNQPSIPTDGGEIKETDAMGREKFWEDLGRPDDDGK*
Ga0114343_12184001	3300008110	Freshwater, Plankton	MEASKEPLNQIQTDGGYIKETDQMGREKFWEDLGRPDDGK*
Ga0114347_10537763	3300008114	Freshwater, Plankton	MLDWNIMENLNQPSILTDGGNIKETDAMGREKFWEDLGRPDDGK*
Ga0114350_11069682	3300008116	Freshwater, Plankton	MKELKKPSEQIETDGGTIKETDAMGREKFWEDLGRPND*
Ga0114350_11391521	3300008116	Freshwater, Plankton	KEPSIQINTDGGQIKETDQMGREKFWEDLGRPDDRK*
Ga0114840_10323253	3300008258	Freshwater, Plankton	MDNSKNLWTEIQTNGGTIKETDAMGREKFWEDLGRPDDGK*
Ga0114841_11468413	3300008259	Freshwater, Plankton	MEKSKEPLNQIQTDGGTIKETDQMGREKFWEDLGRPDDGK*
Ga0114336_10129634	3300008261	Freshwater, Plankton	MENLKSTSIETDGGQIVETDQMGREKFWEDLGRPND*
Ga0114336_11325752	3300008261	Freshwater, Plankton	METSKEPSIQINTDGGQIIETDQMGREKFWEDLGRPND*
Ga0104242_10032665	3300008962	Freshwater	MENLNQPSILTDGEAIKETDAMGREKFWEDLGRPDDSGK*
Ga0104242_10562641	3300008962	Freshwater	MEKSNEPSIQINTDGGVIKETDQMGREKFWEDLGRPDDGK*
Ga0102830_10746583	3300009059	Estuarine	MDNSKDLLIHIQTDGGTIKETDQMGREKFWEDLGRPDDRK*
Ga0114974_1003451812	3300009183	Freshwater Lake	MENLSQPSIQKDSDSLKETDAMGREKFWEDLGRPDDGE*
Ga0103858_100202262	3300009239	River Water	MIESKNPSEQIPDIQTDGGQIKDTDQMGREKFWEDIGRPND*
Ga0129333_1000845017	3300010354	Freshwater To Marine Saline Gradient	MNESKEPLIQTDGGQIKETDAMGREKFWEDLGRPDDR*
Ga0129333_100381882	3300010354	Freshwater To Marine Saline Gradient	MTESKEPLKQIQTDGGIIIETDQMGREKFWEDLGRPND*
Ga0129333_100677745	3300010354	Freshwater To Marine Saline Gradient	MNELKKPSDNIQTDGGTIKETDSMGREKFWEDLGRPDDSGK*
Ga0129333_101595152	3300010354	Freshwater To Marine Saline Gradient	MTELKKPSDNIQTDGGQIKETDQMGREKFWEDLGRP*
Ga0129333_104926162	3300010354	Freshwater To Marine Saline Gradient	MDNSKDPLIQIQTDGGTIKETDQMGREKFWEDLGRPDDRK*
Ga0129333_106027725	3300010354	Freshwater To Marine Saline Gradient	MTNLKKPLEQIQTDGGQIKETDQMGREKFWEDIGRP*
Ga0129333_108781953	3300010354	Freshwater To Marine Saline Gradient	GWRYMEKSKEQLNQIQTDGGYIKETDQMGREKFWEDLGRPDDGK*
Ga0129333_110219422	3300010354	Freshwater To Marine Saline Gradient	MTQLENPLKDIQTESGTIKETDAMGREKFWEDLGRPDDGK*
Ga0139556_10432942	3300011011	Freshwater	MLDWNTMENLNQPSILTDGGNIKETDAMGREKFWEDLGR
Ga0153800_10175542	3300011995	Freshwater	MLDWNIMENLNQPSILTDGGNIKETDAMGREKFWEDLGRPNDGK*
Ga0157498_10277601	3300012666	Freshwater, Surface Ice	MTKLENPFKELQNESGTIKETDAMGREKFWEDLGRPDDGK*
Ga0157602_10015931	3300012730	Freshwater	MLDWSIMENLNQPSILTDGGTIKETDAMGREKFWGDLGRPNDGK*
Ga0164293_101736573	3300013004	Freshwater	MLDWNIMENLNQPSILTDGGNIKETDAMGREKFWEDLG
Ga0164293_104226141	3300013004	Freshwater	KKMLDWNIMENLNQPSILTDGGNIKETDAMGREKFWEDLGRPNDGK*
