Basic Information | |
---|---|
Family ID | F021644 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 218 |
Average Sequence Length | 42 residues |
Representative Sequence | MTNARLRLAFAGETMFPPRAPFFLRTWGTSRFPTPLHGH |
Number of Associated Samples | 159 |
Number of Associated Scaffolds | 218 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 90.74 % |
% of genes near scaffold ends (potentially truncated) | 58.72 % |
% of genes from short scaffolds (< 2000 bps) | 66.51 % |
Associated GOLD sequencing projects | 152 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.20 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (86.239 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (21.560 % of family members) |
Environment Ontology (ENVO) | Unclassified (22.936 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (41.284 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 25.37% β-sheet: 0.00% Coil/Unstructured: 74.63% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.20 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 218 Family Scaffolds |
---|---|---|
PF00005 | ABC_tran | 5.05 |
PF05698 | Trigger_C | 4.13 |
PF02653 | BPD_transp_2 | 3.21 |
PF00528 | BPD_transp_1 | 3.21 |
PF13519 | VWA_2 | 2.75 |
PF01061 | ABC2_membrane | 2.29 |
PF00318 | Ribosomal_S2 | 2.29 |
PF00410 | Ribosomal_S8 | 2.29 |
PF00115 | COX1 | 1.83 |
PF00574 | CLP_protease | 1.83 |
PF07729 | FCD | 1.83 |
PF14520 | HHH_5 | 1.38 |
PF03819 | MazG | 1.38 |
PF01029 | NusB | 1.38 |
PF02911 | Formyl_trans_C | 1.38 |
PF01370 | Epimerase | 1.38 |
PF08352 | oligo_HPY | 1.38 |
PF00941 | FAD_binding_5 | 1.38 |
PF00988 | CPSase_sm_chain | 1.38 |
PF00347 | Ribosomal_L6 | 1.38 |
PF01979 | Amidohydro_1 | 0.92 |
PF01569 | PAP2 | 0.92 |
PF00441 | Acyl-CoA_dh_1 | 0.92 |
PF01032 | FecCD | 0.92 |
PF02075 | RuvC | 0.92 |
PF02569 | Pantoate_ligase | 0.92 |
PF01507 | PAPS_reduct | 0.92 |
PF00730 | HhH-GPD | 0.92 |
PF08666 | SAF | 0.92 |
PF00903 | Glyoxalase | 0.92 |
PF00573 | Ribosomal_L4 | 0.92 |
PF10431 | ClpB_D2-small | 0.92 |
PF00892 | EamA | 0.92 |
PF07650 | KH_2 | 0.92 |
PF00828 | Ribosomal_L27A | 0.92 |
PF01799 | Fer2_2 | 0.46 |
PF02786 | CPSase_L_D2 | 0.46 |
PF04085 | MreC | 0.46 |
PF02781 | G6PD_C | 0.46 |
PF02769 | AIRS_C | 0.46 |
PF13492 | GAF_3 | 0.46 |
PF00924 | MS_channel | 0.46 |
PF13115 | YtkA | 0.46 |
PF02548 | Pantoate_transf | 0.46 |
PF04107 | GCS2 | 0.46 |
PF00764 | Arginosuc_synth | 0.46 |
PF00117 | GATase | 0.46 |
PF00676 | E1_dh | 0.46 |
PF00238 | Ribosomal_L14 | 0.46 |
PF13742 | tRNA_anti_2 | 0.46 |
PF00276 | Ribosomal_L23 | 0.46 |
PF01022 | HTH_5 | 0.46 |
PF01058 | Oxidored_q6 | 0.46 |
PF13242 | Hydrolase_like | 0.46 |
PF13649 | Methyltransf_25 | 0.46 |
PF10397 | ADSL_C | 0.46 |
PF13442 | Cytochrome_CBB3 | 0.46 |
PF00346 | Complex1_49kDa | 0.46 |
PF01476 | LysM | 0.46 |
PF03793 | PASTA | 0.46 |
PF01790 | LGT | 0.46 |
PF00861 | Ribosomal_L18p | 0.46 |
PF02812 | ELFV_dehydrog_N | 0.46 |
PF00496 | SBP_bac_5 | 0.46 |
PF02608 | Bmp | 0.46 |
PF05681 | Fumerase | 0.46 |
PF01042 | Ribonuc_L-PSP | 0.46 |
PF12705 | PDDEXK_1 | 0.46 |
PF09084 | NMT1 | 0.46 |
PF01966 | HD | 0.46 |
PF02625 | XdhC_CoxI | 0.46 |
PF01645 | Glu_synthase | 0.46 |
PF00266 | Aminotran_5 | 0.46 |
PF13478 | XdhC_C | 0.46 |
PF13560 | HTH_31 | 0.46 |
PF01709 | Transcrip_reg | 0.46 |
PF02738 | MoCoBD_1 | 0.46 |
PF10728 | DUF2520 | 0.46 |
PF00202 | Aminotran_3 | 0.46 |
PF01583 | APS_kinase | 0.46 |
PF09587 | PGA_cap | 0.46 |
PF01257 | 2Fe-2S_thioredx | 0.46 |
PF13365 | Trypsin_2 | 0.46 |
PF02670 | DXP_reductoisom | 0.46 |
PF01230 | HIT | 0.46 |
PF11303 | DUF3105 | 0.46 |
PF00682 | HMGL-like | 0.46 |
PF02679 | ComA | 0.46 |
PF05683 | Fumerase_C | 0.46 |
PF02775 | TPP_enzyme_C | 0.46 |
PF01209 | Ubie_methyltran | 0.46 |
PF00156 | Pribosyltran | 0.46 |
PF03572 | Peptidase_S41 | 0.46 |
PF13288 | DXPR_C | 0.46 |
PF01075 | Glyco_transf_9 | 0.46 |
PF02272 | DHHA1 | 0.46 |
PF01967 | MoaC | 0.46 |
PF07499 | RuvA_C | 0.46 |
PF02074 | Peptidase_M32 | 0.46 |
PF04321 | RmlD_sub_bind | 0.46 |
PF13378 | MR_MLE_C | 0.46 |
PF00327 | Ribosomal_L30 | 0.46 |
PF03462 | PCRF | 0.46 |
PF00696 | AA_kinase | 0.46 |
PF01746 | tRNA_m1G_MT | 0.46 |
PF08545 | ACP_syn_III | 0.46 |
PF01040 | UbiA | 0.46 |
PF03719 | Ribosomal_S5_C | 0.46 |
PF13302 | Acetyltransf_3 | 0.46 |
PF13559 | DUF4129 | 0.46 |
PF00890 | FAD_binding_2 | 0.46 |
PF12706 | Lactamase_B_2 | 0.46 |
PF01258 | zf-dskA_traR | 0.46 |
PF02875 | Mur_ligase_C | 0.46 |
PF02779 | Transket_pyr | 0.46 |
COG ID | Name | Functional Category | % Frequency in 218 Family Scaffolds |
---|---|---|---|
COG0544 | FKBP-type peptidyl-prolyl cis-trans isomerase (trigger factor) | Posttranslational modification, protein turnover, chaperones [O] | 4.13 |
COG0616 | Periplasmic serine protease, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 3.67 |
COG0740 | ATP-dependent protease ClpP, protease subunit | Posttranslational modification, protein turnover, chaperones [O] | 3.67 |
COG0505 | Carbamoylphosphate synthase small subunit | Amino acid transport and metabolism [E] | 2.75 |
COG0052 | Ribosomal protein S2 | Translation, ribosomal structure and biogenesis [J] | 2.29 |
COG0096 | Ribosomal protein S8 | Translation, ribosomal structure and biogenesis [J] | 2.29 |
COG1802 | DNA-binding transcriptional regulator, GntR family | Transcription [K] | 1.83 |
COG2186 | DNA-binding transcriptional regulator, FadR family | Transcription [K] | 1.83 |
COG1030 | Membrane-bound serine protease NfeD, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 1.83 |
COG0097 | Ribosomal protein L6P/L9E | Translation, ribosomal structure and biogenesis [J] | 1.38 |
COG0223 | Methionyl-tRNA formyltransferase | Translation, ribosomal structure and biogenesis [J] | 1.38 |
COG1086 | NDP-sugar epimerase, includes UDP-GlcNAc-inverting 4,6-dehydratase FlaA1 and capsular polysaccharide biosynthesis protein EpsC | Cell wall/membrane/envelope biogenesis [M] | 0.92 |
COG1194 | Adenine-specific DNA glycosylase, acts on AG and A-oxoG pairs | Replication, recombination and repair [L] | 0.92 |
COG1727 | Ribosomal protein L18E | Translation, ribosomal structure and biogenesis [J] | 0.92 |
COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.92 |
COG2231 | 3-Methyladenine DNA glycosylase, HhH-GPD/Endo3 superfamily | Replication, recombination and repair [L] | 0.92 |
COG0088 | Ribosomal protein L4 | Translation, ribosomal structure and biogenesis [J] | 0.92 |
COG0122 | 3-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 0.92 |
COG0177 | Endonuclease III | Replication, recombination and repair [L] | 0.92 |
COG0414 | Panthothenate synthetase | Coenzyme transport and metabolism [H] | 0.92 |
COG0451 | Nucleoside-diphosphate-sugar epimerase | Cell wall/membrane/envelope biogenesis [M] | 0.92 |
COG0702 | Uncharacterized conserved protein YbjT, contains NAD(P)-binding and DUF2867 domains | General function prediction only [R] | 0.92 |
COG0817 | Holliday junction resolvasome RuvABC endonuclease subunit RuvC | Replication, recombination and repair [L] | 0.92 |
COG1059 | Thermostable 8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 0.92 |
COG1071 | TPP-dependent pyruvate or acetoin dehydrogenase subunit alpha | Energy production and conversion [C] | 0.46 |
COG1087 | UDP-glucose 4-epimerase | Cell wall/membrane/envelope biogenesis [M] | 0.46 |
COG1088 | dTDP-D-glucose 4,6-dehydratase | Cell wall/membrane/envelope biogenesis [M] | 0.46 |
COG1089 | GDP-D-mannose dehydratase | Cell wall/membrane/envelope biogenesis [M] | 0.46 |
COG1090 | NAD dependent epimerase/dehydratase family enzyme | General function prediction only [R] | 0.46 |
COG1091 | dTDP-4-dehydrorhamnose reductase | Cell wall/membrane/envelope biogenesis [M] | 0.46 |
COG1186 | Protein chain release factor PrfB | Translation, ribosomal structure and biogenesis [J] | 0.46 |
COG1304 | FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomerase | Energy production and conversion [C] | 0.46 |
COG1734 | RNA polymerase-binding transcription factor DksA | Transcription [K] | 0.46 |
COG1740 | Ni,Fe-hydrogenase I small subunit | Energy production and conversion [C] | 0.46 |
COG1744 | Lipoprotein Med, regulator of KinD/Spo0A, PBP1-ABC superfamily, includes NupN | Signal transduction mechanisms [T] | 0.46 |
COG1792 | Cell shape-determining protein MreC | Cell cycle control, cell division, chromosome partitioning [D] | 0.46 |
