Basic Information | |
---|---|
Family ID | F021876 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 217 |
Average Sequence Length | 43 residues |
Representative Sequence | MLDEKDFQRKADAAFEDLKRRLLTLGDEHGFDVEGESGKLEVI |
Number of Associated Samples | 170 |
Number of Associated Scaffolds | 217 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 51.15 % |
% of genes near scaffold ends (potentially truncated) | 99.08 % |
% of genes from short scaffolds (< 2000 bps) | 89.40 % |
Associated GOLD sequencing projects | 164 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.45 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (96.774 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (20.737 % of family members) |
Environment Ontology (ENVO) | Unclassified (29.032 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.387 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 36.62% β-sheet: 0.00% Coil/Unstructured: 63.38% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 217 Family Scaffolds |
---|---|---|
PF00578 | AhpC-TSA | 35.48 |
PF08534 | Redoxin | 16.13 |
PF02683 | DsbD | 11.06 |
PF00484 | Pro_CA | 9.22 |
PF05635 | 23S_rRNA_IVP | 2.76 |
PF11175 | DUF2961 | 1.84 |
PF02517 | Rce1-like | 0.92 |
PF00512 | HisKA | 0.92 |
PF02518 | HATPase_c | 0.92 |
PF01925 | TauE | 0.46 |
PF02729 | OTCace_N | 0.46 |
PF07228 | SpoIIE | 0.46 |
PF13602 | ADH_zinc_N_2 | 0.46 |
PF06983 | 3-dmu-9_3-mt | 0.46 |
PF01243 | Putative_PNPOx | 0.46 |
PF13620 | CarboxypepD_reg | 0.46 |
PF07978 | NIPSNAP | 0.46 |
PF12686 | DUF3800 | 0.46 |
PF01850 | PIN | 0.46 |
PF16499 | Melibiase_2 | 0.46 |
PF06745 | ATPase | 0.46 |
PF07676 | PD40 | 0.46 |
PF01066 | CDP-OH_P_transf | 0.46 |
PF07638 | Sigma70_ECF | 0.46 |
PF12704 | MacB_PCD | 0.46 |
PF01207 | Dus | 0.46 |
PF04014 | MazE_antitoxin | 0.46 |
PF01370 | Epimerase | 0.46 |
PF00085 | Thioredoxin | 0.46 |
PF16925 | TetR_C_13 | 0.46 |
COG ID | Name | Functional Category | % Frequency in 217 Family Scaffolds |
---|---|---|---|
COG0288 | Carbonic anhydrase | Inorganic ion transport and metabolism [P] | 9.22 |
COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 0.92 |
COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 0.92 |
COG1183 | Phosphatidylserine synthase | Lipid transport and metabolism [I] | 0.46 |
COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.46 |
COG2764 | Zn-dependent glyoxalase, PhnB family | Energy production and conversion [C] | 0.46 |
COG3865 | Glyoxalase superfamily enzyme, possible 3-demethylubiquinone-9 3-methyltransferase | General function prediction only [R] | 0.46 |
COG5050 | sn-1,2-diacylglycerol ethanolamine- and cholinephosphotranferases | Lipid transport and metabolism [I] | 0.46 |
COG0042 | tRNA-dihydrouridine synthase | Translation, ribosomal structure and biogenesis [J] | 0.46 |
COG0558 | Phosphatidylglycerophosphate synthase | Lipid transport and metabolism [I] | 0.46 |
COG0730 | Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family | Inorganic ion transport and metabolism [P] | 0.46 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 96.77 % |
Unclassified | root | N/A | 3.23 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001154|JGI12636J13339_1001061 | All Organisms → cellular organisms → Bacteria | 4620 | Open in IMG/M |
3300002917|JGI25616J43925_10006780 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4959 | Open in IMG/M |
3300002917|JGI25616J43925_10211279 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
3300004080|Ga0062385_11222366 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
3300004099|Ga0058900_1406451 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 668 | Open in IMG/M |
3300004479|Ga0062595_101042052 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 708 | Open in IMG/M |
3300005177|Ga0066690_10892988 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 568 | Open in IMG/M |
3300005180|Ga0066685_10933259 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 578 | Open in IMG/M |
3300005332|Ga0066388_101374652 | Not Available | 1224 | Open in IMG/M |
3300005436|Ga0070713_100299148 | All Organisms → cellular organisms → Bacteria | 1481 | Open in IMG/M |
3300005437|Ga0070710_10346834 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 982 | Open in IMG/M |
3300005454|Ga0066687_10519558 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 705 | Open in IMG/M |
3300005541|Ga0070733_10190371 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1340 | Open in IMG/M |
3300005541|Ga0070733_10634571 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 717 | Open in IMG/M |
3300005548|Ga0070665_100504461 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1221 | Open in IMG/M |
3300005556|Ga0066707_10349611 | All Organisms → cellular organisms → Bacteria | 967 | Open in IMG/M |
3300005598|Ga0066706_11270352 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 557 | Open in IMG/M |
3300005718|Ga0068866_10008316 | All Organisms → cellular organisms → Bacteria | 4366 | Open in IMG/M |
3300006032|Ga0066696_10235129 | All Organisms → cellular organisms → Bacteria | 1180 | Open in IMG/M |
3300006050|Ga0075028_100824352 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 567 | Open in IMG/M |
3300006162|Ga0075030_100007201 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 9932 | Open in IMG/M |
3300006163|Ga0070715_10024149 | All Organisms → cellular organisms → Bacteria | 2390 | Open in IMG/M |
3300006163|Ga0070715_10101085 | All Organisms → cellular organisms → Bacteria | 1345 | Open in IMG/M |
3300006174|Ga0075014_100345195 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 797 | Open in IMG/M |
3300006174|Ga0075014_100828032 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 549 | Open in IMG/M |
3300006354|Ga0075021_11092255 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 522 | Open in IMG/M |
3300006796|Ga0066665_11054424 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 621 | Open in IMG/M |
3300006806|Ga0079220_10363723 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 926 | Open in IMG/M |
3300006854|Ga0075425_101430719 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 782 | Open in IMG/M |
3300006954|Ga0079219_11487366 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 612 | Open in IMG/M |
3300007076|Ga0075435_101985456 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 511 | Open in IMG/M |