Ga0164293_107262832	3300013004	Freshwater	MTQLENPFKDFQNESGAIKDTDAMGREKFWEDLGRPNDGK*
Ga0164292_103869862	3300013005	Freshwater	MESLKNPLTEIQTDGGTIKETDAMGREKFWEDLGRPDDRK*
Ga0163212_10942021	3300013087	Freshwater	MTNLEWPSTEIQTDGGQVKETDAMGREKFWEDIGRPENGK*
(restricted) Ga0172374_13425722	3300013122	Freshwater	MTQLENPFKDIQTEGEAIKETDAMGREKFWEDLGRPSDDGK*
(restricted) Ga0172372_100476464	3300013132	Freshwater	MSESKKPSEQIEMDGGQIKETDSMGREKFWEDLGRPNGDGK*
(restricted) Ga0172376_100393392	3300014720	Freshwater	MSESKEPLIQTDGGKIKETDAMGREKFWEDLGRPEDGK*
Ga0181365_11181111	3300017736	Freshwater Lake	KLLGRNIMENLKNVSIETDGGQIKETDAMGREKFWEDLGRPDDGKXKTTKFRR
Ga0181356_10999172	3300017761	Freshwater Lake	MENLKSVSIETDGGQIKETDAMGREKFWEDLGRPDDGK
Ga0181346_10602502	3300017780	Freshwater Lake	MQNLKSASINTDGGQIIETDSMGREKFWEDLGRPNDGK
Ga0181355_13610781	3300017785	Freshwater Lake	NLKSASINTDGGQIIETDSMGREKFWEDLGRPNDGK
Ga0169931_100474045	3300017788	Freshwater	MSESKEPLIQTDGGKIKETDAMGREKFWEDLGRPEDGK
Ga0169931_100494064	3300017788	Freshwater	MSESKKPSEQIEMDGGQIKETDSMGREKFWEDLGRPNGDGK
Ga0169931_101578033	3300017788	Freshwater	MTQSENPFKDIQTEGGAIKETDAMGREKFWEDIGRPSDDGK
Ga0181359_10888604	3300019784	Freshwater Lake	MQNLKSASIETDGGQIVETDSMGREKFWEDLGRPDDGK
Ga0207193_10742954	3300020048	Freshwater Lake Sediment	MENLNSPLIHTQTDGGTIIETDAMGREKFWEDLGRPNDGE
Ga0207193_17973852	3300020048	Freshwater Lake Sediment	MDNSKTPLIHTQTDGGTIIETDAMGREKFWEDLGRPDDGK
Ga0194113_101418613	3300020074	Freshwater Lake	MTNLEWPSTEIQTDGGQVKETDAMGREKFWEDIGRPENGK
Ga0194113_107279052	3300020074	Freshwater Lake	MSESKEPLIQTDGGTIKETDAMGREKFWEDLGRPEDGK
Ga0194111_103853443	3300020083	Freshwater Lake	NLEWPSTEIQTDGGQVKETDAMGREKFWEDIGRPENGK
Ga0211732_13342521	3300020141	Freshwater	MTQLESPFKDIQTEGGTIKETDAMGREKFWEDLGRPSDDGK
Ga0211732_15953192	3300020141	Freshwater	MENLNQPSILTDGGNIKETDAMGREKFWEDLGRPSDDGK
Ga0211736_109459943	3300020151	Freshwater	MENLKNPLTEIQTDGGTIKETDAMGREKFWEDLGRPDDRK
Ga0211734_106932173	3300020159	Freshwater	MDNSKDRLIHTQTDGGTIIETDAMGREKFWEDLGRPNDGK
Ga0211733_109458082	3300020160	Freshwater	MTQLENPFKDIQTEGGTIKETDAMGREKFWEDLGRPSDDGK
Ga0211726_103212263	3300020161	Freshwater	MQNLKSASIETDGGQIKETDAMGREKFWEDLGRPDDGE
Ga0211726_105370793	3300020161	Freshwater	MLDWNTMENLNQPSILTDGGNIKETDAMGREKFWEDLGRPNDGK
Ga0211729_106640813	3300020172	Freshwater	MDNSKDRLIHTQTDGGTIIETDAMGREKFWEDLGRPDDRK
Ga0211729_109417202	3300020172	Freshwater	MENLNQPSILTDGGTIKETDAMGREKFWEDLGRPDDGK
Ga0194121_100745791	3300020200	Freshwater Lake	MTNLEWPSTEIQTDGDQVKETDAMGREKFWEDIGRPENGK
