NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F021529

Metagenome / Metatranscriptome Family F021529

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F021529
Family Type Metagenome / Metatranscriptome
Number of Sequences 218
Average Sequence Length 50 residues
Representative Sequence MLRRLIVVTALAAGMSIAAAVALATPALAKGPSQARITGPGLAHAIVVS
Number of Associated Samples 139
Number of Associated Scaffolds 218

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 99.54 %
% of genes near scaffold ends (potentially truncated) 99.08 %
% of genes from short scaffolds (< 2000 bps) 93.12 %
Associated GOLD sequencing projects 134
AlphaFold2 3D model prediction Yes
3D model pTM-score0.46

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (93.119 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(55.505 % of family members)
Environment Ontology (ENVO) Unclassified
(67.431 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(55.505 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Fibrous Signal Peptide: Yes Secondary Structure distribution: α-helix: 36.36%    β-sheet: 7.79%    Coil/Unstructured: 55.84%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.46
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 218 Family Scaffolds
PF08281Sigma70_r4_2 12.84
PF00291PALP 4.59
PF12836HHH_3 1.38
PF00067p450 0.92
PF13490zf-HC2 0.46
PF05173DapB_C 0.46
PF00196GerE 0.46
PF04545Sigma70_r4 0.46
PF04075F420H2_quin_red 0.46
PF03176MMPL 0.46
PF01799Fer2_2 0.46
PF12681Glyoxalase_2 0.46
PF132392TM 0.46
PF05721PhyH 0.46
PF00144Beta-lactamase 0.46
PF00465Fe-ADH 0.46

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 218 Family Scaffolds
COG2124Cytochrome P450Defense mechanisms [V] 0.92
COG02894-hydroxy-tetrahydrodipicolinate reductaseAmino acid transport and metabolism [E] 0.46
COG03373-dehydroquinate synthetaseAmino acid transport and metabolism [E] 0.46
COG0371Glycerol dehydrogenase or related enzyme, iron-containing ADH familyEnergy production and conversion [C] 0.46
COG1033Predicted exporter protein, RND superfamilyGeneral function prediction only [R] 0.46
COG1454Alcohol dehydrogenase, class IVEnergy production and conversion [C] 0.46
COG1680CubicO group peptidase, beta-lactamase class C familyDefense mechanisms [V] 0.46
COG1686D-alanyl-D-alanine carboxypeptidaseCell wall/membrane/envelope biogenesis [M] 0.46
COG1979Alcohol dehydrogenase YqhD, Fe-dependent ADH familyEnergy production and conversion [C] 0.46
COG2367Beta-lactamase class ADefense mechanisms [V] 0.46
COG2409Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamilyGeneral function prediction only [R] 0.46
COG5285Ectoine hydroxylase-related dioxygenase, phytanoyl-CoA dioxygenase (PhyH) familySecondary metabolites biosynthesis, transport and catabolism [Q] 0.46


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms93.12 %
UnclassifiedrootN/A6.88 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2070309004|prs_FHA1B5K04XGZHBAll Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium523Open in IMG/M
2166559005|cont_contig62987All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii778Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_105611959All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii717Open in IMG/M
3300005332|Ga0066388_101834684All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1080Open in IMG/M
3300005436|Ga0070713_101360933All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii688Open in IMG/M
3300005440|Ga0070705_100195934All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae1381Open in IMG/M
3300005467|Ga0070706_100986036All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii777Open in IMG/M
3300005467|Ga0070706_101405860All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii639Open in IMG/M
3300005554|Ga0066661_10709400Not Available590Open in IMG/M
3300005560|Ga0066670_10510673All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium738Open in IMG/M
3300005560|Ga0066670_10655324All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales637Open in IMG/M
3300005764|Ga0066903_100226158All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2845Open in IMG/M
3300005764|Ga0066903_107023216All Organisms → cellular organisms → Bacteria584Open in IMG/M
3300006577|Ga0074050_11875317All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii783Open in IMG/M
3300006579|Ga0074054_12007305All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii740Open in IMG/M
3300006580|Ga0074049_12938850All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii750Open in IMG/M
3300006914|Ga0075436_100354218All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1058Open in IMG/M
3300009176|Ga0105242_12099157All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii609Open in IMG/M
3300010043|Ga0126380_11325415All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii628Open in IMG/M
3300010048|Ga0126373_11045749All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii882Open in IMG/M
3300010320|Ga0134109_10258592All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii659Open in IMG/M
3300010358|Ga0126370_10487382Not Available1038Open in IMG/M
3300010359|Ga0126376_11902388All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii635Open in IMG/M
3300010360|Ga0126372_12493705All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii568Open in IMG/M
3300010360|Ga0126372_13105329All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii516Open in IMG/M
3300010362|Ga0126377_10643462All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1109Open in IMG/M
3300010366|Ga0126379_10102166All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura fibrosa2554Open in IMG/M
3300010366|Ga0126379_10380122All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1453Open in IMG/M
3300010366|Ga0126379_12032464All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii677Open in IMG/M
3300010366|Ga0126379_13088000All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii557Open in IMG/M
3300010376|Ga0126381_101238555All Organisms → cellular organisms → Bacteria → Terrabacteria group1078Open in IMG/M
3300010376|Ga0126381_103350987All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii631Open in IMG/M