3300007255|Ga0099791_10031072 | All Organisms → cellular organisms → Bacteria | 2344 | Open in IMG/M |
3300009088|Ga0099830_11780609 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 514 | Open in IMG/M |
3300009089|Ga0099828_10018795 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5347 | Open in IMG/M |
3300009089|Ga0099828_10218551 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1703 | Open in IMG/M |
3300009089|Ga0099828_11146482 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 690 | Open in IMG/M |
3300009137|Ga0066709_100149075 | All Organisms → cellular organisms → Bacteria | 2986 | Open in IMG/M |
3300009143|Ga0099792_10209425 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1114 | Open in IMG/M |
3300009143|Ga0099792_10862816 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 597 | Open in IMG/M |
3300009635|Ga0116117_1076250 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 830 | Open in IMG/M |
3300009641|Ga0116120_1069016 | All Organisms → cellular organisms → Bacteria | 1192 | Open in IMG/M |
3300010047|Ga0126382_10247628 | All Organisms → cellular organisms → Bacteria | 1303 | Open in IMG/M |
3300010048|Ga0126373_11834742 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
3300010329|Ga0134111_10238993 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
3300010358|Ga0126370_10493775 | All Organisms → cellular organisms → Bacteria | 1032 | Open in IMG/M |
3300010358|Ga0126370_10494215 | All Organisms → cellular organisms → Bacteria | 1032 | Open in IMG/M |
3300010358|Ga0126370_10656572 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 915 | Open in IMG/M |
3300010359|Ga0126376_10531558 | All Organisms → cellular organisms → Bacteria | 1096 | Open in IMG/M |
3300010361|Ga0126378_13393298 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
3300010364|Ga0134066_10205386 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
3300010366|Ga0126379_12411338 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 625 | Open in IMG/M |
3300010376|Ga0126381_101537536 | All Organisms → cellular organisms → Bacteria | 962 | Open in IMG/M |
3300011269|Ga0137392_10154827 | All Organisms → cellular organisms → Bacteria | 1852 | Open in IMG/M |
3300011269|Ga0137392_10268418 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1407 | Open in IMG/M |
3300011271|Ga0137393_10672755 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 887 | Open in IMG/M |
3300012096|Ga0137389_11796025 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 509 | Open in IMG/M |
3300012198|Ga0137364_11470746 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 502 | Open in IMG/M |
3300012202|Ga0137363_10133669 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1930 | Open in IMG/M |
3300012202|Ga0137363_10365847 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1196 | Open in IMG/M |
3300012202|Ga0137363_10703157 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 855 | Open in IMG/M |
3300012202|Ga0137363_11314654 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 612 | Open in IMG/M |
3300012203|Ga0137399_10017396 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4592 | Open in IMG/M |
3300012203|Ga0137399_10555548 | All Organisms → cellular organisms → Bacteria | 964 | Open in IMG/M |
3300012203|Ga0137399_10808765 | Not Available | 789 | Open in IMG/M |
3300012203|Ga0137399_11414975 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 582 | Open in IMG/M |
3300012205|Ga0137362_10630433 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 923 | Open in IMG/M |
3300012205|Ga0137362_10777825 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 821 | Open in IMG/M |
3300012211|Ga0137377_10531123 | All Organisms → cellular organisms → Bacteria | 1114 | Open in IMG/M |
3300012285|Ga0137370_10115527 | All Organisms → cellular organisms → Bacteria | 1525 | Open in IMG/M |
3300012349|Ga0137387_10491733 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 890 | Open in IMG/M |
3300012354|Ga0137366_10212899 | All Organisms → cellular organisms → Bacteria | 1440 | Open in IMG/M |
3300012363|Ga0137390_10572366 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_57_6 | 1099 | Open in IMG/M |
3300012683|Ga0137398_10177783 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1394 | Open in IMG/M |
3300012683|Ga0137398_10326743 | All Organisms → cellular organisms → Bacteria | 1035 | Open in IMG/M |
3300012683|Ga0137398_10508085 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83 | 829 | Open in IMG/M |
3300012917|Ga0137395_10096251 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1960 | Open in IMG/M |
3300012918|Ga0137396_10014664 | All Organisms → cellular organisms → Bacteria | 4897 | Open in IMG/M |
3300012918|Ga0137396_10843998 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 673 | Open in IMG/M |
3300012927|Ga0137416_10251334 | All Organisms → cellular organisms → Bacteria | 1444 | Open in IMG/M |
3300012929|Ga0137404_10078043 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2618 | Open in IMG/M |
3300012930|Ga0137407_10292843 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1487 | Open in IMG/M |
3300012930|Ga0137407_12230351 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 523 | Open in IMG/M |
3300012944|Ga0137410_10072358 | All Organisms → cellular organisms → Bacteria | 2502 | Open in IMG/M |
3300013307|Ga0157372_11617148 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 746 | Open in IMG/M |
3300014157|Ga0134078_10183969 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
3300014199|Ga0181535_10368272 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 846 | Open in IMG/M |
3300014200|Ga0181526_10383403 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 893 | Open in IMG/M |
3300015051|Ga0137414_1067257 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 562 | Open in IMG/M |
3300016294|Ga0182041_11045255 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 740 | Open in IMG/M |
3300016319|Ga0182033_10487795 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1057 | Open in IMG/M |
3300016319|Ga0182033_10960460 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 759 | Open in IMG/M |
3300016357|Ga0182032_11541331 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 577 | Open in IMG/M |
3300016371|Ga0182034_11533865 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 584 | Open in IMG/M |
3300016404|Ga0182037_11650052 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