Ga0211731_101171343	3300020205	Freshwater	MQNLKSASIETDGGQIKETDAMGREKFWEDLGRPNDGE
Ga0208050_10006655	3300020498	Freshwater	MENLNQPSILTDGGNIKETDAMGREKFWEDLGRPDDGK
Ga0208202_10227872	3300020514	Freshwater	MTQLENPFKDFQNESGAIKDTDAMGREKFWEDLGRPNDGK
Ga0208224_10021861	3300020528	Freshwater	MENLNQPSILTDGGNIKETDAMGREKFWEDLGRPD
Ga0208856_10013697	3300020548	Freshwater	MLDWNTMENLNQPSILTDGGTIKETDAMGREKFWEDLGRPNDGK
Ga0208485_10062385	3300020573	Freshwater	MENLNQPSILTDGGTIKETDAMGREKFWEDLGRPNDGK
Ga0214163_10034849	3300021141	Freshwater	MDNLNQPLIQTDGGQIKETDQMGREKFWEDMGRPDDGK
Ga0222714_104999211	3300021961	Estuarine Water	MENLNQPSIPTDGGEIKETDSMGREKFWEDLGRPDDSGK
Ga0222713_1000956111	3300021962	Estuarine Water	MDNSKNTWTEIQTNGGTIKETDAMGREKFWEDLGRPDDGK
Ga0222713_107720182	3300021962	Estuarine Water	MTQLENPFKDIQTEGGAIKETDAMGREKFWEDLGRPDDGK
Ga0222712_1000023894	3300021963	Estuarine Water	MDNLKNPWTEIQTNGGTIKETDAMGREKFWEDLGRPDDGK
Ga0222712_102491944	3300021963	Estuarine Water	MENLSQPSIQKDSDSLKETDAMGREKFWEDLGRPDDGE
Ga0222712_106681723	3300021963	Estuarine Water	MSNSKETLTQIQTDGGTIKEIDAMGREKFWEDLGRPDGK
Ga0181353_10297564	3300022179	Freshwater Lake	MEKSKEPLNQIQTDGGTIKETDQMGREKFWEDLGRPDDGK
Ga0181351_10248192	3300022407	Freshwater Lake	MQNLKSASIETDGGQIKETDAMGREKFWEDLGRPDDGK
Ga0214917_100995567	3300022752	Freshwater	MTQLENPFKDIQTESGTIKETDAMGREKFWEDLGRPDDGK
Ga0214919_1002161115	3300023184	Freshwater	MQNLKSASIETDGGQIKETDSMGREKFWEDLGRPNDGE
Ga0255147_10082893	3300024289	Freshwater	MSELKKPSENNQINTDGGQIKETDAMGREKFWEDLGRPND
Ga0244775_101352973	3300024346	Estuarine	MDNSKDQLTHTQTDGGTIIETDAMGREKFWEDLGRPDDRK
Ga0244775_107480322	3300024346	Estuarine	MDNSKDLLIQIQTDGGTIKETDQMGREKFWEDLGRPDDRK
Ga0244775_113324781	3300024346	Estuarine	MESSKTPLIHTQTDGGTIIETDAMGREKFWEDLGRPNDGK
Ga0244775_113458712	3300024346	Estuarine	MEKSKEPSIQINTDGGQIKETDQMGREKFWEDLGRPDDGK
Ga0255141_10268833	3300024351	Freshwater	MRWVWKFMTELKKPLEQISEIQTDGGQIKETDQMGREKFWEDLGRPND
Ga0255141_10686711	3300024351	Freshwater	SELKKPSENNQINTDGGQIKETDAMGREKFWEDLGRPND
Ga0255171_10568471	3300024354	Freshwater	KFMKESKELSEKIQTDGGHIKETDAMGREKFWEDLGRPND
Ga0255169_10567591	3300024356	Freshwater	KFMKESKEPSEKIQTDGGHIKETDAMGREKFWEDLGRPND
Ga0255143_10238494	3300024500	Freshwater	KESKEPSEKIQTDGGHIKETDAMGREKFWEDLGRPND
Ga0255228_10104613	3300024531	Freshwater	MENLKSTSIETDGGQIVETDQMGREKFWEDLGRPNDRG
Ga0255284_10454801	3300024559	Freshwater	MKESKDQSEKIQTDGEQRKETDAMGREKFWEDLGRPND
Ga0255230_10789831	3300024849	Freshwater	MEKSKEPSIQISTDGGKIVETDQMGREKFWEDLGRPND
Ga0208546_10165709	3300025585	Aqueous	MNEWKKPSEISEIQTDGGQIKETDAMGREKFWEDLGRPND