3300010376|Ga0126381_103685858Not Available600Open in IMG/M
3300010376|Ga0126381_104393965All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii545Open in IMG/M
3300010376|Ga0126381_104555912All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii535Open in IMG/M
3300010376|Ga0126381_104715227All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii525Open in IMG/M
3300010398|Ga0126383_10455124All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1330Open in IMG/M
3300010398|Ga0126383_11772143All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii706Open in IMG/M
3300010398|Ga0126383_13331794All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii525Open in IMG/M
3300010400|Ga0134122_11397268All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii714Open in IMG/M
3300011269|Ga0137392_11352520All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii571Open in IMG/M
3300012199|Ga0137383_10660910All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii764Open in IMG/M
3300012209|Ga0137379_11562799All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii559Open in IMG/M
3300012210|Ga0137378_11380797All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii618Open in IMG/M
3300012354|Ga0137366_10109205All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2094Open in IMG/M
3300012356|Ga0137371_10492996All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii946Open in IMG/M
3300012358|Ga0137368_10852350All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii559Open in IMG/M
3300012917|Ga0137395_10528908All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii850Open in IMG/M
3300012918|Ga0137396_11123180All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii560Open in IMG/M
3300012971|Ga0126369_13159440All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii539Open in IMG/M
3300012971|Ga0126369_13538154All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii512Open in IMG/M
3300012989|Ga0164305_11039552All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii699Open in IMG/M
3300013764|Ga0120111_1037057All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1274Open in IMG/M
3300016270|Ga0182036_11131923Not Available649Open in IMG/M
3300016294|Ga0182041_10070019All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2463Open in IMG/M
3300016319|Ga0182033_10092283All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2204Open in IMG/M
3300016319|Ga0182033_10289341All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae1348Open in IMG/M
3300016319|Ga0182033_10486230All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1058Open in IMG/M
3300016341|Ga0182035_10118985All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1973Open in IMG/M
3300016341|Ga0182035_10183449All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1640Open in IMG/M
3300016341|Ga0182035_12153350Not Available506Open in IMG/M
3300016357|Ga0182032_10649321All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii882Open in IMG/M
3300016357|Ga0182032_11626053All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii562Open in IMG/M
3300016371|Ga0182034_10568085All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii954Open in IMG/M
3300016387|Ga0182040_10064439All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2346Open in IMG/M
3300016404|Ga0182037_11118751All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii690Open in IMG/M
3300016404|Ga0182037_11632392All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii574Open in IMG/M
3300016422|Ga0182039_10864498All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii806Open in IMG/M
3300017947|Ga0187785_10138634All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1011Open in IMG/M
3300018433|Ga0066667_11928062All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii540Open in IMG/M
3300021088|Ga0210404_10884560All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii511Open in IMG/M
3300021420|Ga0210394_11152359All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii667Open in IMG/M
3300021560|Ga0126371_10261484All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1848Open in IMG/M
3300021560|Ga0126371_10922469All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1017Open in IMG/M
3300021560|Ga0126371_11701431Not Available755Open in IMG/M
3300026984|Ga0208732_1022819All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii569Open in IMG/M
3300027857|Ga0209166_10300283All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii845Open in IMG/M
3300027882|Ga0209590_10907009All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii555Open in IMG/M
3300028807|Ga0307305_10397543All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii623Open in IMG/M
3300028819|Ga0307296_10229636All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1009Open in IMG/M
3300028828|Ga0307312_10493280All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii808Open in IMG/M
3300028828|Ga0307312_10511946All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii792Open in IMG/M
3300028876|Ga0307286_10283501All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii610Open in IMG/M
3300028884|Ga0307308_10231063All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii886Open in IMG/M
3300028906|Ga0308309_10452018All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1107Open in IMG/M
3300031543|Ga0318516_10031199All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2815Open in IMG/M
3300031543|Ga0318516_10266742All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii990Open in IMG/M
3300031544|Ga0318534_10001856All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria8787Open in IMG/M
3300031544|Ga0318534_10391788All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii798Open in IMG/M
3300031544|Ga0318534_10399881All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii789Open in IMG/M
3300031544|Ga0318534_10546224All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii660Open in IMG/M
3300031545|Ga0318541_10825227All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii517Open in IMG/M
3300031546|Ga0318538_10605263All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii594Open in IMG/M