COG1809 | Phosphosulfolactate synthase, CoM biosynthesis protein A | Coenzyme transport and metabolism [H] | 0.46 |
COG1838 | Tartrate dehydratase beta subunit/Fumarate hydratase class I, C-terminal domain | Energy production and conversion [C] | 0.46 |
COG1841 | Ribosomal protein L30/L7E | Translation, ribosomal structure and biogenesis [J] | 0.46 |
COG1905 | NADH:ubiquinone oxidoreductase 24 kD subunit (chain E) | Energy production and conversion [C] | 0.46 |
COG1941 | Coenzyme F420-reducing hydrogenase, gamma subunit | Energy production and conversion [C] | 0.46 |
COG1951 | Tartrate dehydratase alpha subunit/Fumarate hydratase class I, N-terminal domain | Energy production and conversion [C] | 0.46 |
COG1975 | Molybdoenzyme maturation factor PaoD (Mo cofactor insertion), XdhC/CoxF family | Posttranslational modification, protein turnover, chaperones [O] | 0.46 |
COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 0.46 |
COG2227 | 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase | Coenzyme transport and metabolism [H] | 0.46 |
COG2317 | Zn-dependent carboxypeptidase, M32 family | Posttranslational modification, protein turnover, chaperones [O] | 0.46 |
COG3260 | Ni,Fe-hydrogenase III small subunit | Energy production and conversion [C] | 0.46 |
COG3261 | Ni,Fe-hydrogenase III large subunit | Energy production and conversion [C] | 0.46 |
COG3264 | Small-conductance mechanosensitive channel MscK | Cell wall/membrane/envelope biogenesis [M] | 0.46 |
COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.46 |
COG0069 | Glutamate synthase domain 2 | Amino acid transport and metabolism [E] | 0.46 |
COG0089 | Ribosomal protein L23 | Translation, ribosomal structure and biogenesis [J] | 0.46 |
COG0093 | Ribosomal protein L14 | Translation, ribosomal structure and biogenesis [J] | 0.46 |
COG0098 | Ribosomal protein S5 | Translation, ribosomal structure and biogenesis [J] | 0.46 |
COG0137 | Argininosuccinate synthase | Amino acid transport and metabolism [E] | 0.46 |
COG0216 | Protein chain release factor RF1 | Translation, ribosomal structure and biogenesis [J] | 0.46 |
COG0217 | Transcriptional and/or translational regulatory protein YebC/TACO1 | Translation, ribosomal structure and biogenesis [J] | 0.46 |
COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 0.46 |
COG0256 | Ribosomal protein L18 | Translation, ribosomal structure and biogenesis [J] | 0.46 |
COG0315 | Molybdenum cofactor biosynthesis enzyme MoaC | Coenzyme transport and metabolism [H] | 0.46 |
COG0334 | Glutamate dehydrogenase/leucine dehydrogenase | Amino acid transport and metabolism [E] | 0.46 |
COG0364 | Glucose-6-phosphate 1-dehydrogenase | Carbohydrate transport and metabolism [G] | 0.46 |
COG0377 | NADH:ubiquinone oxidoreductase 20 kD subunit (chain B) or related Fe-S oxidoreductase | Energy production and conversion [C] | 0.46 |
COG0413 | Ketopantoate hydroxymethyltransferase | Coenzyme transport and metabolism [H] | 0.46 |
COG0529 | Adenylylsulfate kinase or related kinase | Inorganic ion transport and metabolism [P] | 0.46 |
COG0567 | 2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, and related enzymes | Energy production and conversion [C] | 0.46 |
COG0632 | Holliday junction resolvasome RuvABC DNA-binding subunit | Replication, recombination and repair [L] | 0.46 |
COG0649 | NADH:ubiquinone oxidoreductase 49 kD subunit (chain D) | Energy production and conversion [C] | 0.46 |
COG0668 | Small-conductance mechanosensitive channel | Cell wall/membrane/envelope biogenesis [M] | 0.46 |
COG0682 | Prolipoprotein diacylglyceryltransferase | Cell wall/membrane/envelope biogenesis [M] | 0.46 |
COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.46 |
COG0743 | 1-deoxy-D-xylulose 5-phosphate reductoisomerase | Lipid transport and metabolism [I] | 0.46 |
COG0793 | C-terminal processing protease CtpA/Prc, contains a PDZ domain | Posttranslational modification, protein turnover, chaperones [O] | 0.46 |
COG0859 | ADP-heptose:LPS heptosyltransferase | Cell wall/membrane/envelope biogenesis [M] | 0.46 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 87.16 % |
Unclassified | root | N/A | 12.84 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000364|INPhiseqgaiiFebDRAFT_100352406 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 549 | Open in IMG/M |
3300000858|JGI10213J12805_10425962 | Not Available | 1137 | Open in IMG/M |
3300000891|JGI10214J12806_10219592 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1137 | Open in IMG/M |
3300000956|JGI10216J12902_107263803 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 783 | Open in IMG/M |
3300002124|C687J26631_10158208 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
3300002124|C687J26631_10215128 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 638 | Open in IMG/M |
3300003993|Ga0055468_10266899 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 542 | Open in IMG/M |
3300004156|Ga0062589_101213612 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 723 | Open in IMG/M |
3300004463|Ga0063356_105840153 | Not Available | 528 | Open in IMG/M |
3300005166|Ga0066674_10072734 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1576 | Open in IMG/M |
3300005168|Ga0066809_10008881 | All Organisms → cellular organisms → Bacteria | 1845 | Open in IMG/M |
3300005180|Ga0066685_10239867 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1249 | Open in IMG/M |
3300005328|Ga0070676_11164285 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 585 | Open in IMG/M |
3300005355|Ga0070671_100384928 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1199 | Open in IMG/M |
3300005558|Ga0066698_10199856 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1367 | Open in IMG/M |
3300006046|Ga0066652_100016276 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 4977 | Open in IMG/M |
3300006048|Ga0075363_100943866 | Not Available | 530 | Open in IMG/M |
3300006049|Ga0075417_10004587 | All Organisms → cellular organisms → Bacteria | 4585 | Open in IMG/M |
3300006058|Ga0075432_10007643 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3688 | Open in IMG/M |
3300006169|Ga0082029_1023334 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5598 | Open in IMG/M |
3300006169|Ga0082029_1371744 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3719 | Open in IMG/M |
3300006358|Ga0068871_100284445 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium | 1447 | Open in IMG/M |
3300006572|Ga0074051_10007391 | All Organisms → cellular organisms → Bacteria | 2862 | Open in IMG/M |
3300006577|Ga0074050_12037263 | All Organisms → cellular organisms → Bacteria | 2287 | Open in IMG/M |
3300006581|Ga0074048_13405087 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1012 | Open in IMG/M |
3300006796|Ga0066665_10427044 | All Organisms → cellular organisms → Bacteria | 1095 | Open in IMG/M |
3300006847|Ga0075431_100419441 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1338 | Open in IMG/M |
3300006852|Ga0075433_10108987 | All Organisms → cellular organisms → Bacteria | 2457 | Open in IMG/M |
3300006853|Ga0075420_100013898 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 7182 | Open in IMG/M |
3300006853|Ga0075420_100314066 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1358 | Open in IMG/M |
3300006880|Ga0075429_100517468 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1046 | Open in IMG/M |
3300007004|Ga0079218_10934247 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 858 | Open in IMG/M |
3300009087|Ga0105107_11149319 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 541 | Open in IMG/M |
3300009090|Ga0099827_10218847 | All Organisms → cellular organisms → Bacteria | 1590 | Open in IMG/M |
3300009094|Ga0111539_12496450 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 599 | Open in IMG/M |
3300009098|Ga0105245_12365965 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
3300009100|Ga0075418_10018521 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 7691 | Open in IMG/M |
3300009100|Ga0075418_10543497 | All Organisms → cellular organisms → Bacteria | 1248 | Open in IMG/M |
3300009100|Ga0075418_11067987 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 874 | Open in IMG/M |
3300009156|Ga0111538_10962098 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1080 | Open in IMG/M |
3300009807|Ga0105061_1087791 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 528 | Open in IMG/M |