3300017947|Ga0187785_10712171 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 528 | Open in IMG/M |
3300017959|Ga0187779_10549287 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 769 | Open in IMG/M |
3300017974|Ga0187777_10256346 | All Organisms → cellular organisms → Bacteria | 1188 | Open in IMG/M |
3300017999|Ga0187767_10357336 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 516 | Open in IMG/M |
3300018012|Ga0187810_10094209 | All Organisms → cellular organisms → Bacteria | 1171 | Open in IMG/M |
3300018012|Ga0187810_10402716 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 575 | Open in IMG/M |
3300018037|Ga0187883_10591661 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 575 | Open in IMG/M |
3300018047|Ga0187859_10389048 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 764 | Open in IMG/M |
3300018058|Ga0187766_11122558 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 565 | Open in IMG/M |
3300018064|Ga0187773_11145529 | Not Available | 519 | Open in IMG/M |
3300018085|Ga0187772_10292341 | All Organisms → cellular organisms → Bacteria | 1114 | Open in IMG/M |
3300018090|Ga0187770_10142560 | All Organisms → cellular organisms → Bacteria | 1821 | Open in IMG/M |
3300018090|Ga0187770_10360485 | All Organisms → cellular organisms → Bacteria | 1138 | Open in IMG/M |
3300018090|Ga0187770_10626085 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 856 | Open in IMG/M |
3300018433|Ga0066667_12273952 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 507 | Open in IMG/M |
3300018482|Ga0066669_11597306 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 595 | Open in IMG/M |
3300020199|Ga0179592_10524877 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 505 | Open in IMG/M |
3300020579|Ga0210407_10441431 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1018 | Open in IMG/M |
3300020579|Ga0210407_11450803 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
3300020579|Ga0210407_11451337 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 507 | Open in IMG/M |
3300020580|Ga0210403_10418258 | All Organisms → cellular organisms → Bacteria | 1093 | Open in IMG/M |
3300020580|Ga0210403_10505958 | All Organisms → cellular organisms → Bacteria | 981 | Open in IMG/M |
3300020580|Ga0210403_10721065 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 798 | Open in IMG/M |
3300020582|Ga0210395_10770535 | Not Available | 718 | Open in IMG/M |
3300020582|Ga0210395_10884484 | Not Available | 664 | Open in IMG/M |
3300020582|Ga0210395_10960444 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
3300021046|Ga0215015_10241988 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1232 | Open in IMG/M |
3300021170|Ga0210400_10109718 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2193 | Open in IMG/M |
3300021171|Ga0210405_10368077 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1133 | Open in IMG/M |
3300021181|Ga0210388_10410641 | All Organisms → cellular organisms → Bacteria | 1190 | Open in IMG/M |
3300021181|Ga0210388_11308093 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 611 | Open in IMG/M |
3300021406|Ga0210386_10495851 | All Organisms → cellular organisms → Bacteria | 1055 | Open in IMG/M |
3300021478|Ga0210402_10359497 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1351 | Open in IMG/M |
3300021478|Ga0210402_10757438 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 895 | Open in IMG/M |
3300021478|Ga0210402_11553043 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 589 | Open in IMG/M |
3300021478|Ga0210402_12008520 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 504 | Open in IMG/M |
3300021559|Ga0210409_10411601 | All Organisms → cellular organisms → Bacteria | 1209 | Open in IMG/M |
3300022510|Ga0242652_1048642 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 532 | Open in IMG/M |
3300022531|Ga0242660_1089219 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 738 | Open in IMG/M |
3300022726|Ga0242654_10017522 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1703 | Open in IMG/M |
3300024249|Ga0247676_1053818 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 657 | Open in IMG/M |
3300024249|Ga0247676_1057786 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 635 | Open in IMG/M |
3300024251|Ga0247679_1096041 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
3300024288|Ga0179589_10033952 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1815 | Open in IMG/M |
3300024330|Ga0137417_1395949 | All Organisms → cellular organisms → Bacteria | 1427 | Open in IMG/M |
3300025472|Ga0208692_1049329 | All Organisms → cellular organisms → Bacteria | 1001 | Open in IMG/M |
3300025906|Ga0207699_10495855 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 881 | Open in IMG/M |
3300025915|Ga0207693_10881211 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 687 | Open in IMG/M |
3300025922|Ga0207646_10609552 | All Organisms → cellular organisms → Bacteria | 980 | Open in IMG/M |
3300025939|Ga0207665_11197825 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 606 | Open in IMG/M |
3300025986|Ga0207658_12157097 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 506 | Open in IMG/M |
3300026317|Ga0209154_1294106 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
3300026333|Ga0209158_1015268 | All Organisms → cellular organisms → Bacteria | 3603 | Open in IMG/M |
3300026490|Ga0257153_1010883 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1819 | Open in IMG/M |
3300026514|Ga0257168_1105685 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
3300026514|Ga0257168_1150151 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
3300026548|Ga0209161_10151450 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1339 | Open in IMG/M |
3300026551|Ga0209648_10072510 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2894 | Open in IMG/M |
3300026557|Ga0179587_10246069 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1143 | Open in IMG/M |
3300026557|Ga0179587_11047369 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 537 | Open in IMG/M |
3300026835|Ga0207782_115714 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 591 | Open in IMG/M |
3300026839|Ga0207764_120553 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
3300026849|Ga0207804_113668 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 741 | Open in IMG/M |