3300031546|Ga0318538_10727590All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii538Open in IMG/M
3300031572|Ga0318515_10071062All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1788Open in IMG/M
3300031572|Ga0318515_10234318All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii984Open in IMG/M
3300031572|Ga0318515_10507708All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii643Open in IMG/M
3300031573|Ga0310915_10564963All Organisms → cellular organisms → Bacteria → Terrabacteria group807Open in IMG/M
3300031640|Ga0318555_10052741All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2068Open in IMG/M
3300031640|Ga0318555_10128500All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae1349Open in IMG/M
3300031668|Ga0318542_10128843All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1244Open in IMG/M
3300031668|Ga0318542_10317253All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii799Open in IMG/M
3300031668|Ga0318542_10378839Not Available729Open in IMG/M
3300031680|Ga0318574_10105649All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae1565Open in IMG/M
3300031680|Ga0318574_10346825All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii865Open in IMG/M
3300031680|Ga0318574_10602133All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii644Open in IMG/M
3300031681|Ga0318572_10627469All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii640Open in IMG/M
3300031682|Ga0318560_10494850All Organisms → cellular organisms → Bacteria → Terrabacteria group662Open in IMG/M
3300031713|Ga0318496_10808664All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii516Open in IMG/M
3300031720|Ga0307469_10560742All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1013Open in IMG/M
3300031723|Ga0318493_10369868All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii781Open in IMG/M
3300031723|Ga0318493_10833489All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii520Open in IMG/M
3300031724|Ga0318500_10202142All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii952Open in IMG/M
3300031724|Ga0318500_10451899All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii643Open in IMG/M
3300031736|Ga0318501_10615593All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii596Open in IMG/M
3300031744|Ga0306918_10191385All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea1537Open in IMG/M
3300031744|Ga0306918_10471724All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii982Open in IMG/M
3300031744|Ga0306918_11031279All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii638Open in IMG/M
3300031747|Ga0318502_10832743All Organisms → cellular organisms → Bacteria → Terrabacteria group560Open in IMG/M
3300031748|Ga0318492_10735396All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii529Open in IMG/M
3300031751|Ga0318494_10031545All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2713Open in IMG/M
3300031751|Ga0318494_10191137All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1164Open in IMG/M
3300031763|Ga0318537_10381153Not Available520Open in IMG/M
3300031764|Ga0318535_10312800All Organisms → cellular organisms → Bacteria → Terrabacteria group702Open in IMG/M
3300031764|Ga0318535_10386745Not Available625Open in IMG/M
3300031765|Ga0318554_10078056All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1843Open in IMG/M
3300031768|Ga0318509_10297401All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii903Open in IMG/M
3300031769|Ga0318526_10166233All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii899Open in IMG/M
3300031769|Ga0318526_10188546Not Available842Open in IMG/M
3300031769|Ga0318526_10334046All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii620Open in IMG/M
3300031770|Ga0318521_10211796All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1122Open in IMG/M
3300031770|Ga0318521_10498548All Organisms → cellular organisms → Bacteria → Terrabacteria group731Open in IMG/M
3300031771|Ga0318546_10827081All Organisms → cellular organisms → Bacteria652Open in IMG/M
3300031771|Ga0318546_11306984All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii509Open in IMG/M
3300031777|Ga0318543_10203836All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii878Open in IMG/M
3300031778|Ga0318498_10128170All Organisms → cellular organisms → Bacteria1154Open in IMG/M
3300031778|Ga0318498_10159728All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1026Open in IMG/M
3300031778|Ga0318498_10347200All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii663Open in IMG/M
3300031778|Ga0318498_10526353All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii519Open in IMG/M
3300031779|Ga0318566_10552307All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii562Open in IMG/M
3300031779|Ga0318566_10662572All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii506Open in IMG/M
3300031782|Ga0318552_10003617All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5818Open in IMG/M
3300031782|Ga0318552_10091800All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1490Open in IMG/M
3300031782|Ga0318552_10163734All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1120Open in IMG/M
3300031782|Ga0318552_10741673Not Available501Open in IMG/M
3300031792|Ga0318529_10014379All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3030Open in IMG/M
3300031792|Ga0318529_10529565All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii547Open in IMG/M
3300031792|Ga0318529_10568893All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii526Open in IMG/M
3300031793|Ga0318548_10313155All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii771Open in IMG/M
3300031794|Ga0318503_10077029All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1043Open in IMG/M
3300031795|Ga0318557_10353634All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii675Open in IMG/M
3300031795|Ga0318557_10410451All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii623Open in IMG/M
3300031796|Ga0318576_10124657All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae1191Open in IMG/M
3300031796|Ga0318576_10244603All Organisms → cellular organisms → Bacteria → Terrabacteria group846Open in IMG/M
3300031796|Ga0318576_10530055All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium555Open in IMG/M