3300010323|Ga0134086_10430200 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 535 | Open in IMG/M |
3300010325|Ga0134064_10108514 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 921 | Open in IMG/M |
3300010335|Ga0134063_10187656 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 969 | Open in IMG/M |
3300011432|Ga0137428_1257972 | Not Available | 514 | Open in IMG/M |
3300011440|Ga0137433_1212772 | Not Available | 633 | Open in IMG/M |
3300012045|Ga0136623_10054680 | All Organisms → cellular organisms → Bacteria | 1742 | Open in IMG/M |
3300012045|Ga0136623_10126562 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1111 | Open in IMG/M |
3300012045|Ga0136623_10149121 | All Organisms → cellular organisms → Bacteria | 1014 | Open in IMG/M |
3300012091|Ga0136625_1002817 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 6335 | Open in IMG/M |
3300012091|Ga0136625_1011906 | All Organisms → cellular organisms → Bacteria | 3237 | Open in IMG/M |
3300012092|Ga0136621_1000916 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 11785 | Open in IMG/M |
3300012092|Ga0136621_1003415 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 6611 | Open in IMG/M |
3300012092|Ga0136621_1004500 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 5787 | Open in IMG/M |
3300012092|Ga0136621_1007191 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4597 | Open in IMG/M |
3300012093|Ga0136632_10050996 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1906 | Open in IMG/M |
3300012186|Ga0136620_10050091 | All Organisms → cellular organisms → Bacteria | 1962 | Open in IMG/M |
3300012187|Ga0136622_10000163 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 25099 | Open in IMG/M |
3300012187|Ga0136622_10003127 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 6960 | Open in IMG/M |
3300012201|Ga0137365_10007695 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 8606 | Open in IMG/M |
3300012201|Ga0137365_10128354 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1906 | Open in IMG/M |
3300012527|Ga0136633_1022952 | All Organisms → cellular organisms → Bacteria | 3071 | Open in IMG/M |
3300012527|Ga0136633_1087850 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1276 | Open in IMG/M |
3300012679|Ga0136616_10023224 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3088 | Open in IMG/M |
3300012679|Ga0136616_10092584 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1430 | Open in IMG/M |
3300012680|Ga0136612_10001245 | All Organisms → cellular organisms → Bacteria | 10711 | Open in IMG/M |
3300012681|Ga0136613_10000803 | All Organisms → cellular organisms → Bacteria | 15257 | Open in IMG/M |
3300012681|Ga0136613_10013034 | All Organisms → cellular organisms → Bacteria | 4713 | Open in IMG/M |
3300012681|Ga0136613_10678162 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 551 | Open in IMG/M |
3300012951|Ga0164300_10489259 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 700 | Open in IMG/M |
3300014268|Ga0075309_1024925 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1293 | Open in IMG/M |
3300014271|Ga0075326_1283057 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 516 | Open in IMG/M |
3300014302|Ga0075310_1135319 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 550 | Open in IMG/M |
3300014311|Ga0075322_1099328 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → Gaiella occulta | 679 | Open in IMG/M |
3300015077|Ga0173483_10010541 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 3153 | Open in IMG/M |
3300015170|Ga0120098_1029077 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 719 | Open in IMG/M |
3300015201|Ga0173478_10332364 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 702 | Open in IMG/M |
3300015371|Ga0132258_10014418 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 16808 | Open in IMG/M |
3300015371|Ga0132258_10029650 | All Organisms → cellular organisms → Bacteria | 12192 | Open in IMG/M |
3300015371|Ga0132258_11016511 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2095 | Open in IMG/M |
3300015371|Ga0132258_11352726 | All Organisms → cellular organisms → Bacteria | 1799 | Open in IMG/M |
3300015372|Ga0132256_102560199 | Not Available | 611 | Open in IMG/M |
3300015373|Ga0132257_101352243 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 905 | Open in IMG/M |
3300015374|Ga0132255_103073769 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 712 | Open in IMG/M |
3300017787|Ga0183260_10001593 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 18846 | Open in IMG/M |
3300017787|Ga0183260_10007150 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 8704 | Open in IMG/M |
3300017787|Ga0183260_10011058 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 6968 | Open in IMG/M |
3300017787|Ga0183260_10034578 | All Organisms → cellular organisms → Bacteria | 3800 | Open in IMG/M |
3300017787|Ga0183260_10047839 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 3185 | Open in IMG/M |
3300017787|Ga0183260_10207039 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1372 | Open in IMG/M |
3300017789|Ga0136617_10034061 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 4533 | Open in IMG/M |
3300017789|Ga0136617_10070730 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 3053 | Open in IMG/M |
3300017789|Ga0136617_10138768 | Not Available | 2082 | Open in IMG/M |
3300017965|Ga0190266_10260842 | Not Available | 876 | Open in IMG/M |
3300017994|Ga0187822_10356793 | Not Available | 529 | Open in IMG/M |
3300018053|Ga0184626_10098977 | All Organisms → cellular organisms → Bacteria | 1235 | Open in IMG/M |
3300018056|Ga0184623_10434324 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
3300018063|Ga0184637_10707352 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 550 | Open in IMG/M |
3300018074|Ga0184640_10474610 | Not Available | 554 | Open in IMG/M |
3300018077|Ga0184633_10018190 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 3446 | Open in IMG/M |
3300018077|Ga0184633_10252442 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 906 | Open in IMG/M |
3300018077|Ga0184633_10303217 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 814 | Open in IMG/M |
3300018082|Ga0184639_10394819 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 715 | Open in IMG/M |
3300018422|Ga0190265_10025996 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. URHD0082 | 4772 | Open in IMG/M |
3300018422|Ga0190265_10187836 | All Organisms → cellular organisms → Bacteria | 2064 | Open in IMG/M |
3300018422|Ga0190265_10560451 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus | 1259 | Open in IMG/M |
3300018422|Ga0190265_10626468 | All Organisms → cellular organisms → Bacteria | 1195 | Open in IMG/M |
3300018429|Ga0190272_10655102 | All Organisms → cellular organisms → Bacteria | 934 | Open in IMG/M |
3300018429|Ga0190272_12465681 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium | 565 | Open in IMG/M |
3300018431|Ga0066655_10050717 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2137 | Open in IMG/M |
3300018466|Ga0190268_11256667 | Not Available | 620 | Open in IMG/M |
3300018466|Ga0190268_11291717 | Not Available | 614 | Open in IMG/M |
3300018469|Ga0190270_10026459 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3698 | Open in IMG/M |
3300018481|Ga0190271_10060155 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3294 | Open in IMG/M |
3300019377|Ga0190264_10486718 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 838 | Open in IMG/M |
3300019884|Ga0193741_1037041 | All Organisms → cellular organisms → Bacteria | 1259 | Open in IMG/M |
3300020016|Ga0193696_1007007 | All Organisms → cellular organisms → Bacteria | 3096 | Open in IMG/M |
3300020020|Ga0193738_1001368 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 9947 | Open in IMG/M |
3300020020|Ga0193738_1018896 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 2184 | Open in IMG/M |
3300020020|Ga0193738_1048560 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1284 | Open in IMG/M |
3300020020|Ga0193738_1053457 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1216 | Open in IMG/M |
3300021073|Ga0210378_10377187 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 527 | Open in IMG/M |
3300021445|Ga0182009_10671690 | Not Available | 559 | Open in IMG/M |
3300021972|Ga0193737_1066114 | Not Available | 509 | Open in IMG/M |