3300026909|Ga0207858_1009658 | All Organisms → cellular organisms → Bacteria | 959 | Open in IMG/M |
3300027313|Ga0207780_1043904 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 773 | Open in IMG/M |
3300027629|Ga0209422_1049675 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1008 | Open in IMG/M |
3300027643|Ga0209076_1139839 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 680 | Open in IMG/M |
3300027684|Ga0209626_1139010 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 639 | Open in IMG/M |
3300027698|Ga0209446_1167286 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 567 | Open in IMG/M |
3300027725|Ga0209178_1254184 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
3300027727|Ga0209328_10257063 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
3300027787|Ga0209074_10341562 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
3300027829|Ga0209773_10250872 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 739 | Open in IMG/M |
3300027853|Ga0209274_10693358 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 525 | Open in IMG/M |
3300027855|Ga0209693_10623346 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
3300027889|Ga0209380_10029853 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3075 | Open in IMG/M |
3300027910|Ga0209583_10742668 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 516 | Open in IMG/M |
3300028072|Ga0247675_1051316 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 614 | Open in IMG/M |
3300028381|Ga0268264_10359075 | All Organisms → cellular organisms → Bacteria | 1389 | Open in IMG/M |
3300028906|Ga0308309_10006113 | All Organisms → cellular organisms → Bacteria | 7311 | Open in IMG/M |
3300030847|Ga0075405_12024804 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 557 | Open in IMG/M |
3300030848|Ga0075388_10048937 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 748 | Open in IMG/M |
3300030974|Ga0075371_11564080 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 580 | Open in IMG/M |
3300031231|Ga0170824_104191591 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 538 | Open in IMG/M |
3300031231|Ga0170824_121356251 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 543 | Open in IMG/M |
3300031474|Ga0170818_109967248 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1864 | Open in IMG/M |
3300031708|Ga0310686_116749043 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 558 | Open in IMG/M |
3300031715|Ga0307476_10843859 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 677 | Open in IMG/M |
3300031718|Ga0307474_11060277 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 642 | Open in IMG/M |
3300031720|Ga0307469_10501064 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1064 | Open in IMG/M |
3300031720|Ga0307469_10600126 | All Organisms → cellular organisms → Bacteria | 984 | Open in IMG/M |
3300031720|Ga0307469_11456253 | Not Available | 655 | Open in IMG/M |
3300031736|Ga0318501_10320311 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 830 | Open in IMG/M |
3300031744|Ga0306918_10165883 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1643 | Open in IMG/M |
3300031753|Ga0307477_10072739 | All Organisms → cellular organisms → Bacteria | 2377 | Open in IMG/M |
3300031753|Ga0307477_10312352 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1084 | Open in IMG/M |
3300031890|Ga0306925_11566025 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 642 | Open in IMG/M |
3300031897|Ga0318520_10843048 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 576 | Open in IMG/M |
3300031941|Ga0310912_11128181 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 598 | Open in IMG/M |
3300031945|Ga0310913_10122758 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1775 | Open in IMG/M |
3300031947|Ga0310909_11443538 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 549 | Open in IMG/M |
3300031954|Ga0306926_12492411 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 567 | Open in IMG/M |
3300031962|Ga0307479_10173390 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2120 | Open in IMG/M |
3300031962|Ga0307479_11134673 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 747 | Open in IMG/M |
3300032009|Ga0318563_10421697 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 722 | Open in IMG/M |
3300032035|Ga0310911_10199948 | All Organisms → cellular organisms → Bacteria | 1136 | Open in IMG/M |
3300032035|Ga0310911_10789414 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 549 | Open in IMG/M |
3300032064|Ga0318510_10400742 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 584 | Open in IMG/M |
3300032089|Ga0318525_10406608 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 698 | Open in IMG/M |
3300032091|Ga0318577_10042135 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2020 | Open in IMG/M |
3300032160|Ga0311301_10034259 | All Organisms → cellular organisms → Bacteria | 12813 | Open in IMG/M |
3300032174|Ga0307470_10893546 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 697 | Open in IMG/M |
3300032180|Ga0307471_101659409 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 794 | Open in IMG/M |
3300032180|Ga0307471_101861354 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 752 | Open in IMG/M |
3300032180|Ga0307471_103458168 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 559 | Open in IMG/M |
3300032180|Ga0307471_104159557 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 511 | Open in IMG/M |
3300032205|Ga0307472_100552441 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1005 | Open in IMG/M |
3300032261|Ga0306920_102062529 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
3300032783|Ga0335079_10236756 | All Organisms → cellular organisms → Bacteria | 2013 | Open in IMG/M |
3300032828|Ga0335080_12303578 | Not Available | 515 | Open in IMG/M |
3300032892|Ga0335081_10156303 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3248 | Open in IMG/M |
3300033475|Ga0310811_11029811 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 714 | Open in IMG/M |