3300031797|Ga0318550_10270324All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii825Open in IMG/M
3300031798|Ga0318523_10086627All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea1523Open in IMG/M
3300031798|Ga0318523_10426382All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii658Open in IMG/M
3300031798|Ga0318523_10552048Not Available568Open in IMG/M
3300031799|Ga0318565_10246039All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium869Open in IMG/M
3300031799|Ga0318565_10579810All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii540Open in IMG/M
3300031805|Ga0318497_10154174All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora1258Open in IMG/M
3300031805|Ga0318497_10264581All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii955Open in IMG/M
3300031805|Ga0318497_10367586All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii804Open in IMG/M
3300031805|Ga0318497_10471659All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii703Open in IMG/M
3300031821|Ga0318567_10623581All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii612Open in IMG/M
3300031821|Ga0318567_10668401All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii589Open in IMG/M
3300031831|Ga0318564_10432986All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii574Open in IMG/M
3300031832|Ga0318499_10303780All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii616Open in IMG/M
3300031832|Ga0318499_10379316All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii542Open in IMG/M
3300031833|Ga0310917_10907803All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii592Open in IMG/M
3300031835|Ga0318517_10104178All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae1247Open in IMG/M
3300031846|Ga0318512_10478207All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii630Open in IMG/M
3300031859|Ga0318527_10111826All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1128Open in IMG/M
3300031860|Ga0318495_10378238All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium625Open in IMG/M
3300031880|Ga0318544_10352329All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii572Open in IMG/M
3300031890|Ga0306925_10008177All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria9896Open in IMG/M
3300031890|Ga0306925_10274404All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae1816Open in IMG/M
3300031890|Ga0306925_10637742Not Available1121Open in IMG/M
3300031893|Ga0318536_10478175All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii627Open in IMG/M
3300031893|Ga0318536_10662451All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii520Open in IMG/M
3300031894|Ga0318522_10414612All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii510Open in IMG/M
3300031896|Ga0318551_10831063All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii538Open in IMG/M
3300031910|Ga0306923_12115739All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium567Open in IMG/M
3300031912|Ga0306921_10781799All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1091Open in IMG/M
3300031912|Ga0306921_11704630All Organisms → cellular organisms → Bacteria → Terrabacteria group681Open in IMG/M
3300031912|Ga0306921_11779913All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii663Open in IMG/M
3300031942|Ga0310916_10323618All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae1308Open in IMG/M
3300031945|Ga0310913_11174443All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii535Open in IMG/M
3300031946|Ga0310910_11212578All Organisms → cellular organisms → Bacteria → Terrabacteria group585Open in IMG/M
3300031947|Ga0310909_10605798All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii915Open in IMG/M
3300032001|Ga0306922_10591920All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1176Open in IMG/M
3300032001|Ga0306922_11651661All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii636Open in IMG/M
3300032008|Ga0318562_10836341All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii526Open in IMG/M
3300032009|Ga0318563_10242956All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii972Open in IMG/M
3300032010|Ga0318569_10280906All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii774Open in IMG/M
3300032035|Ga0310911_10680857All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii596Open in IMG/M
3300032041|Ga0318549_10071008All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae1477Open in IMG/M
3300032041|Ga0318549_10218968Not Available855Open in IMG/M
3300032043|Ga0318556_10219382All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii991Open in IMG/M
3300032054|Ga0318570_10013867All Organisms → cellular organisms → Bacteria2905Open in IMG/M
3300032054|Ga0318570_10462555All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii579Open in IMG/M
3300032055|Ga0318575_10339915All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii760Open in IMG/M
3300032059|Ga0318533_10132514All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea1752Open in IMG/M
3300032063|Ga0318504_10160981All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1037Open in IMG/M
3300032063|Ga0318504_10484077All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii592Open in IMG/M
3300032064|Ga0318510_10542181All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii507Open in IMG/M
3300032065|Ga0318513_10381299All Organisms → cellular organisms → Bacteria → Terrabacteria group688Open in IMG/M
3300032066|Ga0318514_10015847All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3347Open in IMG/M
3300032066|Ga0318514_10767331All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii513Open in IMG/M
3300032068|Ga0318553_10314317All Organisms → cellular organisms → Bacteria → Terrabacteria group820Open in IMG/M
3300032068|Ga0318553_10550743All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii604Open in IMG/M
3300032076|Ga0306924_11356022All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium761Open in IMG/M
3300032089|Ga0318525_10311073All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii809Open in IMG/M
3300032090|Ga0318518_10133541All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae1255Open in IMG/M