3300022756|Ga0222622_10434736 | All Organisms → cellular organisms → Bacteria | 929 | Open in IMG/M |
3300022756|Ga0222622_11102467 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
3300022901|Ga0247788_1000961 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4294 | Open in IMG/M |
3300022915|Ga0247790_10011368 | All Organisms → cellular organisms → Bacteria | 1818 | Open in IMG/M |
3300023102|Ga0247754_1136019 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 606 | Open in IMG/M |
3300023266|Ga0247789_1101381 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 573 | Open in IMG/M |
3300025001|Ga0209618_1049493 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter crystallopoietes → Arthrobacter crystallopoietes BAB-32 | 662 | Open in IMG/M |
3300025002|Ga0209001_1004234 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 2662 | Open in IMG/M |
3300025159|Ga0209619_10177426 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1208 | Open in IMG/M |
3300025310|Ga0209172_10301549 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
3300025318|Ga0209519_10049507 | All Organisms → cellular organisms → Bacteria | 2380 | Open in IMG/M |
3300025318|Ga0209519_10557453 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 636 | Open in IMG/M |
3300025319|Ga0209520_10191204 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → unclassified Symbiodinium → Symbiodinium sp. KB8 | 1290 | Open in IMG/M |
3300025324|Ga0209640_10043535 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 3905 | Open in IMG/M |
3300025324|Ga0209640_10045782 | All Organisms → cellular organisms → Bacteria | 3806 | Open in IMG/M |
3300025559|Ga0210087_1002555 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4251 | Open in IMG/M |
3300025559|Ga0210087_1094131 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 589 | Open in IMG/M |
3300025559|Ga0210087_1105821 | Not Available | 550 | Open in IMG/M |
3300025567|Ga0210076_1046065 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 942 | Open in IMG/M |
3300025791|Ga0210115_1051771 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 874 | Open in IMG/M |
3300025791|Ga0210115_1087178 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 639 | Open in IMG/M |
3300025913|Ga0207695_10006635 | All Organisms → cellular organisms → Bacteria | 14944 | Open in IMG/M |
3300025949|Ga0207667_11094514 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
3300026029|Ga0208002_1016682 | Not Available | 709 | Open in IMG/M |
3300026032|Ga0208419_1024678 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → Gaiella occulta | 690 | Open in IMG/M |
3300026071|Ga0208537_1046294 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 522 | Open in IMG/M |
3300026535|Ga0256867_10093272 | All Organisms → cellular organisms → Bacteria | 1167 | Open in IMG/M |
3300026856|Ga0209852_1014094 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 514 | Open in IMG/M |
3300027523|Ga0208890_1040218 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 724 | Open in IMG/M |
3300027523|Ga0208890_1059115 | Not Available | 616 | Open in IMG/M |
3300027561|Ga0209887_1014478 | All Organisms → cellular organisms → Bacteria | 1984 | Open in IMG/M |
3300027561|Ga0209887_1114599 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 537 | Open in IMG/M |
3300027577|Ga0209874_1003910 | All Organisms → cellular organisms → Bacteria | 4511 | Open in IMG/M |
3300027638|Ga0208612_1006853 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 4197 | Open in IMG/M |
3300027638|Ga0208612_1040467 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Propionibacteriaceae → Propioniciclava → Propioniciclava tarda | 1374 | Open in IMG/M |
3300027873|Ga0209814_10002855 | All Organisms → cellular organisms → Bacteria | 6385 | Open in IMG/M |
3300027882|Ga0209590_10175281 | All Organisms → cellular organisms → Bacteria | 1344 | Open in IMG/M |
3300027907|Ga0207428_10042787 | All Organisms → cellular organisms → Bacteria | 3662 | Open in IMG/M |
3300027909|Ga0209382_10413535 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1500 | Open in IMG/M |
3300027952|Ga0209889_1035139 | All Organisms → cellular organisms → Bacteria | 1083 | Open in IMG/M |
3300027954|Ga0209859_1012675 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1587 | Open in IMG/M |
(restricted) 3300027995|Ga0233418_10049850 | Not Available | 1163 | Open in IMG/M |
(restricted) 3300028043|Ga0233417_10102613 | Not Available | 1204 | Open in IMG/M |
3300028708|Ga0307295_10053370 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1046 | Open in IMG/M |
3300028718|Ga0307307_10160927 | Not Available | 703 | Open in IMG/M |
3300028754|Ga0307297_10176152 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 739 | Open in IMG/M |
3300028768|Ga0307280_10088354 | All Organisms → cellular organisms → Bacteria | 1017 | Open in IMG/M |
3300028782|Ga0307306_10220983 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 547 | Open in IMG/M |
3300028784|Ga0307282_10058165 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1737 | Open in IMG/M |
3300028787|Ga0307323_10177423 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
3300028793|Ga0307299_10110892 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1028 | Open in IMG/M |
3300028807|Ga0307305_10044587 | All Organisms → cellular organisms → Bacteria | 2042 | Open in IMG/M |
3300028812|Ga0247825_10066052 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2415 | Open in IMG/M |
3300028814|Ga0307302_10502412 | Not Available | 602 | Open in IMG/M |
3300028819|Ga0307296_10006723 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6025 | Open in IMG/M |
3300028819|Ga0307296_10140257 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1303 | Open in IMG/M |
3300028875|Ga0307289_10189358 | Not Available | 846 | Open in IMG/M |
3300028884|Ga0307308_10563192 | Not Available | 546 | Open in IMG/M |
3300028885|Ga0307304_10582689 | Not Available | 517 | Open in IMG/M |
3300030006|Ga0299907_10002665 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 11127 | Open in IMG/M |
3300030006|Ga0299907_10003005 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 10672 | Open in IMG/M |
3300030006|Ga0299907_10013579 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5925 | Open in IMG/M |
3300030006|Ga0299907_10038742 | All Organisms → cellular organisms → Bacteria | 3740 | Open in IMG/M |
3300030006|Ga0299907_10089161 | All Organisms → cellular organisms → Bacteria | 2519 | Open in IMG/M |
3300030006|Ga0299907_10165435 | All Organisms → cellular organisms → Bacteria | 1828 | Open in IMG/M |
3300030006|Ga0299907_10623189 | All Organisms → cellular organisms → Bacteria | 836 | Open in IMG/M |
3300030006|Ga0299907_11207786 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
3300030336|Ga0247826_11385350 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 568 | Open in IMG/M |
3300030606|Ga0299906_10011467 | All Organisms → cellular organisms → Bacteria | 7123 | Open in IMG/M |
3300031229|Ga0299913_10974301 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
3300031576|Ga0247727_10009267 | All Organisms → cellular organisms → Bacteria | 17918 | Open in IMG/M |
3300031576|Ga0247727_10118533 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2685 | Open in IMG/M |
3300031858|Ga0310892_11345824 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 512 | Open in IMG/M |
3300031873|Ga0315297_10078056 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 2581 | Open in IMG/M |
3300031908|Ga0310900_10299087 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1182 | Open in IMG/M |
3300031908|Ga0310900_10718943 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 801 | Open in IMG/M |
3300031908|Ga0310900_11163563 | Not Available | 640 | Open in IMG/M |
3300031949|Ga0214473_10944297 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 916 | Open in IMG/M |
3300031962|Ga0307479_10055603 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3811 | Open in IMG/M |
3300032000|Ga0310903_10767012 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
3300032013|Ga0310906_10422180 | All Organisms → cellular organisms → Bacteria | 886 | Open in IMG/M |
3300032075|Ga0310890_10015128 | All Organisms → cellular organisms → Bacteria | 3801 | Open in IMG/M |
3300032075|Ga0310890_10517505 | Not Available | 910 | Open in IMG/M |