3300033829|Ga0334854_036929 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1173 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 20.74% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 19.82% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 6.91% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.61% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.61% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.61% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.15% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.69% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.30% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.77% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.77% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.77% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.84% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.84% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.38% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.38% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.38% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.38% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.38% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.38% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.92% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.92% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.92% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.92% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.92% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.92% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.46% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.46% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.46% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.46% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.46% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.46% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001154 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 | Environmental | Open in IMG/M |
3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300004099 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF236 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300009635 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10 | Environmental | Open in IMG/M |
3300009641 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300014199 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaG | Environmental | Open in IMG/M |
3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
3300015051 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300022510 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-14-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022531 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300024249 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK17 | Environmental | Open in IMG/M |
3300024251 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK20 | Environmental | Open in IMG/M |
3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300025472 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_100 (SPAdes) | Environmental | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
3300026490 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-A | Environmental | Open in IMG/M |
3300026514 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-B | Environmental | Open in IMG/M |
3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
3300026835 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 60 (SPAdes) | Environmental | Open in IMG/M |
3300026839 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 52 (SPAdes) | Environmental | Open in IMG/M |
3300026849 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 46 (SPAdes) | Environmental | Open in IMG/M |
3300026909 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 23 (SPAdes) | Environmental | Open in IMG/M |
3300027313 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 45 (SPAdes) | Environmental | Open in IMG/M |
3300027629 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
3300027684 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027698 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
3300027727 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
3300028072 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK16 | Environmental | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300030847 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA10 SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030848 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA8 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030974 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA8 SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
3300033829 | Peat soil microbial communities from Stordalen Mire, Sweden - 715 P2 1-5 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12636J13339_10010611 | 3300001154 | Forest Soil | MLDEKDFRNKADAAFDDLKRRLLTAGDEHGFDVEGES |
JGI25616J43925_100067806 | 3300002917 | Grasslands Soil | MYAKCMLDEKDFQRKADAAFDDLKRRMLTAGDEHGFDVEGE |
JGI25616J43925_102112791 | 3300002917 | Grasslands Soil | MYAKCMLDEKDFQRKADSAFEDLKRRMLTAGDEHGFDVEGESGKL |
Ga0062385_112223661 | 3300004080 | Bog Forest Soil | MLDEKDFQRKADSAFEELKKRMLVVADQQDFDVEGESGKLEVIF |
Ga0058900_14064512 | 3300004099 | Forest Soil | MLEEKDFQRKADAAFADLKKRLLVLADEHGFDVEGESGKLEVIFE |
Ga0062595_1010420521 | 3300004479 | Soil | MLDEKDFQKKADAAFEELKKRLLELGDEHGFDVEGASGKLE |
Ga0066690_108929882 | 3300005177 | Soil | MLEEKDFQRKADAAFDDLKKRLLALGDEHGFDVEGESGKLEV |
Ga0066685_109332592 | 3300005180 | Soil | MATLDERDFQRKSGAAFEELKRRLLDAGDEHGFDVEGESGKLEVIFEEP |
Ga0066388_1013746524 | 3300005332 | Tropical Forest Soil | MYSEFMLDEKDFQRKADAAFEDLKKRLLTLGDEHGFDVEGE |
Ga0070713_1002991481 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MLDERDFQKKCEAAFEDLKRRMLNAGDAHGFDVEGESGKLEV |
Ga0070710_103468343 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MLSEHDFQKNADALFEELKKRLLRLGDEHGFDVEGESGKLEV |
Ga0066687_105195582 | 3300005454 | Soil | MATLDEHEFQRKSGATFEELKKRLLDAGDEHGFDVEGESGKLEV |
Ga0070733_101903711 | 3300005541 | Surface Soil | MLDEKEFQRKADAAFEDLKRRLLVVGDEHGFDVEGESGKLEV |
Ga0070733_106345712 | 3300005541 | Surface Soil | MATLDERDFQKKSDAAFAELKRRMLDAGDEHGFDVEGESGKLEVIFEEPE |
Ga0070665_1005044611 | 3300005548 | Switchgrass Rhizosphere | MPTLEERDFQKKCEAALEELKRRLLDAGDEHGFDVEGESGKLEVVFEDPAPAKFVI |
Ga0066707_103496112 | 3300005556 | Soil | MYAKCMLDEKDFQRKADAAFEELKRRMLTAGDEHGFDVEGE |
Ga0066706_112703521 | 3300005598 | Soil | MYAEFMLDEKDFQRKADSAFEDLKRRMLTAGDEHGFD |
Ga0068866_100083166 | 3300005718 | Miscanthus Rhizosphere | MAILEERDFQKKCDAALEELKRRLLEAGDEHGFDVEGESGKLEVVF |
Ga0066696_102351293 | 3300006032 | Soil | MLEEKDFQRKADAAFDDLKKRLLALGDAHGFDVEGESGKLEVLF |