3300032090|Ga0318518_10188470All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1055Open in IMG/M
3300032090|Ga0318518_10298152Not Available827Open in IMG/M
3300032091|Ga0318577_10414374All Organisms → cellular organisms → Bacteria643Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil55.50%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil12.84%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil11.47%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.59%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.21%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.83%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.38%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.38%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.46%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.46%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.46%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.46%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.46%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.46%
Green-Waste CompostEnvironmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Green-Waste Compost0.46%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.46%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.46%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.46%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.46%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.46%
SimulatedEngineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated0.46%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2070309004Green-waste compost microbial communities at University of California, Davis, USA, from solid state bioreactor - Luquillo Rain Forest, Puerto RicoEnvironmentalOpen in IMG/M
2166559005Simulated microbial communities from Lyon, FranceEngineeredOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005554Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110EnvironmentalOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006577Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006579Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006580Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012358Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013764Permafrost microbial communities from Nunavut, Canada - A28_35cm_6MEnvironmentalOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300017947Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MGEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300026984Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF048 (SPAdes)EnvironmentalOpen in IMG/M
3300027857Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028876Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031763Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29EnvironmentalOpen in IMG/M
3300031764Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031769Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031777Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24EnvironmentalOpen in IMG/M
3300031778Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24EnvironmentalOpen in IMG/M
3300031779Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22EnvironmentalOpen in IMG/M
3300031782Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20EnvironmentalOpen in IMG/M
3300031792Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23EnvironmentalOpen in IMG/M
3300031793Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21EnvironmentalOpen in IMG/M
3300031794Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23EnvironmentalOpen in IMG/M
3300031795Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19EnvironmentalOpen in IMG/M
3300031796Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24EnvironmentalOpen in IMG/M
3300031797Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23EnvironmentalOpen in IMG/M
3300031798Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19EnvironmentalOpen in IMG/M
3300031799Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031831Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20EnvironmentalOpen in IMG/M
3300031832Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031835Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031859Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25EnvironmentalOpen in IMG/M
3300031860Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25EnvironmentalOpen in IMG/M
3300031880Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031893Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28EnvironmentalOpen in IMG/M
3300031894Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032008Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18EnvironmentalOpen in IMG/M
3300032009Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19EnvironmentalOpen in IMG/M
3300032010Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22EnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032041Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032054Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23EnvironmentalOpen in IMG/M
3300032055Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032063Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17EnvironmentalOpen in IMG/M
3300032064Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17EnvironmentalOpen in IMG/M
3300032065Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300032091Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
prs_056549502070309004Green-Waste CompostMMRRLIVTTALAAGISIAAAITLATPAAAKGPSQARITGPGLVHAIVVSG
cont_0987.000041302166559005SimulatedMLRRLIAVTALTAGMSIAAATTLATPALAKGPSQARITGPGL
INPhiseqgaiiFebDRAFT_10561195923300000364SoilMVRRLIAVMTFATGMSIAAVMLAMPALAKGPSQARITGPGLVHAIVVTGGGEPGQPGRLASLAERTNL
Ga0066388_10183468413300005332Tropical Forest SoilMLRRLIAVTALAAGMSIAAVIALATPALAKGPSQARITGPGLVRAIV
Ga0070713_10136093323300005436Corn, Switchgrass And Miscanthus RhizosphereMLRRLIAVTTLATGISIAAVTLATPAFAKGPTQARITGPGLVHPIVLSGAGERGQPGRLSALAEQTN
Ga0070705_10019593413300005440Corn, Switchgrass And Miscanthus RhizosphereMLRRLIAVAALAAGMSVAAVMTLATPAFAKGPSQASITGPGLGRAIVVSGEGE
Ga0070706_10098603623300005467Corn, Switchgrass And Miscanthus RhizosphereMLRRLTIVAALAAGMCITAVMTLATPALAKGPTQARITGPGLAGHGIVVSGNGEPGQLSRLARLAT