3300032122|Ga0310895_10189815 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 916 | Open in IMG/M |
3300032143|Ga0315292_10015175 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5106 | Open in IMG/M |
3300033233|Ga0334722_10270616 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1244 | Open in IMG/M |
3300033551|Ga0247830_10277735 | All Organisms → cellular organisms → Bacteria | 1277 | Open in IMG/M |
3300033813|Ga0364928_0099161 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 684 | Open in IMG/M |
3300034115|Ga0364945_0062605 | All Organisms → cellular organisms → Bacteria | 1053 | Open in IMG/M |
3300034115|Ga0364945_0122351 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 771 | Open in IMG/M |
3300034164|Ga0364940_0035307 | All Organisms → cellular organisms → Bacteria | 1312 | Open in IMG/M |
3300034664|Ga0314786_182227 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium | 511 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 21.56% |
Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 13.76% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 6.88% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.96% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 5.96% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.13% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 4.13% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.67% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 3.21% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 3.21% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.75% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 2.29% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.83% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.83% |
Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 1.83% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.83% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.38% |
Polar Desert | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert | 0.92% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.92% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.92% |
Termite Nest | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest | 0.92% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.92% |
Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.92% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.46% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.46% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.46% |
Hot Spring Sediment | Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment | 0.46% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.46% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.46% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.46% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.46% |
Fossill | Environmental → Terrestrial → Soil → Fossil → Unclassified → Fossill | 0.46% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.46% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.46% |
Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.46% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.46% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.46% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.46% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.46% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.46% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.46% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000858 | Soil microbial communities from Great Prairies - Wisconsin Native Prairie soil | Environmental | Open in IMG/M |
3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300002124 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_3 | Environmental | Open in IMG/M |
3300003993 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2 | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
3300005168 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPC | Environmental | Open in IMG/M |
3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006048 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Host-Associated | Open in IMG/M |
3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
3300006169 | Termite nest microbial communities from Madurai, India | Environmental | Open in IMG/M |
3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
3300006572 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006577 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006581 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
3300009087 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009807 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_0_10 | Environmental | Open in IMG/M |
3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
3300011432 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT718_2 | Environmental | Open in IMG/M |
3300011440 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT840_2 | Environmental | Open in IMG/M |
3300012045 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ449 (21.06) | Environmental | Open in IMG/M |
3300012091 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ483 (23.06) | Environmental | Open in IMG/M |
3300012092 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ445A (23.06) | Environmental | Open in IMG/M |
3300012093 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ611 (21.06) | Environmental | Open in IMG/M |
3300012186 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ416 (21.06) | Environmental | Open in IMG/M |
3300012187 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ448 (21.06) | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012527 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ83 (22.06) | Environmental | Open in IMG/M |
3300012679 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ299 (21.06) | Environmental | Open in IMG/M |
3300012680 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ224A (23.06) | Environmental | Open in IMG/M |
3300012681 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ272 (21.06) | Environmental | Open in IMG/M |
3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
3300014259 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailB_D1 | Environmental | Open in IMG/M |
3300014268 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailA_D1 | Environmental | Open in IMG/M |
3300014271 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailA_D2 | Environmental | Open in IMG/M |
3300014302 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailA_D2 | Environmental | Open in IMG/M |
3300014311 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D1 | Environmental | Open in IMG/M |
3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
3300015170 | Fossil microbial communities from human bone sample from Teposcolula Yucundaa, Mexico - TP48 | Environmental | Open in IMG/M |
3300015201 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2) | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300017787 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ497 (22.06) (version 2) | Environmental | Open in IMG/M |
3300017789 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ322 (21.06) | Environmental | Open in IMG/M |
3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
3300019884 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2s2 | Environmental | Open in IMG/M |
3300020016 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m1 | Environmental | Open in IMG/M |
3300020020 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a1 | Environmental | Open in IMG/M |
3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
3300021972 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2m2 | Environmental | Open in IMG/M |
3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
3300022901 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S156-409C-4 | Environmental | Open in IMG/M |
3300022915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S171-409R-4 | Environmental | Open in IMG/M |
3300023102 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S184-509B-5 | Environmental | Open in IMG/M |
3300023266 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S220-509R-4 | Environmental | Open in IMG/M |
3300025001 | Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 3 (SPAdes) | Environmental | Open in IMG/M |
3300025002 | Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 2 (SPAdes) | Environmental | Open in IMG/M |