Ga0075028_1008243521 | 3300006050 | Watersheds | MLSEHDFQKKADSAFEDLKKRLLLLGDQHDFDVEGESGKL |
Ga0075030_1000072011 | 3300006162 | Watersheds | MLEEQDFHHKADAAFDDLKKRMLTAGDEHGFDVEGESGKLEVIFEEPE |
Ga0070715_100241495 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MLSEHDFQKKADALFEELKKRLLRLGDEHGFDVEGESGK |
Ga0070715_101010851 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MLDERDFQRKAEAAFDDLKRRLLTLGDEHGFDVEGESGKLEVIFE |
Ga0075014_1003451952 | 3300006174 | Watersheds | MYANCMLEEKDFQRKADAAFEDLKRRMLTAGDEHGFDVEGEAGKLEVLFEE |
Ga0075014_1008280321 | 3300006174 | Watersheds | MLSEHDFQKQADTLFEELKKRLLRLGDEHGFDVEGESGKLEVIF |
Ga0075021_110922552 | 3300006354 | Watersheds | MLDEKDFQRKADAAFEDLKRCMLTAGDEHGFDVEGESGKLEVLFEEPEEAKFVIS |
Ga0066665_110544241 | 3300006796 | Soil | MLDERDFQKKCEAAFDDLKRRMLNAGDAHGFDVEGESGKLEVLFDEPEEAKFVIS |
Ga0079220_103637231 | 3300006806 | Agricultural Soil | MLEEKDFQRKADATFEDLKKRLLSLGDEHGFDVEG |
Ga0075425_1014307192 | 3300006854 | Populus Rhizosphere | MLDEKDFQKKADAAFEELKKRLLALGDEHGFDVEGESGKLEVIFEE |
Ga0079219_114873662 | 3300006954 | Agricultural Soil | MLEERDFQKKCDAALEDLKRRMLNAGDEHGFDVEGESGKLEVLFE |
Ga0075435_1019854562 | 3300007076 | Populus Rhizosphere | MLDEKDFQKKADAAFEELKRRLLALGDEHGFDVEGESGKLEVIFE |
Ga0099791_100310721 | 3300007255 | Vadose Zone Soil | MLDEKDFQRKADSAFEELKRRMLTAGDEHGFDVEGESGKLEVI |
Ga0099830_117806091 | 3300009088 | Vadose Zone Soil | MGILLVYAEFMLEEKDFQRKADAAFDNLKRRLLALGDEHGFDVEGEAGKLEVVFEEPEEA |
Ga0099828_100187951 | 3300009089 | Vadose Zone Soil | MYAKCMLEEKDFQRKADTAFEGLKKRLLVLGDEHGFDVEGEAGKLEI |
Ga0099828_102185511 | 3300009089 | Vadose Zone Soil | MLDEKDFQRKADAAFDDLKRRMLTAGDEHGFDVEGESGKLE |
Ga0099828_111464822 | 3300009089 | Vadose Zone Soil | MLDEKDFQRKADVAFEDLKRRLLTLGDEHGFDVEGE |
Ga0066709_1001490756 | 3300009137 | Grasslands Soil | MLEEKDFQRKADAAFEDLKKRLLTLGDAHGFDVEGEAGKLEVIFEEPEEA |
Ga0099792_102094253 | 3300009143 | Vadose Zone Soil | MLEEKDFQRKADSAFDDLKRRLLTAGDEHGFDVEGESGK |
Ga0099792_108628161 | 3300009143 | Vadose Zone Soil | MLSEKDFQRKADVAFEDLKKRLLALGDQHGFDVEGESGKLEVVFEEPEEAK |
Ga0116117_10762502 | 3300009635 | Peatland | VLEEKDFQRKADAAFEQLKKRLLTAGDAYDFDVEGESG |
Ga0116120_10690161 | 3300009641 | Peatland | MLDEQDFHKKCDAAFEEVRRKLLPLSDIHGFDVEGGS |
Ga0126382_102476281 | 3300010047 | Tropical Forest Soil | MPMLEERDFQKKCEAALEELKRRLLDAGDEHGFDVE |
Ga0126373_118347422 | 3300010048 | Tropical Forest Soil | MYPEFMLEEKDFQRKADAAFEDLKKRLLTLGDEHGFDVEGESGKLEVIFEE |
Ga0134111_102389931 | 3300010329 | Grasslands Soil | MLEEKDFQRKADAAFEDLKKRLLTLGDAHGFDVEGEAGKLEVIFEEPE |
Ga0126370_104937753 | 3300010358 | Tropical Forest Soil | MLEEKDFQRKADTAFEDLKKRLLTLGDEHGFDVEGESGKLEVIFEE |
Ga0126370_104942153 | 3300010358 | Tropical Forest Soil | MPMLEERDFQKKCEAALEELKGRLLDAGDRHGFDVEGESGKL |
Ga0126370_106565723 | 3300010358 | Tropical Forest Soil | MPIDERDFQRKSDAAFEELKRRLLNAGDSHGFDVEGESG |
Ga0126376_105315581 | 3300010359 | Tropical Forest Soil | MAALEERDFQRKSDQALEDLKKRLLEAGDAHGFDVEGESGKLEVIFED |
Ga0126378_133932982 | 3300010361 | Tropical Forest Soil | MLEEKDFQKKADAAFDDLKKRLLTLGDEHGFDVEGESGKLEVIF |
Ga0134066_102053862 | 3300010364 | Grasslands Soil | MLEEKDFQRKADAAFDDLKKRLLALGDEHGFDVEGESGKL |
Ga0126379_124113381 | 3300010366 | Tropical Forest Soil | MLAEQEFQKKADLAFDDLKKRLWKLGDEFAFDVEGESGKLEVIFEEPEPAK |
Ga0126381_1015375361 | 3300010376 | Tropical Forest Soil | MGMLSELEFQKKADATFDELKRRLLTASDEHDFDVEGE |
Ga0137392_101548271 | 3300011269 | Vadose Zone Soil | MMDEQDFRRKCDAAFEDLKRRLIASGDQHGFDVEGESGKLEVL |
Ga0137392_102684181 | 3300011269 | Vadose Zone Soil | MLDEKDFQRKADVAFEDLKRRLLTLGDEHGFDVEGESGKLEV |
Ga0137393_106727551 | 3300011271 | Vadose Zone Soil | MLDEKDFQRKADAAFDELKRRMLTAGDEHGFDVEGESGKLE |
Ga0137389_117960251 | 3300012096 | Vadose Zone Soil | MYANYMLDEKDFQRRADAVFEDLKRRMLTAGDEHGFDVEGEAGKLEVL |
Ga0137364_114707462 | 3300012198 | Vadose Zone Soil | MLDERDFQKKCEAAFDDLKRRMLNAGDAHGFDVEGESGKLEVLFEE |
Ga0137363_101336693 | 3300012202 | Vadose Zone Soil | MATLDEREFHKKSEGTFEELKRRMLEAGDEHGFDVEGESGK |
Ga0137363_103658471 | 3300012202 | Vadose Zone Soil | MYANYMLDEKDFQRRADAAFEDLKRRMLTAGDEHGFDVEGEAGKLEVLFEEPEEAK |
Ga0137363_107031573 | 3300012202 | Vadose Zone Soil | VDEKDFQRKADAAFDDLKRRLLTVGDEHGFDVEGESGKL |
Ga0137363_113146541 | 3300012202 | Vadose Zone Soil | MYANYMLDEKDFQRRADAVFEDLKRRMLTAGDEHGFDVEGEAGKLEVLFEEPEEAKFVI |
Ga0137399_100173961 | 3300012203 | Vadose Zone Soil | MLDEKDFQRKADAAFEDLKRRMLTAGDVHGFDVEGESGKLEVLFEEPEEAK |
Ga0137399_105555481 | 3300012203 | Vadose Zone Soil | MLDEKDFQRKADAAFEDLKRRMLTAGDEHGFDVEGESGKLEIIFEEPEEAKFV |
Ga0137399_108087653 | 3300012203 | Vadose Zone Soil | MLDEKDFQRKADAAFEDLRRRMLTAGDEHGFDVEGESGKLEVLFEE |
Ga0137399_114149752 | 3300012203 | Vadose Zone Soil | MATLDEREFQRKSEAAFEELKRRLLNAGDTNGFDVEGESGKLEVIF |
Ga0137362_106304331 | 3300012205 | Vadose Zone Soil | MLDEKDFQRKADAAFDDLKRRMLTAGDEHGFDVEG |
Ga0137362_107778251 | 3300012205 | Vadose Zone Soil | MGILLVYAEFMLEEKDFQRKADAAFDNLKRRLLALGDEHGFDVEGEA |
Ga0137377_105311231 | 3300012211 | Vadose Zone Soil | MGILLVYAEFMLEEKDFQRKADAAFDNLKKRLLALGDEHGFDVEGEAGKLEVV |
Ga0137370_101155273 | 3300012285 | Vadose Zone Soil | MLDEKDFQRKADAAFEDLRRRMLTAGDEHGFDVEGES |
Ga0137387_104917332 | 3300012349 | Vadose Zone Soil | MGILLVYAEFMLEEKDFQRKADAAFDNLKKRLLALGDEHGFDVEG |
Ga0137366_102128991 | 3300012354 | Vadose Zone Soil | MLEEKDFQRKADAAFDNLKRRLLALGDEHGFDVEGEAGKLEV |
Ga0137390_105723661 | 3300012363 | Vadose Zone Soil | MLDEKDFQRKADAAFDDLKRRMLTAGDEYGFDVEGEAGKLEVVFEEPEEAKFV |
Ga0137398_101777833 | 3300012683 | Vadose Zone Soil | MLDERDFQRKADAAFDDLKRRLLTLGDEHGFDVEGESG |
Ga0137398_103267433 | 3300012683 | Vadose Zone Soil | VYAEIMLDEKDFQRKADAAFEELKRRLLALGDEHGFDVEGESGKLEV |
Ga0137398_105080851 | 3300012683 | Vadose Zone Soil | MYAKCMLDEKDFQRKADAAFDDLKRRMLTAGDEHGFDVEGESGKLEVLFEEP |
Ga0137395_100962511 | 3300012917 | Vadose Zone Soil | MLDEKDFQRKADAAFDDLKRRMLTAGDEYGFDVEGESGKLEVLFEEPE |
Ga0137396_100146646 | 3300012918 | Vadose Zone Soil | MIDEKDFQRKADTAFEDLKRRLLTLGDEHGFDVEGE |
Ga0137396_108439982 | 3300012918 | Vadose Zone Soil | MLDEQDFRRKADAAFDDLKRRLLTLGDEHGFDVEGESGKLEVIF |
Ga0137416_102513341 | 3300012927 | Vadose Zone Soil | MLDEKDFRRKADAAFDDLKKRLLALGDEHGFDVEGEAGR |
Ga0137404_100780435 | 3300012929 | Vadose Zone Soil | MLDEKDFQRRADAAFEDLKRRMLTAGDEHGFDVEGEAGK |
Ga0137407_102928431 | 3300012930 | Vadose Zone Soil | MYAKEMLDEKDFQRKADAAFEDLKRRMLTAGDEHGFDVEGESGK |
Ga0137407_122303511 | 3300012930 | Vadose Zone Soil | MLDEKDFQRKADAAFDDLKRRMLTAGDEHGFDVEGESGKLEV |