Ga0070706_10140586013300005467Corn, Switchgrass And Miscanthus RhizosphereVNRLRKDPLMLRRLIAVTTLATGISIAAVTLATPAFAKGPTQARITG
Ga0066661_1070940013300005554SoilMPRRLIAVTTLAAGMSIAAAISLATPALAKGPSQASIGGPGLVHAIVVSGDGEP
Ga0066670_1051067313300005560SoilMLRRLIVITALAAGMSAAAISLAAPALAKGPSQASITGPKLVH
Ga0066670_1065532413300005560SoilMLRRLIVVTALAAGMSIAAAVALATPALAKGPSQARITGPGL
Ga0066903_10022615813300005764Tropical Forest SoilMLRRLIVLTAVTAGVSIAAVLTLATPALAKGPSQARITGPGLAHPIVV
Ga0066903_10702321613300005764Tropical Forest SoilMPRRLITVTALAAGMSIAAVWVATPALAKGPSQASIT
Ga0074050_1187531723300006577SoilMLRRLIVLTALAGGMSIAAAMLLAAPALAKGPSQARITGPGLARAIVVSGE
Ga0074054_1200730523300006579SoilMLRRLIVLTALAGGMSIAAAMLLASPALAKGPSQARITGPGLARAIVVSGQGEPGQPGRLASLAE
Ga0074049_1293885023300006580SoilMLRRLIVLTALAGGMSIAAAMLLASPALAKGPSQARITGPGLARAIVVSGQGEPG
Ga0075436_10035421813300006914Populus RhizosphereMLRRLIVLAALAAGMSIAAAITLATPALAKGPSQARITGPGLARPIVVSGNGEPGQPGILGTLALQT
Ga0105242_1209915713300009176Miscanthus RhizosphereMLRRLIAVTALAAGMSVAAVLTLATPAFAKGPSQASI
Ga0126380_1132541523300010043Tropical Forest SoilMLRRLIVVTALAAGMSIAAAMTLAAPALAKGPSQASI
Ga0126373_1104574923300010048Tropical Forest SoilMLPRRLFTVIALAAGMSIAAAVTFATPALAKGPSQARITGPGLARPIVVSGSGEPGQPGV
Ga0134109_1025859213300010320Grasslands SoilMLRRLIVVTALAAGMSIAAAVALATPALAKGPSQARITGPGLVHAIVVSGGGV
Ga0126370_1048738223300010358Tropical Forest SoilMVVTALAAGLSVAAVTLAAPAFAKGPSRATITGPGLTRAIVVSGN
Ga0126376_1190238813300010359Tropical Forest SoilMCNGRSRPVLRRLIFLTVLAAGMSVAAVMAAATPALAKGPSQARITGPGLVHAIVVSGGGEPGQPGRLATL
Ga0126372_1249370523300010360Tropical Forest SoilMRRLIVITALAAGISIAAAITLATPAAAKGPSQARIIGPGLVHAIVVSGEGEPGQQGSLATLA
Ga0126372_1310532923300010360Tropical Forest SoilMLRRLAVVTALVAGMSIAAAITLATPALAKGPSQAR
Ga0126377_1064346233300010362Tropical Forest SoilMLRRLITVTTVATGLSIAAVMLAMPAFAKGPSQARITGPGLIHPIVVSGGGEPG
Ga0126379_1010216643300010366Tropical Forest SoilMLRRLTIVTALAAGMCITAATLATPALAKGPSRARITGPGL
Ga0126379_1038012213300010366Tropical Forest SoilMLRKLIVVTALAAGMSIAAAITLATPALAKGPSQASITGPG
Ga0126379_1203246423300010366Tropical Forest SoilMLRRLTIGTALAVAMSIAAALTLATPALAKGPTQARITGPGLARAIVVSGN
Ga0126379_1308800023300010366Tropical Forest SoilMLRRLIVLTALAAAMSIAAAITLATPALAKGPFQAHITGPGLAHAIVVSGNGEPGQ
Ga0126381_10123855513300010376Tropical Forest SoilVLRRLTVVTALAAGMSIAAAITLATQALAKGPSQARITGPGLAPAIVVSG
Ga0126381_10335098713300010376Tropical Forest SoilMLLRRLIVVIALAAGLSIEAITLAAPAFAKGPSQARITGPGLARAIVVSGNGEP
Ga0126381_10368585823300010376Tropical Forest SoilMLRRLLAVIALAAGMSIAAISLATSALAKGPSQASITGPGLA
Ga0126381_10439396523300010376Tropical Forest SoilMLRRLIVVTALAAGTGVAAVLWLAAPALAKGPSQASITGPGLVRAVIVAGNGEPGEQSTLAVLSGQ
Ga0126381_10455591213300010376Tropical Forest SoilMLRRLIAVTALAVGMSVAAAMTLATPALAKGPSQA
Ga0126381_10471522723300010376Tropical Forest SoilMLPRRLITVIALAAGMSIAAAITFATPALAKGPSQARITGPGLARPIVVSGSGE
Ga0126383_1045512433300010398Tropical Forest SoilMMRRLIVTTALAAGISIAAAVTLASPAAAKGPSQARITGP
Ga0126383_1177214323300010398Tropical Forest SoilMLRRLIVLTTLAAGMSLAAVLTLATPALAKGPSQARITGPGLA
Ga0126383_1333179423300010398Tropical Forest SoilMLRRLIILAALTASMCITAVMTLATPALAKGPSQARITGPGLAHGIVVTGNGEPGQLSA
Ga0134122_1139726813300010400Terrestrial SoilMLRRLIAVAALAAGMSVAAVMTLATPAFAKGPSQASITGPGLGRAIVVSGEGEP
Ga0137392_1135252013300011269Vadose Zone SoilMPRRLITVTALAAGLSVAAAISLATPALAKGPSQASITGPGLVRAIVVSGNGEPGEQ
Ga0137383_1066091023300012199Vadose Zone SoilMLRRLTVVITLAAGMSIAAAITLATPALAKGPSQARITGPGLAHAIVVTGSGEPG*
Ga0137379_1156279923300012209Vadose Zone SoilMLRRLIVVTALAAGTSIAATLTLASPALAKGPSQVRITGPGLVHAIVVSGDGEPGQQG
Ga0137378_1138079713300012210Vadose Zone SoilMLRRLIVLTAVAAGISVAALTLATPALAKGPSQAHITGP
Ga0137366_1010920513300012354Vadose Zone SoilMLRKLIVLTAVAGGMSIAGAMTLAVPALAKGPSQASITGPGLAHAI
Ga0137371_1049299623300012356Vadose Zone SoilMLRRLIVVTALAAGMSIAAAVALATPALAKGPSQARITGPGLVHAIVVSGGGE
Ga0137368_1085235013300012358Vadose Zone SoilMLRKLIVLTAVAGGMSIAGAMTLAVPALAKGPSQASITGPGLAHAIVVSGE
Ga0137395_1052890813300012917Vadose Zone SoilMLRRLIVVTAFAAGMSIAACITLATSALAKGPSQARITGPGLVHAIVVSGDGEP
Ga0137396_1112318023300012918Vadose Zone SoilMLRRLIAVTALAAGMSIAAAMTLATPALAKGPSQARITGPGLVRAVVVSGN
Ga0126369_1315944013300012971Tropical Forest SoilMLRRLIVLTTVAAGIGIATVLTLAAPALAKGPSQARITGPGLAHPIVVTGNGEPGQPG
Ga0126369_1353815423300012971Tropical Forest SoilMLRRLTRVAALAAGMCSTAVALATPALAKGPSRARITG
Ga0164305_1103955223300012989SoilVLRRLIAVTALAAGMSVAAVLTLATPAFAKGPSQASITGPGLG
Ga0120111_103705733300013764PermafrostMLRRLIVLTALAAGMSIAAAMTLATSALAKGPSQARITGPGLAHAIIVSGGGEPGQQGRLARRGEQNSLCPLV
Ga0182036_1113192313300016270SoilMLRRLFVVAALAAGMSIAAVITLATPALAKGPSQARITGPGLVRAVVVSGNGEPGQQGRLGNL
Ga0182041_1007001913300016294SoilMLRKLIAVTTLAIAMSIAAAVTLATPALAKGPSQATITGPGLAHTIVVSG
Ga0182033_1009228343300016319SoilMLRKLIAVTTLAIAMSIAAAVTLATPALAKGPSQATITGPGLA
Ga0182033_1028934133300016319SoilMLRRLIVLTVLTAGVSAATVIALATPALAKGPTQASITG
Ga0182033_1048623013300016319SoilMLRRLITVTALAVGLSIAAAMTLATPALAKGPSQARITGPGLGRAVV
Ga0182035_1011898543300016341SoilMLRRLIVLTALAAGMSVAAVLALAAPALAKGPSQARI
Ga0182035_1018344913300016341SoilMLRKLIAVTTLAIAMSIAAAVTLATPALAKGPSQATITGPGLAHTIVVSGNGEPGLPGR
Ga0182035_1215335013300016341SoilMLRRLLAVIALAAGTSIAAISLATPALAKGPSQASITGPGL
Ga0182032_1064932113300016357SoilMLRRLITVTALAVGLSIAAAMTLATPALAKGPSQARITGPGLGR
Ga0182032_1162605323300016357SoilMLRRLIVLTALVAGLSIAAAITSATPALAKGPSQARISGPGLAHPIVVSGDGEPGQPGMLATL
Ga0182034_1056808523300016371SoilMLRKLIAVTTLAIAMSIAAAVTLATPALAKGPSQATITGPGLAHTIVVSGHG
Ga0182040_1006443943300016387SoilMLRRLIVLTTAAAGISIASVLTLAAPALAKGPSQARITGPGLAHPIVVSGNGEPGQLGTL
Ga0182037_1111875123300016404SoilMLRKLIAVTTLAIGMSIVAVVTLATPALAKGPSQATITGPGLAHTIVVSGNGEPGLPGRLAT
Ga0182037_1163239223300016404SoilMLRRLTVVTALAAGMSLAAALMLATPALAKGPSQARITGPGLARTIVVSGNGE
Ga0182039_1086449813300016422SoilMLRRLFVLTALAAGMCIAAAITLAAPALAKGPSQARITGPGLAHA
Ga0187785_1013863413300017947Tropical PeatlandMLRRLIAVSALAAGMSIAAAMTLATPAFAKGPSQARITGPGLVRAIVVSGAGEPGQQSRLASL
Ga0066667_1192806223300018433Grasslands SoilMLRRLIAVTALAAGMTIAAAMTLATPALAKGPSQARITGPGLARAVVVSGNGE
Ga0210404_1088456023300021088SoilMLRRLIVITALAAGVSGAAALSLATPALAKGPSQASITGLG
Ga0210394_1115235913300021420SoilMLRRLIAVAALAGGMSIAAAMTLATPAFAKGPSQAS