3300025159 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 3 | Environmental | Open in IMG/M |
3300025310 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025318 | Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 1 | Environmental | Open in IMG/M |
3300025319 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 1 | Environmental | Open in IMG/M |
3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
3300025559 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025567 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025791 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026029 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailA_D2 (SPAdes) | Environmental | Open in IMG/M |
3300026032 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailA_D1 (SPAdes) | Environmental | Open in IMG/M |
3300026062 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D1 (SPAdes) | Environmental | Open in IMG/M |
3300026071 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_TuleA_D1 (SPAdes) | Environmental | Open in IMG/M |
3300026535 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (HiSeq) | Environmental | Open in IMG/M |
3300026856 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_40_50 (SPAdes) | Environmental | Open in IMG/M |
3300027523 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPA (SPAdes) | Environmental | Open in IMG/M |
3300027561 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40 (SPAdes) | Environmental | Open in IMG/M |
3300027577 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 (SPAdes) | Environmental | Open in IMG/M |
3300027638 | Polar desert microbial communities from Antarctic Dry Valleys - UQ889 (SPAdes) | Environmental | Open in IMG/M |
3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300027952 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10 (SPAdes) | Environmental | Open in IMG/M |
3300027954 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_50_60 (SPAdes) | Environmental | Open in IMG/M |
3300027995 (restricted) | Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_1_MG | Environmental | Open in IMG/M |
3300028043 (restricted) | Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_0.5_MG | Environmental | Open in IMG/M |
3300028708 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152 | Environmental | Open in IMG/M |
3300028718 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194 | Environmental | Open in IMG/M |
3300028754 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_157 | Environmental | Open in IMG/M |
3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
3300028782 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_193 | Environmental | Open in IMG/M |
3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
3300028812 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48 | Environmental | Open in IMG/M |
3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
3300030606 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT145D125 | Environmental | Open in IMG/M |
3300031229 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 | Environmental | Open in IMG/M |
3300031576 | Biofilm microbial communities from Wishing Well Cave, Virginia, United States - WW16-25 | Environmental | Open in IMG/M |
3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
3300031873 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0 | Environmental | Open in IMG/M |
3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032000 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3 | Environmental | Open in IMG/M |
3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
3300032122 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4 | Environmental | Open in IMG/M |
3300032143 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0 | Environmental | Open in IMG/M |
3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
3300033813 | Sediment microbial communities from East River floodplain, Colorado, United States - 30_j17 | Environmental | Open in IMG/M |
3300034115 | Sediment microbial communities from East River floodplain, Colorado, United States - 29_s17 | Environmental | Open in IMG/M |
3300034164 | Sediment microbial communities from East River floodplain, Colorado, United States - 14_s17 | Environmental | Open in IMG/M |
3300034664 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
INPhiseqgaiiFebDRAFT_1003524061 | 3300000364 | Soil | VSTARLRLAVAGETMFPPRGPLLLTTWGTSRFPAPLHA |
JGI10213J12805_104259622 | 3300000858 | Soil | VSTAHPRLAVAGETMFPPRAPFFWKTWGTSRFPTPLP |
JGI10214J12806_102195921 | 3300000891 | Soil | MSNARPGLAFVGETVSPPRAPFFSKAWGTSRFPTPL |
JGI10216J12902_1072638033 | 3300000956 | Soil | MSVVRLRLAPMGETMFPPRAPFLSRAWGTSRFPTPLPAH |
C687J26631_101582082 | 3300002124 | Soil | MTNAHLRLAFVEETMFPSSAPFLRTWGTSRFPTPLPAHG |
C687J26631_102151281 | 3300002124 | Soil | MSNAPLRLAFTGETMFPPCAPFFLRAWGTSRFTTPL |
Ga0055468_102668992 | 3300003993 | Natural And Restored Wetlands | MTNARLRLAFAGETRFPPHAPFFWETWGTSRFPTPLPAQRSEADR* |
Ga0062589_1012136121 | 3300004156 | Soil | MSTTCLRLVVAGETLFSPRAPFSSRTWGTSRFPTPLHAHRATKVA |
Ga0063356_1058401531 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MTARPQLAVVGETMFPPRAPFFLKPRETSRFPAPLPRHEPRS |
Ga0066674_100727343 | 3300005166 | Soil | MTNARLWLAFAGETMFPPRIPLLLKTWGTSRFPTTLHAPGPETGP* |
Ga0066809_100088813 | 3300005168 | Soil | MTNARLRLAFAGETMFPPRAPFFLRGWGTSRFPRAWGTSRFPTLLPAHRPTEVGR* |
Ga0066685_102398672 | 3300005180 | Soil | MTNARLWLAFAGETMFPTRIPLLLKTWGTSRFPTPLHAPGPETGP* |
Ga0070676_111642852 | 3300005328 | Miscanthus Rhizosphere | MSIDSLRKSIAEETMFPPRTPFFPTARGTSRFPTPLPAHAKEAFA* |
Ga0070671_1003849283 | 3300005355 | Switchgrass Rhizosphere | RGRRMSNARIRLAFVGETMFPPRDPLLLNVWGTSRFPTPLPAPASTEVAA* |
Ga0066698_101998563 | 3300005558 | Soil | MSNARLRLAFVGETMFPPRGPLLLNPWGTSRFPTPF |
Ga0066652_10001627610 | 3300006046 | Soil | MTNARLWLAFAGETMFPTRIPLLLKTWGTSRFPTPLHAPAPETGP* |
Ga0075363_1009438662 | 3300006048 | Populus Endosphere | VSTARLRLAVAGETMFPPRAPFFLRAWGTSRFPTPL |
Ga0075417_100045872 | 3300006049 | Populus Rhizosphere | MTTARLQLALAGETVFPPGAWFVSRAWGPFRFPTPLPDHGPKAGP* |
Ga0075432_100076432 | 3300006058 | Populus Rhizosphere | MTTARLRLALVGETVFPPGAWFVSRAWGPFRFPTPLPDHGPKAGP* |
Ga0082029_10233347 | 3300006169 | Termite Nest | MNNAHLRLAFAGETMSPPCAPFFRRAWGTSRFPTPLPAHEREART* |
Ga0082029_13717446 | 3300006169 | Termite Nest | MSNARLQLAFAGATMFLPRTPFFLTPRGTSRFRAPFPAHRVGDTR* |
Ga0068871_1002844452 | 3300006358 | Miscanthus Rhizosphere | MSTARLQLAFAGETMFPPRAPFFLKTWGTSRFPTPLPA |
Ga0074051_100073914 | 3300006572 | Soil | MSNVRLWLPFMGETMFPPCAPFFLTSWETSRFPTPLHAHDAEDGS* |
Ga0074050_120372631 | 3300006577 | Soil | VTTARLQLAVAGETMFPPRAPFFWRTWGTSRFPTPLH |
Ga0074048_134050871 | 3300006581 | Soil | MTNARLRLAFTGETMFPPRAPFFLRAWGTSRFPTPL |
Ga0066665_104270441 | 3300006796 | Soil | MTNARLWLAFAGETMFPTGIPLLLKTWGTSRFPTPLHAPGPETGP* |
Ga0075431_1004194413 | 3300006847 | Populus Rhizosphere | MSTARLRLPITGETMFPPWAPFFLRTWGTSRFPTPLPA |
Ga0075433_101089874 | 3300006852 | Populus Rhizosphere | MNNARLRLAFAGETMFPPRAPFFLRAWGTSRFPTPFPTHAPRSGA* |
Ga0075420_1000138981 | 3300006853 | Populus Rhizosphere | MSNAHLPLAFAGETMFPPRAPFFLRTRGTSRFPIPL |
Ga0075420_1003140661 | 3300006853 | Populus Rhizosphere | MSTARLRLPVTVETMFPPWAPFFLRTWGTSRFPTPLPA |
Ga0075429_1005174681 | 3300006880 | Populus Rhizosphere | MSTARLRLPVTVETMFPPWAPFFLRTWGTSRFPTPLPAH |
Ga0079218_109342472 | 3300007004 | Agricultural Soil | MSNARPELAFAGETMFPPRTPFFSKSWETSRFPTPLPAHRPETGR* |
Ga0105107_111493191 | 3300009087 | Freshwater Sediment | MSNARPGLAFAGETMSPPRAPFFSKAWGTSRFPTPLPAHESEADS* |
Ga0099827_102188471 | 3300009090 | Vadose Zone Soil | MSIVRVPQTIVGATMFPPRTPFFLGARGTSRFPTPLLAH |
Ga0111539_124964501 | 3300009094 | Populus Rhizosphere | MTTLASRLAFAGETVFPTRAPSLWRTWGTSRFPTPLH |
Ga0105245_123659652 | 3300009098 | Miscanthus Rhizosphere | MSIDSLRKSIAEETMFPPRTPFFPTARGTSRFPTPLPAHAPTKVGA* |
Ga0075418_100185217 | 3300009100 | Populus Rhizosphere | MTTARLRLALVGETVFPPRAWFFSRAWGPFRFPTPLPDHGPKAGP* |
Ga0075418_105434973 | 3300009100 | Populus Rhizosphere | VSTARFRLAVAGETMFPPRAPFFPKAWGTSRFPTPLH |
Ga0075418_110679871 | 3300009100 | Populus Rhizosphere | MTTARLRLAVVGETMFPPRAPFFLKPRETSRFPAPLP |
Ga0111538_109620981 | 3300009156 | Populus Rhizosphere | MTDARLRLALAGATMFPPRAPFFLETWGTSRFPTPLPAP |
Ga0105061_10877913 | 3300009807 | Groundwater Sand | MSNARLRLAFAWETMFPPRAPFFLKAWGTSRFPTPL |
Ga0134086_104302001 | 3300010323 | Grasslands Soil | MSTARLRLAIVRETMLPPRAPFFLRAWGTFRFPTPLHAHRP |