Ga0137410_100723585 | 3300012944 | Vadose Zone Soil | MLDERDFQKKCEAAFDDLKRRMLNAGDAHGFDVEGESGKLEVLFEEP |
Ga0157372_116171484 | 3300013307 | Corn Rhizosphere | MATLEEREFQKKSDAAFEELKRRMLDAGDEHGFDVE |
Ga0134078_101839692 | 3300014157 | Grasslands Soil | MLEEKDFQRKADAAFDDLKKRLLALGDAHGFDVEGESGKLEVLFEEPQEAKFVIS |
Ga0181535_103682721 | 3300014199 | Bog | MLAEHDFQKKADALFDDLKKRLLNLGDVHDFDVEGESGKLEVICE |
Ga0181526_103834031 | 3300014200 | Bog | MLTEHDFQKKADAAFEDLKRRMLTLGDEHGFDVEGESG |
Ga0137414_10672571 | 3300015051 | Vadose Zone Soil | VDEKDFQRKADAAFDDLKRRLLTVGDQHGFDVEGERSGKLEVIFEEP |
Ga0182041_110452552 | 3300016294 | Soil | MLSERDFQKNADVLFEELKKRLLRLGDEHGFDVEGESGKLEVI |
Ga0182033_104877953 | 3300016319 | Soil | MATLDERDFQKKCDTALGELKHRLLEAGDAHGFDVEGESGKL |
Ga0182033_109604601 | 3300016319 | Soil | MGMLSELEFQKKADTTFDELKRRLLTASDEHDFDVEGESGKIEV |
Ga0182032_115413312 | 3300016357 | Soil | MLSEHDFQRNADALFEELKKRLLRLGDEHGFDVEG |
Ga0182034_115338652 | 3300016371 | Soil | MLSEHDFQKEADLAFEGLKKRLLKLGDEFGFDVEGE |
Ga0182037_116500522 | 3300016404 | Soil | MLEEKDFQRKADVAFEDLKKRLLALGDEHGFDVEGESGKLE |
Ga0187785_107121712 | 3300017947 | Tropical Peatland | MLTEHDFQKKADSAFEDLKRRLLKLGDEHDFDVEGESGKLEVIFE |
Ga0187779_105492872 | 3300017959 | Tropical Peatland | MLSEHDFQKKADAVFEQLKRRLLRLGDEYGFDVEGESGKLEVILEQPE |
Ga0187777_102563463 | 3300017974 | Tropical Peatland | MLSEQDFGKKADAAFDDLKRRLLSLGDEHGFDVEGE |
Ga0187767_103573361 | 3300017999 | Tropical Peatland | MLDEKDFQRKADSAFEVLKKRLLALADEHGFDVEGESGKLEV |
Ga0187810_100942091 | 3300018012 | Freshwater Sediment | MLDEQDFHRKADAAFEDLKKRLLVLGDEHGFDVEGEAGKLEVLFEEPEEAKFV |
Ga0187810_104027161 | 3300018012 | Freshwater Sediment | MLSEHDFQKKADAAFDDLKRRLLVLGDKHGFDVEG |
Ga0187883_105916612 | 3300018037 | Peatland | MLAEHDFQKKADALFEDLKKRLLNLGDVHDFDVEGESGKLEVIFE |
Ga0187859_103890481 | 3300018047 | Peatland | VLEEKDFQRKADAAFEQLKKRLLTAGDEYDFDVEGQSGKLEVLFEKP |
Ga0187766_111225581 | 3300018058 | Tropical Peatland | MLTEHDFQKKADTAFDDLKRRLLILGDEYEFDVEGESGKL |
Ga0187773_111455291 | 3300018064 | Tropical Peatland | MLEEKDFQRKADEAFEDLKKRLLILGDEHGFDVEGEAGKLEVL |
Ga0187772_102923413 | 3300018085 | Tropical Peatland | MLSEHDFQKKADAAFEDLKRRLLTLGDEHGFDVEGESGKLEV |
Ga0187770_101425603 | 3300018090 | Tropical Peatland | MLTEHDFQKKADEAFDDLRRRLLTLGDEYAFDVEGESGKLEV |
Ga0187770_103604853 | 3300018090 | Tropical Peatland | MLAEHDFQKKADALFDDLKKRLLNLGDEHDFDVEGESGKLEVIFEE |
Ga0187770_106260853 | 3300018090 | Tropical Peatland | MLSEHDFQNKADAAFEVLKNRLLKLGDEHGFDVEGESG |
Ga0066667_122739521 | 3300018433 | Grasslands Soil | MMDEREFQKKCDAAFEELKRRLLPLSDEHGFDVEGES |
Ga0066669_115973061 | 3300018482 | Grasslands Soil | MATLDEREVQKKCELLFEQLKRRVLKVGDARGFDVEGESARP |
Ga0179592_105248772 | 3300020199 | Vadose Zone Soil | MLSEYDFQKKADLAFEDLKKRLLNLGDEHGFDVEGESGKLEVIFE |
Ga0210407_104414311 | 3300020579 | Soil | MLSEHDFQKKADLAFEDLKKRLLNLGDEHGFDVEGESGKLEVIF |
Ga0210407_114508032 | 3300020579 | Soil | MLEEKDFQRKADGAFEELKRRLLTLGDAHGFDVEGESGKLEVIFEEP |
Ga0210407_114513371 | 3300020579 | Soil | MLEEKDFQRKADAAFEDLKKRLLTLGDEQGFDVEGQSGK |
Ga0210403_104182581 | 3300020580 | Soil | MLDEQDFRRKADAAFEDLKRRLLTLGDEHGFDVAGESGKLEVI |
Ga0210403_105059581 | 3300020580 | Soil | MLEEKDFQRKADAAFAELKKRLLVVADEHDFDVEGESGKLEVI |
Ga0210403_107210652 | 3300020580 | Soil | MLEEKDFQRKADAAFADLKKRLLVLADEHGFDVEGESGKLE |
Ga0210395_107705352 | 3300020582 | Soil | MLEEKDFQRKADDAFAELKKRLLVVADEHDFDVEGESGKLEV |
Ga0210395_108844841 | 3300020582 | Soil | MLEEKDFQRKADAAFDDLKKRLLTLGDEQGFDVEGQSGKLEVI |
Ga0210395_109604442 | 3300020582 | Soil | MLEEKDFQRKADAAFEDLKRRMLTAGDEHDFDVEGESGKLEVLFEEPEE |
Ga0215015_102419882 | 3300021046 | Soil | MLEEKDFQRKADAAFEDLKKRLLVLGDEHGFDVEGEAG |
Ga0210400_101097184 | 3300021170 | Soil | MLEEKDFQRKADDAFAELKKRLLVVADEHDFDVEG |
Ga0210405_103680773 | 3300021171 | Soil | MLSEHDFQKKADLAFEDLKKRLLNLGDAHGFDVEG |
Ga0210388_104106411 | 3300021181 | Soil | MIDEKDFTKKADAAFEDLKKRMLTLGDEHGFDVEGESGKLEVIFEEPE |
Ga0210388_113080931 | 3300021181 | Soil | MLSEHDFQKNADALFEELKKRLLRLGDEHGFDVEGESGKLEVIFEEPEP |
Ga0210386_104958513 | 3300021406 | Soil | MLDEQDFRRKADAAFEDLKRRLLTLGDEHGFDVEGESGKLE |
Ga0210402_103594971 | 3300021478 | Soil | MLEEKDFQRKADAAFEELKKRLLVVADEHGFDVEG |
Ga0210402_107574382 | 3300021478 | Soil | MLEEKEFQRKADAAFEELKKRLLVVADEHGFDVEGES |
Ga0210402_115530432 | 3300021478 | Soil | MYANCMLEEKDFQRKADDAFENLKKRLLILGDQHGFDVEGESGKLEV |
Ga0210402_120085201 | 3300021478 | Soil | MATLDEHEFQRKSGAAFEELKRRMLDAGDEHGFDVEGESGKL |
Ga0210409_104116014 | 3300021559 | Soil | MYAKYMLDEKDFQRKADTAFEDLKKRLLVLGDEHG |
Ga0242652_10486421 | 3300022510 | Soil | MLEEKDFQRKADAAFEELKKRLLVVADELGFDVEG |
Ga0242660_10892192 | 3300022531 | Soil | MLSEHHFQKKADLAFEDLKKRLLNLGDEHGFDVEGESG |
Ga0242654_100175221 | 3300022726 | Soil | MLSEHDFQKNADALFEELKKRLLRLGDEHGFDVEGES |
Ga0247676_10538182 | 3300024249 | Soil | MLDERDFQKKCEAAFDDLKRRMLNAGDAHGFDVEGESGKLEVLF |
Ga0247676_10577862 | 3300024249 | Soil | MLSEHDFQKKADLAFEALKKRLLNLGDEHGFDVEGESGKLEVIFEE |
Ga0247679_10960411 | 3300024251 | Soil | MLSEHDFQKKADLAFEDLKKRLLNLGDAHGFDVEGESGKLE |
Ga0179589_100339523 | 3300024288 | Vadose Zone Soil | MAALDERDFQKKSAAAFEELKRRMLEAGDEHGFDVEGESGKLE |
Ga0137417_13959492 | 3300024330 | Vadose Zone Soil | MYAKCMLDEKDFQRKADSAFEELKRRMLTAGDEHGFDVEGESGKLEVIFEELRRPSS |
Ga0208692_10493291 | 3300025472 | Peatland | MLAEHDFQKKADALFDDLKKRLLNLGDEHDFDVEGESGKLEVIFEEP |
Ga0207699_104958551 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MLDEKDFQKKADAAFEELKRRLLALGDEHGFDVEGESGKLEVI |
Ga0207693_108812111 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MPMLEERDFQKKCEAALDELKRRLLDAGDEHGFDVEGESGKLEV |
Ga0207646_106095523 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MPMLEERDFQKKCEAALEELKRRLLHAGDEHGFDVEGESGKLEVVF |
Ga0207665_111978251 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MLDEKDFQKKADAAFEELKRRLLALGDEHGFDVEGESGKLEVIF |
Ga0207658_121570971 | 3300025986 | Switchgrass Rhizosphere | MPMLEERDFQKKCEAALEELKRRLLHAGDEHGFDVEGESGK |
Ga0209154_12941061 | 3300026317 | Soil | MYAKCMLDEKDFQRKADAAFEELKRRMLTAGDEHGFDVEGESGKLEVIFEE |
Ga0209158_10152684 | 3300026333 | Soil | MYAKCMLDEKDFQRKADAAFEDLRRRMLTDGDEHGFDVEGESG |
Ga0257153_10108831 | 3300026490 | Soil | MAALDERDFQKKSGAAFEELKRRMLEAGDEHGFDVEGESGKLEVIFEE |
Ga0257168_11056851 | 3300026514 | Soil | MYAKCMLDEKDFQRKADSAFEELKRRMLTAGDEHGFDVEGESGKLEVI |
Ga0257168_11501512 | 3300026514 | Soil | MLDEKDFQRKADAAFEELKRRLLALGDAHGFDVEGESGKLEVIFEQPEE |