Ga0126371_1026148413300021560Tropical Forest SoilMLRRLTIASALAVGMCITFVMTLATPALAKGPTQARITGPGLPRGIVISGNG
Ga0126371_1092246923300021560Tropical Forest SoilMLRRLIVLTSAAAGISIATVLTLATPALAKGPSQARITGPGLAH
Ga0126371_1170143123300021560Tropical Forest SoilMLRRLIVLTALTAGVSIGTALTLAAPALAKGPSQARITGPGLAHPIVVSGNGE
Ga0208732_102281923300026984Forest SoilMLRRLITVIALAAGLSVAAAISLATPALAKGPSQA
Ga0209166_1030028323300027857Surface SoilMLRRPIIVTVLAVGICVTAVMMPATPALAKGPSQALITGPGLAKGILITGNGEPGQVSRLERLAMQTSLFVLLFG
Ga0209590_1090700913300027882Vadose Zone SoilMPRRLITVTALAAGLSVAAAISLATPALAKGPSQASITGPGLVRAIE
Ga0307305_1039754313300028807SoilMLRRLIVLTALAAGMSIATAMTLATPALAKGPSQARITGPGLARAI
Ga0307296_1022963613300028819SoilMLRRLIVVTALAAGMSIAAAVALATPALAKGPSQARITGPGLAHAIVVS
Ga0307312_1049328023300028828SoilMLRRLIAVTALAAGMSVAAVLTLTTPALAKGPSQVRITGPGLTRAVIVSGNGEPGEQGRLASLALQT
Ga0307312_1051194623300028828SoilMLRRLIVVTALAAGMSIAAAVALAAPALAKGPLQARITGPGLVHAIVVSGGGEPGQPG
Ga0307286_1028350123300028876SoilMLRRLIVVTALAAGMSIAAAVALAAPALAKGPLQAR
Ga0307308_1023106323300028884SoilMLRRLIAVTALAAGMSVAAVLTLTTPALAKGPSQVRITGPGLTRAVIVSGNGE
Ga0308309_1045201813300028906SoilMLRRLIVVTALAAGVSIAVGITLASPALAKGPSQARVTGPGLVH
Ga0318516_1003119913300031543SoilMMRRLIVITAFAAGISIAAAITLATPALAKGPSQARITGPGLVHAIVVS
Ga0318516_1026674223300031543SoilMLRRLIVLTAVATGMSITAVLTLATPALAKGPSQARIAGPGLAHPIVVGGNGEPGQPGIL
Ga0318534_1000185613300031544SoilMLRRLIVLTTAAAGISIASVLTLAAPALAKGPSQARITG
Ga0318534_1039178823300031544SoilMLRRLITVTALAVGLSIAAAMTLATPALAKGPSQARITGPGLGRAVVVSGNGEPGEQGR
Ga0318534_1039988113300031544SoilMLRRLIVVTALAAGMSAAAALSLATPALAKGPSQASITGPGLVRAIMVSGSGEPGQQGTL
Ga0318534_1054622423300031544SoilMLRRLTAVTTLAIGMSIAAAVMLATPALAKGPSQAAITGPGLAHTIVVSGAGEPGQPGRLATLAG
Ga0318541_1082522713300031545SoilMLRRLTAVTTLAIGMSIAAAVMLATPALAKGPSQAAITGPGLAHT
Ga0318538_1060526313300031546SoilMPRKLIAVTTLAIAMSIAAAVTLATPALAKGPSQATITGPGLA
Ga0318538_1072759023300031546SoilMLRRLIVLTALAAGMSMAAVLALAAPALAKGPSQARITG
Ga0318515_1007106243300031572SoilMLRRLFVVAALAAGMSIAAVITLATPALAKGPSQARITGPG
Ga0318515_1023431813300031572SoilMLRRLITVTALAVGLSIAAAMTLATPALAKGPSQARITGP
Ga0318515_1050770813300031572SoilMLRRLIVLTALAAGMSVAAVLALAAPAVAKGPSQARITGPGLAHPIVV
Ga0310915_1056496313300031573SoilMMRRLIVITAFAAGISIAAAITLATPALAKGPSQARITGPGLVHAIVVSGE
Ga0318555_1005274143300031640SoilMLRRLIVLTTAAAGISIASVLTLAAPALAKGPSQARITGPGLAHPIVVTGNGEPG
Ga0318555_1012850013300031640SoilMLRRLIVVTTLAGSISVAAAISLATPALAKGPSQASITGPGLAHAIIVSGSGEPGQQGKLAL
Ga0318542_1012884333300031668SoilMLRRLIGVTTLTAGMSVAAAISLATPALAKGPSQASITGPGLVHAIVVSDNGEPGQQGTLAVLAGQ
Ga0318542_1031725313300031668SoilMLRRLITVTALAAGLSIAAVMALATPAFAKGPSQAR
Ga0318542_1037883913300031668SoilMLRRLLAVIALAAGTSIAAISLATPALAKGPSQASITGPGLAHAIVV
Ga0318574_1010564933300031680SoilMLRRLIVLTALAAGMSVAAVLALAAPALAKGPSQARITGPGLAHPIVVSGNGEPGQL
Ga0318574_1034682523300031680SoilMLRRLITVTALAVGLSIAAAMTLATPALAKGPSQARITGPGLGRAVVVSGNGEPGEQGRLASLA
Ga0318574_1060213313300031680SoilMLRRLTVVAALAAGMSIAAAITLAAPALAKGPTLARI
Ga0318572_1062746923300031681SoilMLRRLTVVTALAAGMSLAAALMLATPALAKGPSQARITGPGLARTIVVSGNGEPGQQS
Ga0318560_1049485023300031682SoilMMRRLIVVTAFAAGISIAAAITLATPALAKGPSQARITGPGLVHAIVVSGE
Ga0318496_1080866413300031713SoilMLRRLIVVTALAAGMSAAAALSLATPALAKGPSQASITGPGLVRAIMV
Ga0307469_1056074213300031720Hardwood Forest SoilMLRRLIAVTALAAGMSVAAALTLATPALAKGPSQARITGPGLAR
Ga0318493_1036986823300031723SoilMLRRLIVVTTLAGSISVAAAISLATPALAKGPSQASITGPGLAHAIIVSGSGEPGQQGK
Ga0318493_1083348923300031723SoilMLRRLIVLTTAAAGISIASVLTLAAPALAKGPSQARITGPGLAH
Ga0318500_1020214223300031724SoilMLRRLTVLTALAAGMSLAAALMLATPALAKGPSQARITGPGLARTIVVSGNGEPGQQSRL
Ga0318500_1045189913300031724SoilMLRRLIVVTTLAGSISVAAAISLATPALAKGPSQASITGPGLAHAIIVSGS
Ga0318501_1061559313300031736SoilMLRRLIVVTTLAGSISVAAAISLAAPALAKGPSQASITGP
Ga0306918_1019138513300031744SoilMLRKLIAVTTLAIAMSIAAAVTLATPALAKGPSQATITGPGLAHTIV
Ga0306918_1047172413300031744SoilMLRRLIVLTALVAGLSIAAAITSATPALAKGPSQARITGPGLAHPIVVTGN
Ga0306918_1103127913300031744SoilMLRRLITVTALAVGLSIAAAMTLATPALAKGPSQARITGPGLGRAVVVSGNGEPGE
Ga0318502_1083274313300031747SoilMPRRLIVVTALAAGMSIAAVITLATPALAKGPSQARITGPGLTRAIVV
Ga0318492_1073539623300031748SoilMLRRLTVVTALAAGMSLAAALMLATPALAKGPSQARITGPGLA
Ga0318494_1003154553300031751SoilMVRRPIVATALAAGMSLAAAITLATPALAKGPSQASI
Ga0318494_1019113733300031751SoilMLRRLITVTALAAGLSIAAVMALATPALAKGPSQARITGPGLVRAIVVSGAGEPGQQSR
Ga0318537_1038115323300031763SoilMLRRLLAVIALAAGTSIAAISLATPALAKGPSQASIT
Ga0318535_1031280013300031764SoilMMRRLIVITALAAGISIAAAITLATPAAAKGPSQARITGPGLVRAIV
Ga0318535_1038674513300031764SoilMLRRLFVVAALAAGMSIAAVITLATPALAKGPSQARITGPGLVRAVVVSGNGEPGQQGRLGNLALE
Ga0318554_1007805643300031765SoilMLRRLIGVTTLTAGMSVAAAISLATPALAKGPSQASITGPGLVHAIVVSDNGEPGQ
Ga0318509_1029740113300031768SoilMLRRLIVVTTLAGSISVAAAISLAAPALAKGPSQASITGPGLAHAIIVSGSGEPGQQGKLALLAGQ
Ga0318526_1016623323300031769SoilMLRRLIGVTTLTAGMSVAAAISLATPALAKGPSQASITGPG
Ga0318526_1018854613300031769SoilMLRRLLAVIALAAGTSIAAISLATPALAKGPSQASITGPGLAHAIVVSGGGEP
Ga0318526_1033404613300031769SoilMLRRLIVLTALTAGMTTAAVVALATPALAKGPSQAVITGPGLAHPVVISGDGEPGQLGRLAGL
Ga0318521_1021179613300031770SoilMLRRLFVVAALAAGMSIAAVITLATPALAKGPSQARITGPGLVRAVVVSGNGEP
Ga0318521_1049854813300031770SoilMMRRLIVVTAFAAGISIAAAITLATPALAKGPSQARITGPGLVHAIVVS
Ga0318546_1082708113300031771SoilMMRRLIVTTALAAGISIAAAITLATPAAAKGPSQARITGPGLVHA
Ga0318546_1130698423300031771SoilMLRRLITVTALAAGLSIAAVMALATPAFAKGPSQARIT
Ga0318543_1020383613300031777SoilMLRRLFVVAALAAGMSIAAVITLATPALAKGPSQA
Ga0318498_1012817013300031778SoilMLRRLFVVAALAAGMSIAAVITLATPALAKGPSQARITGPGLVRAVVV
Ga0318498_1015972823300031778SoilMLRRLIVLTALTAGMTTAAVVALATPALAKGPSQAVITGPGLAHPVVISGSPR
Ga0318498_1034720023300031778SoilMLRRLIVVTALAAGMSIAAAITLATPALAKGPSQASITGPGLAHTIVVSGTGEPG
Ga0318498_1052635323300031778SoilMLRRLITVTALAVGLSIAAAMTLATPALAKGPSQARITGPE
Ga0318566_1055230723300031779SoilMLRRLIVLTALAAGMSVAAVLALAAPAVAKGPSQARITGPGLAHPIVVSGNGEPGQL
Ga0318566_1066257223300031779SoilMLRKLIAVTTLAIGMSIVAVVTLATPALAKGPSQATITGPGLAHA
Ga0318552_1000361713300031782SoilMVRRPIVATALAAGMSLAAAITLATPALAKGPSQA
Ga0318552_1009180033300031782SoilMMRRLIVVTAFAAGISIAAAITLATPALAKGPSQARITGPGLVHAIVV
Ga0318552_1016373413300031782SoilMLRRLTVVAALAAGMSIAAAITLAAPALAKGPTLAR
Ga0318552_1074167313300031782SoilMLRRLSVVTAVVAGMSIAAITLASPALAKGPSQARITGPGLAHAIVVSG