Ga0134064_101085143 | 3300010325 | Grasslands Soil | LAFAGETMFPPRIPLLLKTWGTSRFPTTLHAPGPETGP* |
Ga0134063_101876561 | 3300010335 | Grasslands Soil | MTNARLWLAFAGETMFPTRIPLLLKTWGTSRFPTPLHA |
Ga0137428_12579721 | 3300011432 | Soil | MTLTRLRLALPAKEIRETVFPPRTPFFWKAWGTSRFPTPLH |
Ga0137433_12127722 | 3300011440 | Soil | MNNTRLRLAFTGETMFPPCAPFFSRTFGNSPFPPPPPLHLPGAGLIKRSH |
Ga0136623_100546803 | 3300012045 | Polar Desert Sand | AMSNARLRLAFTGETMFPPCTPFFLKTWGTFRFPTPLHAHGQETCP* |
Ga0136623_101265621 | 3300012045 | Polar Desert Sand | MNARLQLAFAGETMFPPRAPFFLKAWGTSRFPTPLH |
Ga0136623_101491212 | 3300012045 | Polar Desert Sand | MTNARLRLAFAEETMFPPRAPFFLRAWGTSRFPTPL |
Ga0136625_10028175 | 3300012091 | Polar Desert Sand | MNIVRLRQTIAGETMFPPRAPFFSRAWGTSRFPTPLHAHGPNTGP* |
Ga0136625_10119062 | 3300012091 | Polar Desert Sand | MSNARLRLAFTGETMFPPCTPFFLKTWGTFRFPTHPSTLMP* |
Ga0136621_10009165 | 3300012092 | Polar Desert Sand | MSTARRRLAVAVAEETMFPPRTPFFLRTWGTSRSPTPLHAHRPETGR* |
Ga0136621_10034152 | 3300012092 | Polar Desert Sand | MSNARLRLAFTGETMFPPCTPFFLKTWGTFRFPTPLHAHGQETCP* |
Ga0136621_10045006 | 3300012092 | Polar Desert Sand | MTIVRLRQTIAEETMFPPRAPFFVKAWGTSRFPTPVHRHRAEIRP* |
Ga0136621_10071914 | 3300012092 | Polar Desert Sand | MTARLRLAVAGETMFPPRAPVSLKAWGTSRFPTPLHAPGSETGS* |
Ga0136632_100509961 | 3300012093 | Polar Desert Sand | MNTRLRLAFAGETMFPPRAPFFLRTWGTSRFPTPLHAHRP |
Ga0136620_100500914 | 3300012186 | Polar Desert Sand | MNNARLRLAFVGETMFPPRAPFFLKTWGTSRFPTPLPVHGPTEVGP* |
Ga0136622_1000016322 | 3300012187 | Polar Desert Sand | MTARLRLAVAGETMFPPRAPFFLKAWGTSRFPTPLHAPGSETGS* |
Ga0136622_100031272 | 3300012187 | Polar Desert Sand | MSNARRRLAFTGETMFPPCTPFFLKTWGTFRFPTPLHAHGQETCP* |
Ga0137365_1000769518 | 3300012201 | Vadose Zone Soil | MTNARLWLAFAGETMFPPRIPLLLKTWGASRFPTTLH |
Ga0137365_101283545 | 3300012201 | Vadose Zone Soil | MTNARLWLAFAGETMFPPRIPLLLKTWGTSRFPTTLHAPAPETGP* |
Ga0136633_10229522 | 3300012527 | Polar Desert Sand | MNIVRLRQTIAEETMFPSRAPFFLKAWGTSRVPTPLHAQRPVSGI* |
Ga0136633_10878502 | 3300012527 | Polar Desert Sand | MSTARLRLAVARETMFPPRAPFFWRAWETSRFPTPLPAHRKGSR* |
Ga0136616_100232244 | 3300012679 | Polar Desert Sand | MNTRLRLAFAGETMFPPRAPFFLRTWGTSRFPTPLYSHRPETDL* |
Ga0136616_100925842 | 3300012679 | Polar Desert Sand | MSIVGLPQTIVGETMFPPRAPFFSKAWGTSRFPTPLHTHWQKGDQ* |
Ga0136612_100012456 | 3300012680 | Polar Desert Sand | MTTVRLRLTVAGETMFPPRAPFFLRSWGTSRFPTLLHAHEPETGS* |
Ga0136613_100008033 | 3300012681 | Polar Desert Sand | MTNARLRLAFAEETMFPPRAPFFLRAWGTSRFPTPLPAHWPTEVDQ* |
Ga0136613_100130345 | 3300012681 | Polar Desert Sand | MNNARLRLACTGETMFPPCTPFFLKTWGTFRFPTPLHAHGQETCP* |
Ga0136613_106781622 | 3300012681 | Polar Desert Sand | MSTARRRLAVAVAEETMFPPRTPFFLRTWGTSRFP |
Ga0164300_104892591 | 3300012951 | Soil | TARLQLAVAGETMFPPRAPFFSRAWGTSRFPTPLPAHRLEISR* |
Ga0075311_11279122 | 3300014259 | Natural And Restored Wetlands | MSIDSLRRSIAGEAMFPPRIPFSRPRGASRFPAPVPVP |
Ga0075309_10249252 | 3300014268 | Natural And Restored Wetlands | MSNPRLSLGFAGETLFPPRAPFFPSSWGTSRFPTPLHAHTATEVAV* |
Ga0075326_12830571 | 3300014271 | Natural And Restored Wetlands | VTNARLRLAFVGETMFPPRAPFFSKTWGTFRFPTPL |
Ga0075310_11353191 | 3300014302 | Natural And Restored Wetlands | VNTARLRLAVMGETMFPAWAPFFPTVLGTSRFPTPLPAHRPK |
Ga0075322_10993282 | 3300014311 | Natural And Restored Wetlands | VSTARLQLAVAGGTLFPPRAPFSWEMWGTSRFPTPL |
Ga0173483_100105415 | 3300015077 | Soil | MSTTRLRLVVAGETLFPPRAPFSSRTWGTSRFPTPLHAHRATKVAP* |
Ga0120098_10290771 | 3300015170 | Fossill | MSNARLRLAFVGETMFPPRAPFFLRAWGTSRFPTPL |
Ga0173478_103323641 | 3300015201 | Soil | MSNARLRLAFAGEPMFPPRTPFFARSWGTSRFPAPLPA |
Ga0132258_100144183 | 3300015371 | Arabidopsis Rhizosphere | MSNARIRLAFVGDIMFPPRDPLLLNVWGTSRFPTPLPAPASTEVAA* |
Ga0132258_100296504 | 3300015371 | Arabidopsis Rhizosphere | MSTARLRLAVVGEAMVPARAPFFSTAWGTSRFPTPLPAHGPETGP* |
Ga0132258_110165113 | 3300015371 | Arabidopsis Rhizosphere | MSVARLRLAPVGETMFTPRTPFFLRAWGTSRFPRPAHWPTEVAQ* |
Ga0132258_113527264 | 3300015371 | Arabidopsis Rhizosphere | VTTTRLRLVVAAETLFPPRAPFSWRTRGTSRLPTPLPAH |
Ga0132256_1025601991 | 3300015372 | Arabidopsis Rhizosphere | MSTTRLRLAVAGETLFPPRAPFSWNAWGTSRFPTPLPAHRATEV |
Ga0132257_1013522432 | 3300015373 | Arabidopsis Rhizosphere | MNNARLRLAFAGETMFPPRAPFFLRAWGTSRFPTP |
Ga0132255_1030737691 | 3300015374 | Arabidopsis Rhizosphere | MSNARKLALTGETMFPPCTPFFVRAQGTSRFPAPLHAHR |
Ga0183260_100015932 | 3300017787 | Polar Desert Sand | MNTARLQLAVASRKTSETMLPPDAPFFVKAWGTPRFPTPLPARRPETGR |
Ga0183260_100071505 | 3300017787 | Polar Desert Sand | MSTARRRLAVAVAEETMFPPRTPFFLRTWGTSRSPTPLHAHRPETGR |
Ga0183260_1001105810 | 3300017787 | Polar Desert Sand | MTIVRLRQTIAEETMFPPRAPFFVKAWGTSRFPTPVHRHRAEIRP |
Ga0183260_100345782 | 3300017787 | Polar Desert Sand | MSTARLRLAVVGETIVPPRASFFLEARGTSRFPTPLPAHGPEDGP |
Ga0183260_100478392 | 3300017787 | Polar Desert Sand | MNIVRLRQTIAGETMFPPRAPFFSRAWGTSRFPTPLHAHGPNTGP |
Ga0183260_102070392 | 3300017787 | Polar Desert Sand | MSIVGLQQTIVGETMFPPRAPFFSKAWGTSRFPTPLHTHWQKGDQ |
Ga0136617_100340615 | 3300017789 | Polar Desert Sand | MTTARLRLTVAGETLFPPRAPFFLKTWGTSRFPTPLDAHWAEIRP |
Ga0136617_100707302 | 3300017789 | Polar Desert Sand | MNIVRLRQTIAGETMFPPRAPFFSRAWGTSRFPTPLLAHGPNAGT |
Ga0136617_101387682 | 3300017789 | Polar Desert Sand | MSIVGLPQTIVGETMFPPRAPFFSKAWGTSRFPTPLHTHWQQGDQ |
Ga0190266_102608421 | 3300017965 | Soil | MSTARLQLAVVGETMFSPRAPFFLRAWGTFRFPTPLPAHRP |
Ga0187822_103567932 | 3300017994 | Freshwater Sediment | RHQPPAGMNNARLRLAFVEETMFPPQGPLLLKVSGTSRFPTPLPAHAWTEVAA |
Ga0184626_100989772 | 3300018053 | Groundwater Sediment | MSNTRVRLAFTGETMFPPWAPFFLKTWGTSRFPTPLHAHRPETGR |
Ga0184623_104343241 | 3300018056 | Groundwater Sediment | MTIARLRLTIVGETMFPPRAPFFLRAWGTSRFPTP |
Ga0184637_107073521 | 3300018063 | Groundwater Sediment | MSNARLQLAFVAETMFPPRAPFFLRAWGTPRFPPPPPR |
Ga0184640_104746102 | 3300018074 | Groundwater Sediment | MSNARLRLTFTGETMFPPCAPFFLRAWGTARVPTPLPPHRATMVALWVAP |
Ga0184633_100181905 | 3300018077 | Groundwater Sediment | MTNARLRLAFASDETSETMFPPRAPFFLKTWGTSRFPTPLHAHRRESRL |
Ga0184633_102524421 | 3300018077 | Groundwater Sediment | MSTAHLRFAVAGETMFPSRTPFFLRAWGTSRFPTPLH |
Ga0184633_103032172 | 3300018077 | Groundwater Sediment | VSNARLRLAFASERALETMFPLGAPFFSRAWGTSRFL |
Ga0184639_103948192 | 3300018082 | Groundwater Sediment | MSNARLRLTFTGETMFPPCAPFFLRAWGTSRFPTPLHAHR |
Ga0190265_100259962 | 3300018422 | Soil | MTTLAYRLAFVGETMFPPRAPFFLRAWGTSRFPTPLHAHERETRS |
Ga0190265_101878364 | 3300018422 | Soil | MSNTHLWFVFASKKASETMFPPDAPFFLKAWGTSRFPTPLHTYEPESGS |
Ga0190265_105604512 | 3300018422 | Soil | MNTVRLRLTVAGETMFPTRAPVFLRMWGTSRFPTPLHALEPETGS |
Ga0190265_106264681 | 3300018422 | Soil | MSNTRFQLAFAGETMFPPRAPFFLKAWGTSRFPTPLHTHERGTR |
Ga0190272_106551023 | 3300018429 | Soil | MTTAHPWFAVAEETMFPPRAPFFQRASGTSRFPTPLHRHRLRC |
Ga0190272_124656812 | 3300018429 | Soil | MSTARLRLAITGETMFPPCTPFFLRAWETSRFPTPLP |
Ga0066655_100507173 | 3300018431 | Grasslands Soil | MTNARLWLAFAGETMFPPRIPLLLKTWGTSRFPTTLHAPGPETGP |
Ga0190268_112566672 | 3300018466 | Soil | RLWRTYGEETMFSPRAPFFMRAWGTSRFPTPLHAHAPEAGP |
Ga0190268_112917171 | 3300018466 | Soil | MTTAHLRFAVAGETMFSPRAPFFPRAWGTCRFPTPL |
Ga0190270_100264592 | 3300018469 | Soil | MSTTRLRLVVAGETLFPPRAPFWRTWGTSRFPTPLHAHSATKVAQ |
Ga0190271_100601552 | 3300018481 | Soil | MTTARLWLTVAGGTMFPPRAPFFLKTWGTSRFPTPLPAHGPRAGP |
Ga0190264_104867182 | 3300019377 | Soil | MSNTRLWLAFVGETMFPPRAPFFLRAWGTSRFPTPLHAHERETRS |
Ga0193741_10370412 | 3300019884 | Soil | MSNARPRLPFAGETMFPPRTPFFSKAWGTFRFPTPLHAHGSEVDP |
Ga0193696_10070073 | 3300020016 | Soil | MANARRRLAFAGETMFPPRAPFFLRAWGTSRFPTPLHALGPETGP |
Ga0193738_10013683 | 3300020020 | Soil | MTNARLRLAFTGETMFPPCAPFFLRTWGTSRFPTPLPAHGPGAGA |
Ga0193738_10188963 | 3300020020 | Soil | MSNARLRLAFTGETMHLSCAPFFLTSWGNPTVPTPLPAHDPATGS |
Ga0193738_10485602 | 3300020020 | Soil | MTNARLRLPLAEETMFPPRAPFFLRVWGTSRFPTTFPAHGPEPSP |
Ga0193738_10534572 | 3300020020 | Soil | TFASEETSETMFPPEAPFFLRAWGTSRFPTPLHAHGAKIAP |
Ga0210378_103771872 | 3300021073 | Groundwater Sediment | MSIVRLRLTIAGETMFPPRTPFFLRAWGTSRFPTPLHAHEPE |
Ga0182009_106716902 | 3300021445 | Soil | MSNVHLRFTFAGETMFPPRAPFFPMQGTSRFPVPLPAHTSTEVS |
Ga0193737_10661141 | 3300021972 | Soil | MSNTRLRLVFAEETMFPPRAPFFLRAWGTSRFPTPLPAHGRT |
Ga0222622_104347363 | 3300022756 | Groundwater Sediment | MSNARLRLAFTGETMFPPYAPFFLRAWGTSRCPTTLAPHVPGTSP |
Ga0222622_111024671 | 3300022756 | Groundwater Sediment | MSTARTSLAVVGETMFPPRAPFFPKAQGTFRFSTP |