Ga0209161_101514503 | 3300026548 | Soil | MLDEKDFQRKADSAFEDLKRRMLTAGDEHGFDVEGEAGKLEVLFEEPEEA |
Ga0209648_100725103 | 3300026551 | Grasslands Soil | MYAKCMLDEKDFQRKADAAFDDLKRRMLTAGDEHGFDVEGESGKLEVLFEEPE |
Ga0179587_102460691 | 3300026557 | Vadose Zone Soil | MATLDERGFQKKSEGTFEELKRRMLEAGDEHGFDVEG |
Ga0179587_110473691 | 3300026557 | Vadose Zone Soil | MLDERDFQKKCDTALEELKRRMLTAGDAHGFDVEGESGKLEVLFEEPEEAKF |
Ga0207782_1157141 | 3300026835 | Tropical Forest Soil | MLTELEFQKKADATFEELKRRLLTAGDEHDFDVEGES |
Ga0207764_1205531 | 3300026839 | Tropical Forest Soil | MLTELEFQKKADATFEELKRRLLTAGDEHDFDVEGESGKIEVIFEEP |
Ga0207804_1136682 | 3300026849 | Tropical Forest Soil | MLSEHDFQKKADAAFEDLKRRLLRLGDEHDFDVEGESGK |
Ga0207858_10096583 | 3300026909 | Tropical Forest Soil | MLSESEFQKKADAIFDELKRRLLTAGDEHDFDVEGESGKIEVIF |
Ga0207780_10439042 | 3300027313 | Tropical Forest Soil | MLSEHDFQKKSDALFEELKKRLLQQGDIHDFDVEGQSGK |
Ga0209422_10496753 | 3300027629 | Forest Soil | MLNEKDFQRKADAAFEELKRRLLALGDAHGFDVEGESGKLEVIFEEPE |
Ga0209076_11398392 | 3300027643 | Vadose Zone Soil | MLDEKDFQRRADAAFEDLKRRMLAAGDEHGFDVEGESGKLEVLFEEPVEAK |
Ga0209626_11390102 | 3300027684 | Forest Soil | MLDEKDFQRKADAAFDDLKRRLLTLGDEHGFDVEGQS |
Ga0209446_11672862 | 3300027698 | Bog Forest Soil | MLDEKDFQRKADTAFTDLKKRLLTAGDVFDFDVEGESGKLEVLFEDPEEAK |
Ga0209178_12541841 | 3300027725 | Agricultural Soil | MLDEKDFQKKADSAFLELKKRLLVLADEHGFDVEGESGK |
Ga0209328_102570631 | 3300027727 | Forest Soil | MLDEKEFQRKADTAFEDLKRRLLVVGDEHGFDVEGESGKLEVIFE |
Ga0209074_103415621 | 3300027787 | Agricultural Soil | MLEEKDFQRKADAAFDDLKKRLLTLGDAHGFDVEGESGKLEVIF |
Ga0209773_102508721 | 3300027829 | Bog Forest Soil | MLDEQDFQRKADTAFTELKKRLLTAGDVFDFDVEGESGKLEVLFEEPEETKF |
Ga0209274_106933581 | 3300027853 | Soil | MLEEKDFQRKADAAFEELKKRLLVVADEHGFDVEGESGKL |
Ga0209693_106233462 | 3300027855 | Soil | MLAEHDFQKKADTAFEQLKKKLLLLGDEHGFDVEGESGKLEV |
Ga0209380_100298535 | 3300027889 | Soil | MLEEKDFQRKADGAFEELKRRLLTLGDAHGFDVEGESG |
Ga0209583_107426681 | 3300027910 | Watersheds | MLDEKDFQRKADAAFEDLKKRLLTAGDEHGFDVEGESGK |
Ga0247675_10513161 | 3300028072 | Soil | MAILDERDFQKKCAAALEDLKRRLLDAGDKNGFDVEGESGKLEVVFEEP |
Ga0268264_103590751 | 3300028381 | Switchgrass Rhizosphere | MPTLEERDFQKKCEAALEELKRRLLDAGDEHGFDVEGESGKLEVVFE |
Ga0308309_100061131 | 3300028906 | Soil | MLEEKDFQRKADAAFAELKKRLLVLADEHGFDVEGESGKLEVIFEEP |
Ga0075405_120248042 | 3300030847 | Soil | MLEEKDFQRKADAAFEDLKKRLLTAGDAHGFDVEGESGK |
Ga0075388_100489371 | 3300030848 | Soil | MLSEHDFQKKADLAFEDLKKRLLNLGDEHGFDVEGESGKLEVIFE |
Ga0075371_115640802 | 3300030974 | Soil | MATLDEREFQKKSEGTFEALKRRMLEAGDEHGFDVEGE |
Ga0170824_1041915912 | 3300031231 | Forest Soil | MLSEHDFQKNADALFEELKKRLLRLGDEHGFDVEGESG |
Ga0170824_1213562512 | 3300031231 | Forest Soil | MLSEHDFQKKADLAFEDLKKRLLNLGDAHGFDVEGESGKLEVIFEEP |
Ga0170818_1099672481 | 3300031474 | Forest Soil | MLEEKDFQRKADAAFEDLKKRLLTAGDAHGFDVEGESGKLEVLF |
Ga0310686_1167490431 | 3300031708 | Soil | MGNRMLSEHDFQKKADGAFDDLKRRILKLGDEHGFDVEGESGKL |
Ga0307476_108438592 | 3300031715 | Hardwood Forest Soil | MATLDERDFQKKCDAVLETLKRRLLDAGDAHGFDVEGESGKLEVIFEEPK |
Ga0307474_110602772 | 3300031718 | Hardwood Forest Soil | MLEEKDFQRKADAAFEDLKKRLLTAGDYYDFDVEGESGKLE |
Ga0307469_105010641 | 3300031720 | Hardwood Forest Soil | MLEEKDFQRKADAAFAELKKRLLVLADEHDFDVEGE |
Ga0307469_106001261 | 3300031720 | Hardwood Forest Soil | MATLDEHEFQRKSGAAFEELKRRMLDAGDKHGFDVEGESGKLEV |
Ga0307469_114562531 | 3300031720 | Hardwood Forest Soil | MLEEKDFQRKADAAFDDLKKRLLVLGDEHGFDVEGESGKL |
Ga0318501_103203111 | 3300031736 | Soil | MLTELEFQKKADATFDELKRRLLTAGDEHDFDVEGESGKI |
Ga0306918_101658833 | 3300031744 | Soil | MATLDERDFQKKCDTALGELKHRLLEAGDAHGFDVE |
Ga0307477_100727391 | 3300031753 | Hardwood Forest Soil | MLEEKDFQRKADAAFDDLKKRLLALGDAHGFDVEGESGKLE |
Ga0307477_103123522 | 3300031753 | Hardwood Forest Soil | MLDEQDFHHKADAAFDDLKKRMLTAGDEHGFDVEG |
Ga0306925_115660252 | 3300031890 | Soil | MLAEKDFERRADAAFLELKKRLLVAGDEHGFDVEGESGKLEVLFEEPEEAKF |
Ga0318520_108430481 | 3300031897 | Soil | MATLDERDFQKKCDTALGELKHRLLEAGDAHGFDVEGESGKLEVIFEEPE |
Ga0310912_111281812 | 3300031941 | Soil | VTGMLSELEFQKKADATFDELKRRLLTASDEHDFDVEGESGKIEVIFEEP |
Ga0310913_101227583 | 3300031945 | Soil | MLEEKDFQRKADVAFEDLKKRLLALGDEHGFDVEGES |
Ga0310909_114435381 | 3300031947 | Soil | MLEERDFQKKCEAALEELKGRLLDAGDRHGFDVEGESGKL |
Ga0306926_124924112 | 3300031954 | Soil | MGMLSELEFQKKADTTFDELKRRLLTASDEHDFDVEGE |
Ga0307479_101733903 | 3300031962 | Hardwood Forest Soil | MLDEKDFQRKADAAFEDLKRRLLTLGDEHGFDVEGESGKLEVI |
Ga0307479_111346732 | 3300031962 | Hardwood Forest Soil | MDEKDFQRKADAAFDDLKRRLLTVGDEHGFDVEGESGKLEV |
Ga0318563_104216971 | 3300032009 | Soil | MPMLEERDFQKKCEAALEELKGRLLDAGDRHGFDVEGESGKLEVVFE |
Ga0310911_101999481 | 3300032035 | Soil | MGMLSELEFQKKADTTFDELKRRLLTASDEHDFDVEGESGKIEVIFEE |
Ga0310911_107894142 | 3300032035 | Soil | MAVLGEREFQRNSDAAFAELKGRLLDAGDQHGFDVEGESGKLEVIFEEPS |
Ga0318510_104007421 | 3300032064 | Soil | MLTEFEFQKKADATFEELKRRLLTAGDEHDFDVEGESGKI |
Ga0318525_104066082 | 3300032089 | Soil | MLTELEFQKKADATFEELKRRLLTAGDEHDFDVEGESGKIDV |
Ga0318577_100421351 | 3300032091 | Soil | MLEEKDFQRKADTAFDDLKKRLLTLGDTHGFDVEGESGKLEVIF |
Ga0311301_100342591 | 3300032160 | Peatlands Soil | MLTEHDFQKKADAAFEDLKRRMLTLGDEHGFDVEGVSGKLEV |
Ga0307470_108935461 | 3300032174 | Hardwood Forest Soil | MDEKDFQRKADAAFEDLKRRLLTLGDEHGFDVEGESGKLEVIFEDPE |
Ga0307471_1016594092 | 3300032180 | Hardwood Forest Soil | MATLNEHEFQVKSGTAFEELKRRMLDAGDEHGFDV |
Ga0307471_1018613542 | 3300032180 | Hardwood Forest Soil | MYAKCMLDEKDFQRRADAAFEDLKRRMLTAGDEHGFDVE |
Ga0307471_1034581682 | 3300032180 | Hardwood Forest Soil | MLSEHDFQKKSDALFEELKKRLLHQGDIHDFDVEGESG |
Ga0307471_1041595571 | 3300032180 | Hardwood Forest Soil | MLEEQDFHHKADAAFEDLKKRMLTAGDEHGFDVEGESGKLEVIF |
Ga0307472_1005524413 | 3300032205 | Hardwood Forest Soil | MLSEHDFQKKADAAFEDLKQRLLKIGDEHGFDVEGESGKLEVIFD |
Ga0306920_1020625292 | 3300032261 | Soil | MLEEKDFQRKADAAFEDLKKRLLLLGDEHGFDVEGEA |
Ga0335079_102367561 | 3300032783 | Soil | MLEEKDFQRKADEAFEDLKKRLLILGDEHGFDIEGEAGK |
Ga0335080_123035781 | 3300032828 | Soil | MLEEHDFQKKCGDAFDELKRRMLQAGDEHGFDVEGESGKLEVI |
Ga0335081_101563034 | 3300032892 | Soil | MLSEHDFQKKADAAFDDAKKRLLKLGDEHGFDVEGESGKL |
Ga0310811_110298112 | 3300033475 | Soil | MLEEKDFQRKADAAFGELKKRLLALADEHDFDVEGESGKLEVIFE |
Ga0334854_036929_1_153 | 3300033829 | Soil | VLDEKDFQRKADAAFEELKKRMLAAGDVHGFDVEGESGKLEVLFEEPEEAK |
⦗Top⦘ |