Ga0318529_1001437953300031792SoilMLRRLFVVAALAAGMSIAAVITLATPALAKGPSQARITGPGLVRAVVVSGNGE
Ga0318529_1052956513300031792SoilMLRRLITVTALAVGLSIAAAMTLATPALAKGPSQARITGPGLGRAVVVSGNGEPGQ
Ga0318529_1056889313300031792SoilMLRKLIAVTTLAIGMSIVAVVTLATPALAKGPSQATITGPGLAHAIVVSGAGEPGQAGPLATL
Ga0318548_1031315523300031793SoilMLRRLIGVTTLTAGMSVAAAISLATPALAKGPSQASITGPGLVHAIVVSDNGEPG
Ga0318503_1007702933300031794SoilMLRRLTVVAALAAGMSIAAAITLAAPALAKGPTLARIT
Ga0318557_1035363423300031795SoilMLRKLIAVTTLAIGMSIVAVVTLATPALAKGPSQATITGPGLAH
Ga0318557_1041045123300031795SoilMLRRLTVLTAVAAGMSITAVLTLATPALAKGPSQARIAGPGLAHPIVVGGNGEPGQPGMLGT
Ga0318576_1012465733300031796SoilMLRRLIVLTTAAAGISIASVLTLAAPALAKGPSQARITGPGLAHPIVVTGNGEPGQPGILGTLT
Ga0318576_1024460313300031796SoilMMRRLIVITAFAAGISIAAAITLATPALAKGPSQASITGPGLAHPIVVSGNGEPGQQ
Ga0318576_1053005513300031796SoilMMRRLIVTTALAAGISIAAAITLATPAAAKGPSQARITGPGLVHAIVVSGDGEPG
Ga0318550_1027032413300031797SoilMLRKLIAVTTLAIGMSIVAVVTLATPALAKGPSQATITGPG
Ga0318523_1008662733300031798SoilMLRRLITVTALAVGLSIAAAMTLATPALAKGPSQARITG
Ga0318523_1042638223300031798SoilMLRRLIAVTALAAGMSIAAAMTLATPAFAKGPSQASITGPGLVRAVVVSGNGEPGEQG
Ga0318523_1055204823300031798SoilMLRRLLAVIALAAGTSIAAISLATPALAKGPSQASITGPGLAHAIVVSGGGEPGQQGTL
Ga0318565_1024603913300031799SoilMMRRLIVITAFAAGISIAAAITLATPALAKGPSQARITGPGLVHA
Ga0318565_1057981023300031799SoilMLRRLIVVTTLAGSISVAAAISLATPALAKGPSQASITGPGLAHAII
Ga0318497_1015417433300031805SoilMLRRLIGVTTLTAGMSVAAAISLATPALAKGPSQASITGPGLVHAIVVSDNGEPGQQGTL
Ga0318497_1026458123300031805SoilMLRKLIAVTTLAIGMSIVAVVTLATPALAKGPSQATIT
Ga0318497_1036758613300031805SoilMLRRLITVTALAAGLSIAAVMALATPAFAKGPSQARITGP
Ga0318497_1047165913300031805SoilMLRRLIILTTLAAGMSVAAAISLATPALAKGPSQASITGPGLV
Ga0318567_1062358123300031821SoilMLRRLIVLTTAAAGISIASVLTLAAPALAKGPSQAR
Ga0318567_1066840123300031821SoilMLRRLIVVTVLAAGMSVAAVISLATPALAKGPSQASIAG
Ga0318564_1043298613300031831SoilMLRRLIGVTTLTAGMSVAAAISLATPALAKGPSQASITGPGLVH
Ga0318499_1030378013300031832SoilMLRRLITVTALAVGLSIAAAMTLATPALAKGPSQARITGPGLGRAVVVSGNGEPGEQGRLASLAEE
Ga0318499_1037931613300031832SoilMLRRLIVVTTLAGSISVAAAISLATPALAKGPSQASITGPGLARAIIVSGSGEPGQ
Ga0310917_1090780313300031833SoilMLRRLTVVAALAAGMSIAAAITLAAPALAKGPTLARITGPGLAH
Ga0318517_1010417813300031835SoilMLRRLIVLTTAAAGISIASVLTLAAPALAKGPSQARITGPG
Ga0318512_1047820713300031846SoilMLRKLIAVTTLAIAMSIAAAVTLATPALAKGPSQATITGPGLAHTIVVSGNGEPGLPGRLATLAGQ
Ga0318527_1011182613300031859SoilMLRRLTVVTALAAGMSLAAALMLATPALAKGPSQARITGPGLARTIVVS
Ga0318495_1037823813300031860SoilMPRRLIVVTALAAGMSIAAVITLATPALAKGPSQARITGPGLTRAIVVSGAGEP
Ga0318544_1035232913300031880SoilMLRRLIVVTTLAGSISVAAAISLATPALAKGPSQASITGPG
Ga0306925_1000817713300031890SoilMLRKLIAVTTLAIAMSIAAAVTLATPALAKGPSQATITGPG
Ga0306925_1027440433300031890SoilMLRRLIVVTTLAGSISVAAAISLATPALAKGPSQASITGPGLAHAIIVSGSGEPGQQGKLALL
Ga0306925_1063774223300031890SoilMLRRLLAVIALAAGTSIAAISLATPALAKGPSQASITGPGLAHAIVVSGGGEPGQQG
Ga0318536_1047817513300031893SoilMLRRLIVLTAVATGMSITAVLTLATPALAKGPSQARITGPGLAHPIVVGGNGEP
Ga0318536_1066245113300031893SoilMLRRLIVVTTLAGSISVAAAISLATPALAKGPSQASITGPGL
Ga0318522_1041461223300031894SoilMLRRLIVLTALAAGMSVAAVLALAAPAVAKGPSQARITGPGLA
Ga0318551_1083106313300031896SoilMLRRLIVLTALAAGLSIAAAITSATPALAKGPSQARITGPGLA
Ga0306923_1211573923300031910SoilMMRRLIVITALAAGISIAAAITLATPAAAKGPSQARITGPGLVHAIVVSGDGEPGQQGRLAMLA
Ga0306921_1078179913300031912SoilMLRKLIAVTTLAIAMSIAAAVTLATPALAKGPSQATITGPGLAHTIVVSGHGEPGLPG
Ga0306921_1170463013300031912SoilMMRRLIVITALAAGISIAAAITLATPAAAKGPSQARITGPGLVR
Ga0306921_1177991323300031912SoilMLRRLIVVTALAAGMSVAAAISLATPALAKGPSQASITGPGLAHAIVVSGNGEPGEQ
Ga0310916_1032361813300031942SoilMLRRLIVLTALAAGMSMAAVLALAAPALAKGPSQARITGPGLAHPIVVSGNGEPGQLGT
Ga0310913_1117444323300031945SoilMLRKLIAVTTLAIAMSIAAAVTLATPALAKGPSQARITGPGLVHAI
Ga0310910_1121257823300031946SoilMMRRLIVTTALAAGISIAAAITLATPAAAKGPSQARITGPGLV
Ga0310909_1060579823300031947SoilMLRRLIVVTTLAGSISVAAAISLATPALAKGPSQAS
Ga0306922_1059192033300032001SoilMLRRLFVVAALAAGMSIAAVITLATPALAKGPSQARITGPGLVRAVVVSGNGEPGQQGRLGNLALET
Ga0306922_1165166113300032001SoilMPRRLIAAALTAGLSITLIVISAMPALAKGPTQARITGPGLDRAIVISGAGEPGQQSR
Ga0318562_1083634123300032008SoilMLRRLTVLTAVAAGMSITAVLTLATPALAKGPSQAHITGPGLAHPIVVGGNGEPGQ
Ga0318563_1024295613300032009SoilMLRKLIAVTTLAIGMSIVAVVTLATPALAKGPSQATITGPGLAHAIVVSGAGEPGQAGPLATLAG
Ga0318569_1028090623300032010SoilMLRRLTVVTALAAGMSLAAALMLATPALAKGPSQARITGPGLAR
Ga0310911_1068085713300032035SoilMLRRLIVLTALAAGMSMAAVLALAAPALAKGPSQARITGPGLAHPIVVSGNGEPGQL
Ga0318549_1007100813300032041SoilMVRRPIVATALAAGMSLAAAITLATPALAKGPSQASITGPGLVH
Ga0318549_1021896813300032041SoilMLRRLLAVIALAAGTSIAAISLATPALAKGPSQASITGPGLAHAIVVSGGGEPG
Ga0318556_1021938223300032043SoilMLRRLTVLTALAAGMSLAAALMLATPALAKGPSQARITGPGLARTIVV
Ga0318570_1001386713300032054SoilMLRRLLAVIALAAGTSIAAISLATPALAKGPSQASITGPGLAHAIVVS
Ga0318570_1046255513300032054SoilMLRRLTVLTAVAAGMSITAVLTLATPALAKGPSQARIAGPGLAHPIVVGGNGEP
Ga0318575_1033991513300032055SoilMLRRLIGVTTLTAGMSVAAAISLATPALAKGPSQA
Ga0318533_1013251433300032059SoilMLRKLIAVTTLAIAMSIAAAVTLATPALAKGPSQATITGPGLAHTIVVSGHGEPGLPGRG
Ga0318504_1016098113300032063SoilMLRRLIVLTALAAGMSMAAVLALAAPALAKGPSQARITGPGLAHPIVVSGNGEPGQLG
Ga0318504_1048407713300032063SoilMLRRLIVVTTLAGSISVAAAISLATPALAKGPSQA
Ga0318510_1054218123300032064SoilMLRRLIILTTLAAGMSVAAAISLATPALAKGPSQASITGPGLVHAIVVSGNGEHRKRVLF
Ga0318513_1038129913300032065SoilMMRRLIVTTALAAGISIAAAITLATPAAAKGPSQARITS
Ga0318514_1001584713300032066SoilMLRRLIVLTTAAAGISIASVLTLAAPALAKGPSQARITGPGLAHPIVV
Ga0318514_1076733113300032066SoilMLRRLIVLTALTAGMTTAAVVALATPALAKGPSQAVITGPGLAHP
Ga0318553_1031431713300032068SoilMLRRLIVTGLAAGMSIAAAITLATPAQAKGPSQARITGPG
Ga0318553_1055074313300032068SoilMLRRLIVVTALAAGMSAAAALSLATPALAKGPSQA
Ga0306924_1135602223300032076SoilMMRRLIVITAFAAGISIAAAITLATPALAKGPSQARITGPGLVHAIVVSG
Ga0318525_1031107323300032089SoilMLRRLIVVTALAAGTGVAAALWLATPALAKGPSQASITGPGLVRAVVVAGN
Ga0318518_1013354133300032090SoilMLRKLIAVTTLAIAMSIAAAVTLATPALAKGPSQATITGPGLAHTIVVSGNG
Ga0318518_1018847013300032090SoilMLRRLIGVTTLTAGMSVAAAISLATPALAKGPSQASITGPGLVHAIVVSDNGEPGQQGTLAVL
Ga0318518_1029815223300032090SoilMLRRLLAVIALAAGTSIAAISLATPALAKGPSQASITGPGLA
Ga0318577_1041437423300032091SoilMMRRLIVTTALAAGISIAAAITLATPAAAKGPSQARITGPGLVHAIVVSGEHGE


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.