Ga0247788_10009612 | 3300022901 | Soil | MSIDSLRKSIAEETMFPPRTPFFPTARGTSRFPTPLPAHAKEAFA |
Ga0247790_100113683 | 3300022915 | Soil | MSTTRLRLAVAGETLSPPRAPFTPLHAHRATEVAV |
Ga0247754_11360191 | 3300023102 | Soil | MSTTRLRVVVAGETMSPPRAPFFSEVWGTSRFPTPLPAHSAT |
Ga0247789_11013812 | 3300023266 | Soil | VSTTRLRLVVAGEALFPPCAPFSGNAWGTSRVPTPLHAHGATEVA |
Ga0209618_10494931 | 3300025001 | Soil | MSTVRLRLTVARKETSETMFPLEAPFFLRVWGTSRFPTPLHAHG |
Ga0209001_10042343 | 3300025002 | Soil | MSIVRFQQTIAGETMFPPRAPFFLKSWGTSRFPTPLHAHGLETNP |
Ga0209619_101774261 | 3300025159 | Soil | MSNARLRLAFAGETMFPPRAPFFLKAWGTSRFPTPLHAHEPGDG |
Ga0209172_103015492 | 3300025310 | Hot Spring Sediment | MSTARRDLAVVGETMFPPRAPFFSKAWGTSRFPTPLPAQ |
Ga0209519_100495073 | 3300025318 | Soil | MNNARLRLAFVGETMFPPRTPFFLEAGGTSWFPALLHAHMPEGGI |
Ga0209519_105574532 | 3300025318 | Soil | MSNAPLRLAFTGETMFPPCAPFFLRAWGTSRFPTPLRA |
Ga0209520_101912043 | 3300025319 | Soil | MSTVRLRLTVARKETSETMFPLEAPFFLRAWGTSRFPTPLHAHGPEAG |
Ga0209640_100435352 | 3300025324 | Soil | MTNARLWLAFVGETMFPPRTPFFMRAWGTSRFPTPLHDHSPTEVEL |
Ga0209640_100457821 | 3300025324 | Soil | VSNARLWRAFAGETMLPPRPPFFSSAWGSRFPMPLHA |
Ga0210087_10025551 | 3300025559 | Natural And Restored Wetlands | MTNARLRLAFAGETRFPPHAPFFWETWGTSRFPTPLPAQRSEAER |
Ga0210087_10941311 | 3300025559 | Natural And Restored Wetlands | MSVARVRLALAGETMFPPRAPFFWKAWGTSRFPTPLPAR |
Ga0210087_11058211 | 3300025559 | Natural And Restored Wetlands | MSVARLRLAPVGETMFPPRTPFFWRAWGTSRFPTPLP |
Ga0210076_10460651 | 3300025567 | Natural And Restored Wetlands | MTNARLRLAFVGETRFPPHAPFFWETWGTSRFPTPLPA |
Ga0210115_10517711 | 3300025791 | Natural And Restored Wetlands | MNARLRLALAGETMFPWRAPFFSIPWGTPRFPTPLRAHEPETGS |
Ga0210115_10871782 | 3300025791 | Natural And Restored Wetlands | MSVARVRLALAGETMFPPRAPFFWKAWGTSRFPTPLPA |
Ga0207695_100066355 | 3300025913 | Corn Rhizosphere | MSNARLRLAFVGETMFPPRAPLVLKAWGTSRFPTPFPAHAPSGVAA |
Ga0207667_110945141 | 3300025949 | Corn Rhizosphere | MSVVRLWLAPVGETMFPLRNPFFHVGGGTSRFPHTPLRTLT |
Ga0208002_10166821 | 3300026029 | Natural And Restored Wetlands | MSNARLQLVFAGEAMSLPRTLFFRKTWGTSRFPTPLHN |
Ga0208419_10246781 | 3300026032 | Natural And Restored Wetlands | VSTARLQLAVAGGTLFPPRAPFSWEMWGTSRFPTP |
Ga0208654_10017045 | 3300026062 | Natural And Restored Wetlands | MSNARLQLVFAGEAMSLPRTLFFRKTWGTSRFPTPLHNHGQEGRP |
Ga0208537_10462942 | 3300026071 | Natural And Restored Wetlands | MSVARVRLALAGETMFPPRAPFFWRAWGTSRFLTPLPARASTEVDA |
Ga0256867_100932721 | 3300026535 | Soil | RLAFVGETMFPPRAPFFPKTWGTSRFPTPLHVHGSETAP |
Ga0209852_10140942 | 3300026856 | Groundwater Sand | MSTTRLRLVVAGETLFPPRALFSWRTWGTSRFPTPLHAHSA |
Ga0208890_10402182 | 3300027523 | Soil | VSIARLWLALVGETMFPPRAPFFLKAWETSRFPRPL |
Ga0208890_10591152 | 3300027523 | Soil | MSNVRLWLPFMGETMFPPCAPFFLTSWETSRFPTPLHAHDAE |
Ga0209887_10144784 | 3300027561 | Groundwater Sand | MSNTRFQLAFAGETMFPPRAPFFLETWGTSRFPTPLHLHGPTE |
Ga0209887_11145992 | 3300027561 | Groundwater Sand | VSNARLWLAFAGATMFPPRAPFFLRAWGTSRFPTPLHAQRPT |
Ga0209874_10039103 | 3300027577 | Groundwater Sand | MSNTRFQLAFAGETMFPPRAPFFLETWGTSRFPTPLHTHERQGRS |
Ga0208612_10068535 | 3300027638 | Polar Desert | MNIVRLRQTIAGETMFPPRAPFFSRAWVTSRFPTPLHAHGPNTGP |
Ga0208612_10404672 | 3300027638 | Polar Desert | MSNARLRLAFTGETMFPPCTPFFLKTWGTFRFPTPLHAHGQETCP |
Ga0209814_100028559 | 3300027873 | Populus Rhizosphere | MTTARLQLALAGETVFPPGAWFVSRAWGPFRFPTPLPDHGPKAGP |
Ga0209590_101752814 | 3300027882 | Vadose Zone Soil | MTNARLGLAFAEETMFPPRFAFFLRARRTSRFPAQGP |
Ga0207428_100427874 | 3300027907 | Populus Rhizosphere | MTTARLRLALVGETVFPPGAWFVSRAWGPFRFPTPLPDHGPKAGP |
Ga0209382_104135351 | 3300027909 | Populus Rhizosphere | MNARLRFAQAGETMFPPPAPFFLRSWGTSRLPALHPH |
Ga0209889_10351392 | 3300027952 | Groundwater Sand | MTNARLRLAFTGETMFPPCAPFFLRAWGTSRFPTPLHAH |
Ga0209859_10126755 | 3300027954 | Groundwater Sand | MSNARLRLAFAGAKMFPPRAPFFLRAVGTSRFPTPLHA |
(restricted) Ga0233418_100498501 | 3300027995 | Sediment | MSNAPLWLALAGETMFPPPAPFFLETWGTSRFPTPLP |
(restricted) Ga0233417_101026132 | 3300028043 | Sediment | MSNAPLWLALAGETMFPPPAPFFLETWGTSRFPTPLPAHKPT |
Ga0307295_100533701 | 3300028708 | Soil | MSTSRLRLEVAGETMFPPRAPFFLKAWGTSRFPTPLPAHGK |
Ga0307307_101609272 | 3300028718 | Soil | MSTARVPLAVAGATMFPPRAPFFLRAWGTSRFPTPLHAHGPV |
Ga0307297_101761522 | 3300028754 | Soil | MSTARVPLAVAGATMFPPRAPFFLRAWGTSRFPTPLHAHG |
Ga0307280_100883542 | 3300028768 | Soil | MSTSRLRLEVAEETMFPPRAPFFLKAWGTSRFPTPLPAHGKVYP |
Ga0307306_102209831 | 3300028782 | Soil | MSTSRLRLEVAEETMFPPRAPFFLKAWGTSRFPTPLPAHGK |
Ga0307282_100581652 | 3300028784 | Soil | MSTSRLRLEVAEETMFPLRAPFFLKAWGTSRFPTPLPAHGKVYP |
Ga0307323_101774231 | 3300028787 | Soil | MSNARLRLAFAEETMFPPRAPFFLRVWGTSRFSTPLPAHR |
Ga0307299_101108922 | 3300028793 | Soil | MSTSRLRLEVAEEIMFPPRAPFFLKAWGTSRFHTPLPAHGKVYP |
Ga0307305_100445871 | 3300028807 | Soil | MSNARLQLAFAGETMFPPRAPFFSRAWGTSRFPTPLH |
Ga0247825_100660522 | 3300028812 | Soil | MSTARLRLAVVGETMVPARAPFFSTEWGTSRFPTPFPAHGPETGP |
Ga0307302_105024122 | 3300028814 | Soil | MTNAPLRLAFAGKTMFPPRAPFFLKTWETFRFPTPLPAHAPET |
Ga0307296_100067239 | 3300028819 | Soil | MSTAHLRFAVAGETMFPPRAPFFLGAWETSRFPTP |
Ga0307296_101402571 | 3300028819 | Soil | MTNARLRLAFAGETMFPPRAPFFLRTWGTSRFPTPLHGH |
Ga0307289_101893581 | 3300028875 | Soil | MTTVRLRLPVVGETMLPPRAPFFLKAWGTTPVPNPPHP |
Ga0307308_105631921 | 3300028884 | Soil | MSNARLRLAFAGEKRSETIFPSRGAPFFLRAWGTSR |
Ga0307304_105826891 | 3300028885 | Soil | MNTTRLRLAVAGETMFPPRATFFSKAWGISRFPTPLHARW |
Ga0299907_100026653 | 3300030006 | Soil | MTNARLQLAFAGETMFPPRAPFFLRAWGTSRFPTPLPGHGPDAGP |
Ga0299907_100030053 | 3300030006 | Soil | MSTARLRLAVARERETETMFPPDAPFFLKSWGTSRFPTRLHAHGPETGP |
Ga0299907_100135797 | 3300030006 | Soil | MNTARLRLAVAGETMFPPRAPFFMSSWGTSRFPTPLLAHGATEVAP |
Ga0299907_100387421 | 3300030006 | Soil | MTRTARIRLAVVGEAMFPPRAPFFLRSWGTSGFPT |
Ga0299907_100891613 | 3300030006 | Soil | MSTARKQLAVVEETMFPPRTPFFLSARGTSRFPIPLPPHR |
Ga0299907_101654353 | 3300030006 | Soil | MTRNARLQLAFAGETMFTPQAHFFLNAWATSRFPTPLHHGHRLTGVSR |
Ga0299907_106231891 | 3300030006 | Soil | MTNARLRLAFAGETMFPPRAPFFLRAWGTSRFPTP |
Ga0299907_112077862 | 3300030006 | Soil | VSTARKQLAVVGETMFPPRAPFFLRAWGTPRFPAPLHA |
Ga0247826_113853502 | 3300030336 | Soil | MSVTRLRLAPVGEPMFPPRAPFFRRVWGTSRFPTPLPA |
Ga0299906_1001146710 | 3300030606 | Soil | MTDNARFQLAFAGETMFPPRAPFFSRAWGTSRFPTPLPVGHG |
Ga0299913_109743011 | 3300031229 | Soil | MSNPRLNLGFVGETMFPPRAPFFSSSWGTSRFPTPLHAHT |
Ga0247727_100092674 | 3300031576 | Biofilm | MTNARRRLAFAGETMFPPRAPFFSKVWGTSRFPTPLHAQRPEIGR |
Ga0247727_101185332 | 3300031576 | Biofilm | MANTHLRLAFAGETMFPPRAPFIKAWGTSRFPTPLHAHGPGAGP |
Ga0310892_113458242 | 3300031858 | Soil | MSNAHLRLAFAGETMFPPRAPFSSRAWGTSRFPTP |
Ga0315297_100780562 | 3300031873 | Sediment | MSNARLRLAFVGEAMSPPRAPFFSKTRGTSRLLIPRRVHGPGDRP |
Ga0310900_102990871 | 3300031908 | Soil | MSTARLRLAVVGETMVPARAPFFSTAWGTSRFPTP |
Ga0310900_107189433 | 3300031908 | Soil | VTTTRLRLVVAAETLFPPRAPFSWRTRGTSRFPTP |
Ga0310900_111635631 | 3300031908 | Soil | MNARLRPALAGETMFPPPTPFLAKSWGTSRLPIPLPTFVNEVD |
Ga0214473_109442971 | 3300031949 | Soil | MSNARLRLAFASEKMSETMSPPEAPFFAKSWGTSRFPTPLHTHGSR |
Ga0307479_100556031 | 3300031962 | Hardwood Forest Soil | MSVVRLRLTPVGETMFPLRNPFFRDGGGTSRFPHTPLHQLMRQK |
Ga0310903_107670122 | 3300032000 | Soil | VTTTRLRLVVAAETLFPPRAPFSWRTRGTSRFPTPL |
Ga0310906_104221802 | 3300032013 | Soil | MSIDSLRKSIAEETMFPPRTPFFPTAWETSRFPTPLPAHAKEAFA |
Ga0310890_100151281 | 3300032075 | Soil | MTGTRLRLGPAEETMFPPRAPFYRRAWGTPRFRTPLPAQGPT |
Ga0310890_105175051 | 3300032075 | Soil | VSNPNLGLGFVGETMFPPRAAFFATRRGTSRFPAPLPAHGATKV |
Ga0310895_101898152 | 3300032122 | Soil | MSNARPGLAFVGETVPPPRAPFFSKAWGTSRFPTP |
Ga0315292_100151756 | 3300032143 | Sediment | MSNARLRLAFAEETMFPPRAPFFLKTWGTSRFPTPLHAHGPETGR |
Ga0334722_102706163 | 3300033233 | Sediment | MSIVFQQTIAEETMFPPRAPFFLKTVGTSRFSTLLPAHRPEADL |
Ga0247830_102777351 | 3300033551 | Soil | MSNARPGLAFVGETVSPPRAPFFSKAWGTSRFPTPLPGH |
Ga0364928_0099161_2_106 | 3300033813 | Sediment | MSNARLRLAFARETMSPPQPPFLSKSWGTTRFPTP |
Ga0364945_0062605_1_141 | 3300034115 | Sediment | MSNARLRLAFAGRNMSETMFPLGAPFFLRTWGTSRFPTPLHAHRPEI |
Ga0364945_0122351_654_770 | 3300034115 | Sediment | MSNAPLRLAFTGETMFPPCAPFFLRAWGTSRFPTPLPAH |
Ga0364940_0035307_1203_1310 | 3300034164 | Sediment | MSNARPWLAFAGETMFPPRAPFFLKTWGTSRFPTPL |
Ga0314786_182227_19_156 | 3300034664 | Soil | MNIDSLRKSIAEETMFPPRTPVFPTAWETSRFPTPLPAHAKEAFA |
⦗Top⦘ |