Ga0208784_12222232	3300025732	Aqueous	LKKPSEPTFEEIQTDGGQIKETDQMGREKFWEDLGRPND
Ga0208005_11913391	3300025848	Aqueous	MESLKSPLTHIQTDGGVMIETDAMGREKFWEDLGRPDDGK
Ga0208783_102485123	3300025872	Aqueous	MEKSKEPSTQINTDGGKIKETDQMGREKFWEDLGRPDDGK
Ga0208009_100353310	3300027114	Deep Subsurface	METSKEPSIQINTDGGQIKETDQMGREKFWEDLGRPSDRG
Ga0208009_10322954	3300027114	Deep Subsurface	MLDWNIMENLNQPSILTDGGTIKETDAMGREKFWEDLGRPNDGK
Ga0255074_100237710	3300027121	Freshwater	KDLLIQIQTDGGTIKETDQMGREKFWEDLGRPDDRK
Ga0255074_10053151	3300027121	Freshwater	MDNSKDPLIQIQTDGGTIKETDQMGREKFWEDLGRPDDRK
Ga0255074_10127734	3300027121	Freshwater	MEKSKEPSIQINTDGGTIKETDQMGREKFWEDLGRPDDGK
Ga0255113_10791921	3300027147	Freshwater	RCMKDSKEPSIQINTDGGQIIETDQMGREKFWEDLGRPNDGK
Ga0208787_11327381	3300027518	Deep Subsurface	DWNTMENLNQPSILTDGGTIKETDAMGREKFWEDLGRPNDGK
Ga0208974_10393505	3300027608	Freshwater Lentic	MTKLENPFKELQNESGAIKDTDAMGREKFWEDLGRPDDGK
Ga0208974_11211934	3300027608	Freshwater Lentic	LRKLLGRNIMQNLKSASIETDGGQIKETDSMGREKFWEDLGRPNDGE
Ga0209599_100043055	3300027710	Deep Subsurface	METSKSPLIHTETDGGRIVETDAMGREKFWEDLGRPDGK
Ga0209599_101825682	3300027710	Deep Subsurface	MENLNQPSIQTDGGTIKETDAMGREKFWEDLGRPDDGK
(restricted) Ga0247833_10769443	3300027730	Freshwater	MTQLENPFKDIQTEGGTIKDTDAMGREKFWEDLGRPSNDGK
Ga0209596_10276215	3300027754	Freshwater Lake	MQNLKSTSIETDGGQIVETDSMGREKFWEDLGRPDDGK
Ga0209770_101083813	3300027769	Freshwater Lake	MENSKNPWTEIQTNGGTIKETDAMGREKFWEDLGRPDDGK
Ga0209770_102111553	3300027769	Freshwater Lake	NPWTEIQTNGGTIKETDAMGREKFWEDLGRPDDGK
Ga0209500_100081034	3300027782	Freshwater Lake	MENLKSTSIETDGGQIVETDSMGREKFWEDLGRPNDGK
Ga0209972_100093179	3300027793	Freshwater Lake	MNNSENKLKDLTDPIKTDGGEIKETDAMGREKFWEDLGRPND
Ga0209972_100467524	3300027793	Freshwater Lake	MTELKKPSDDIQTDGGEIKETDQMGREKFWEDLGRPND
Ga0209358_100822465	3300027804	Freshwater Lake	MQTSKEPLNQIQTDGGQIKETDQMGREKFWEDLGRPDDGK
Ga0209229_1000000437	3300027805	Freshwater And Sediment	MENSKDRLNHIETDGGTIKETDAMGREKFWEDLGRPND
Ga0209229_104511213	3300027805	Freshwater And Sediment	MDNSKNLWTEIQTNGGTIKETDAMGREKFWEDLGRPSDDEK
Ga0209550_100843257	3300027892	Freshwater Lake	MEKSKEPSIQINTDGGQIKETDQMGREKFWEDLGRPSDRG
Ga0247723_10221978	3300028025	Deep Subsurface Sediment	DWNIMENLNQPSILTDGGNIKETDAMGREKFWEDLGRPDDGK
Ga0247723_10345232	3300028025	Deep Subsurface Sediment	MDNLNQPSIQTDGGQIKETDQMGREKFWEDMGRPDDGK
Ga0247723_10395103	3300028025	Deep Subsurface Sediment	MDNSKTPLIHTQTDGGTIIETDAMGREKFWEDLGRPDDRK
Ga0247723_10462954	3300028025	Deep Subsurface Sediment	MDNLNQPSIQTDGGQIKETDQMGREKFWEDMGRPDDRK
(restricted) Ga0247832_11369624	3300028557	Freshwater	ASIMTQLENPFKDIQTEGGTIKDTDAMGREKFWEDLGRPSNDGK
Ga0119944_10484672	3300029930	Aquatic	MNESKEPLIQTDGGVIKETDAMGREKFWEDLGRPDDGK
Ga0315907_101523123	3300031758	Freshwater	MKELKKPSEQIETDGGTIKETDAMGREKFWEDLGRPND
Ga0315907_112849141	3300031758	Freshwater	MTQLENPFKDIQTEGGAIKETDAMGREKFWEDLGRPSDDGK
Ga0315900_102631644	3300031787	Freshwater	MENLNQPSILTDGGAIKETDAMGREKFWEDLGRPDDSGE
Ga0315904_103832741	3300031951	Freshwater	ENLNQPSILTDGGTIKETDAIGREKFWEDLGRPNDGK
Ga0315904_105719291	3300031951	Freshwater	MDNSKNLWTEIQTNGGTIKETDAMGREKFWEDLGRPDDGK
Ga0315904_107213364	3300031951	Freshwater	KKMLDWNIMENLNQPSILTDGGNIKETDAMGREKFWEDLGRPDDGK
Ga0315902_111072493	3300032093	Freshwater	MENLNQPSILTDGGTIKETDAMGREKFWEDLGRPDDSGK
Ga0315903_103309765	3300032116	Freshwater	DWNFMDNSKDPLIQIQTDGGTIKETDQMGREKFWEDLGRPDDRK
Ga0315903_105637231	3300032116	Freshwater	DWNFMDNSKNLWTEIQTNGGTIKETDAMGREKFWEDLGRPSDDGK
Ga0316616_1042675631	3300033521	Soil	MSEWKEPLPEINTDGGKIIETDQMGREKFWEDIGRPND
Ga0316617_1024749072	3300033557	Soil	MKELKEPSEKIQTDGGQIKETDQMGREKFWEDLGRPND
Ga0334980_0299888_28_150	3300033816	Freshwater	MKDSKEPSIQINTDGGQIIETDQMGREKFWEDLGRPNDRG
Ga0334977_0200332_38_172	3300033978	Freshwater	MLDWIIMESLNQPSILTDGGNIKETDAMGREKFWEDLGRPDDGK
Ga0334982_0188551_1_111	3300033981	Freshwater	MTKLENPFKELQNESGAIKDTDAMGREKFWEDLGRPS
Ga0334985_0158664_796_921	3300034018	Freshwater	MTQLENPFKDFQNESGAIKDTDAMGREKFWEDLGRPSDDGK
Ga0334998_0079105_627_761	3300034019	Freshwater	MLDWIIMENLNQPSILTDGGNIKETDAMGREKFWEDLGRPDDGK
Ga0335002_0625967_73_207	3300034020	Freshwater	MLDWNIMENLNQPSILTDGGNIKETDAMGREKFWEDLGRPNDGK
Ga0335000_0081113_2013_2150	3300034063	Freshwater	MLDWNIMENLNQPSILTDGGNIKETDAMGREKFWEDLGRPSDDGK
Ga0335019_0000065_33929_34051	3300034066	Freshwater	MESLKNPLTEIQTDGGTIKETDAMGREKFWEDLGRPDDRK
Ga0310130_0019280_236_352	3300034073	Fracking Water	MTESKEPLKQIQTDGGIIIETDQMGREKFWEDLGRPND
Ga0310130_0097676_366_482	3300034073	Fracking Water	MEEWKKQSVETDGGQIKETDAMGREKFWEDIGRPNDGK
Ga0310130_0265112_167_289	3300034073	Fracking Water	MENSKDPLIHIQTDGGQIKETDQMGREKFWEDLGRPDDGK
Ga0335029_0366150_541_663	3300034102	Freshwater	MEDLNEPSIQINTDGGQIKETDQMGREKFWEDLGRPNDRG
Ga0335063_0006743_4714_4830	3300034111	Freshwater	MDNLNQPLIQTDGGKIKETDQMGREKFWEDMGRPDDGK
Ga0335065_0034659_3103_3228	3300034200	Freshwater	MTQLENPFKDFQNESGDIKDTDAMGREKFWEDLGRPSDDGK
Ga0334997_0907781_152_286	3300034280	Freshwater	MLDWNIMENLNQPSILTDGGNIKETDAMGREKFWEDLGRPYDGK
Ga0335007_0217798_1198_1311	3300034283	Freshwater	DNLNQPSIQTDGGQIKETDQMGREKFWEDMGRPDDGK

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters