NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F022076

Metagenome / Metatranscriptome Family F022076

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F022076
Family Type Metagenome / Metatranscriptome
Number of Sequences 216
Average Sequence Length 82 residues
Representative Sequence MNEIKGTRMPDYSGVSKDRDIYGELGWIPNFNVKCSKNNDARHGTNREYFDGPMNYHVTFNNSTMTNSEFFR
Number of Associated Samples 150
Number of Associated Scaffolds 216

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 35.35 %
% of genes near scaffold ends (potentially truncated) 31.48 %
% of genes from short scaffolds (< 2000 bps) 96.76 %
Associated GOLD sequencing projects 137
AlphaFold2 3D model prediction Yes
3D model pTM-score0.17

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (99.537 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(27.315 % of family members)
Environment Ontology (ENVO) Unclassified
(56.019 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(68.519 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 10.00%    β-sheet: 0.00%    Coil/Unstructured: 90.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.17
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 216 Family Scaffolds
PF01602Adaptin_N 1.85



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.54 %
UnclassifiedrootN/A0.46 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2043231002|Landsort10m_GCH9ZVC01DII1CAll Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani530Open in IMG/M
3300000130|SA_S2_NOR15_50mDRAFT_c10235624All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani567Open in IMG/M
3300000136|KGI_S1_ANT02_95mDRAFT_c10117229All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani677Open in IMG/M
3300000949|BBAY94_10106089All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani769Open in IMG/M
3300001354|JGI20155J14468_10227162All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani550Open in IMG/M
3300001816|ACM41_104519All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani517Open in IMG/M
3300002835|B570J40625_100763788All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani855Open in IMG/M
3300002835|B570J40625_100960915All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani733Open in IMG/M
3300004788|Ga0007742_10897392All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani540Open in IMG/M
3300005069|Ga0071350_1043298All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1247Open in IMG/M
3300005516|Ga0066831_10005190All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium3590Open in IMG/M
3300005838|Ga0008649_10245941All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani682Open in IMG/M
3300005941|Ga0070743_10012138All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani3032Open in IMG/M
3300006165|Ga0075443_10144865All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani836Open in IMG/M
3300006165|Ga0075443_10220456All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani683Open in IMG/M
3300006425|Ga0075486_1683810All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani850Open in IMG/M
3300006641|Ga0075471_10210726All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1009Open in IMG/M
3300006803|Ga0075467_10274336All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani906Open in IMG/M
3300006803|Ga0075467_10385439All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani731Open in IMG/M
3300007169|Ga0102976_1177249All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1120Open in IMG/M
3300007513|Ga0105019_1021602All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium4431Open in IMG/M
3300007548|Ga0102877_1144703All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani673Open in IMG/M
3300007864|Ga0105749_1131598All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani576Open in IMG/M
3300007956|Ga0105741_1096367All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani723Open in IMG/M
3300008108|Ga0114341_10238487All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani988Open in IMG/M
3300008108|Ga0114341_10351394All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani740Open in IMG/M
3300008113|Ga0114346_1335075All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani501Open in IMG/M
3300008119|Ga0114354_1118070All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1029Open in IMG/M
3300008938|Ga0103741_1063061All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani724Open in IMG/M
3300008952|Ga0115651_1297319All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1001Open in IMG/M
3300009003|Ga0102813_1062280All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1240Open in IMG/M
3300009003|Ga0102813_1156108All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani711Open in IMG/M
3300009071|Ga0115566_10203220All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1208Open in IMG/M
3300009071|Ga0115566_10259302All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1038Open in IMG/M
3300009071|Ga0115566_10284602All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani979Open in IMG/M
3300009071|Ga0115566_10288762All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani971Open in IMG/M
3300009071|Ga0115566_10448037All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani738Open in IMG/M
3300009071|Ga0115566_10798391All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani519Open in IMG/M
3300009077|Ga0115552_1221655All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani770Open in IMG/M
3300009079|Ga0102814_10459736All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani693Open in IMG/M
3300009080|Ga0102815_10508535All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani674Open in IMG/M
3300009182|Ga0114959_10321496All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani769Open in IMG/M
3300009193|Ga0115551_1123784All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1199Open in IMG/M
3300009263|Ga0103872_1013536All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani892Open in IMG/M
3300009422|Ga0114998_10571616All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani532Open in IMG/M
3300009432|Ga0115005_10316692All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1229Open in IMG/M
3300009432|Ga0115005_10341866All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1181Open in IMG/M
3300009432|Ga0115005_10495860All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani973Open in IMG/M
3300009432|Ga0115005_10657335All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani841Open in IMG/M
3300009432|Ga0115005_10753531All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani783Open in IMG/M
3300009432|Ga0115005_10768715All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani775Open in IMG/M
3300009432|Ga0115005_11199603All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani617Open in IMG/M
3300009434|Ga0115562_1138579All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani918Open in IMG/M
3300009436|Ga0115008_10210173All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1393Open in IMG/M
3300009436|Ga0115008_10211107All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1390Open in IMG/M
3300009436|Ga0115008_10253706All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1251Open in IMG/M
3300009436|Ga0115008_10274211All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1198Open in IMG/M
3300009436|Ga0115008_10287075All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1168Open in IMG/M
3300009436|Ga0115008_10530713All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii842Open in IMG/M
3300009436|Ga0115008_11311330All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani553Open in IMG/M
3300009436|Ga0115008_11590189All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani507Open in IMG/M
3300009441|Ga0115007_10165000All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1424Open in IMG/M
3300009441|Ga0115007_10167356All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1414Open in IMG/M
3300009442|Ga0115563_1147271All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani949Open in IMG/M
3300009466|Ga0126448_1015020All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1896Open in IMG/M
3300009495|Ga0115571_1217575All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani776Open in IMG/M
3300009495|Ga0115571_1220004All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani771Open in IMG/M
3300009495|Ga0115571_1256988All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani701Open in IMG/M
3300009497|Ga0115569_10132148All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1217Open in IMG/M
3300009507|Ga0115572_10323965All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani871Open in IMG/M
3300009544|Ga0115006_10661529All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii918Open in IMG/M
3300009599|Ga0115103_1083629All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani631Open in IMG/M
3300009599|Ga0115103_1165901All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani566Open in IMG/M
3300009599|Ga0115103_1543293All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1083Open in IMG/M
3300009599|Ga0115103_1667792All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1140Open in IMG/M
3300009599|Ga0115103_1787037All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani600Open in IMG/M
3300009606|Ga0115102_10287890All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani516Open in IMG/M
3300009606|Ga0115102_10952512All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani534Open in IMG/M
3300009677|Ga0115104_10138431All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani750Open in IMG/M
3300009677|Ga0115104_10342498All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani585Open in IMG/M
3300009785|Ga0115001_10774501All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani579Open in IMG/M
3300012036|Ga0136600_1036970All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1164Open in IMG/M
3300012408|Ga0138265_1143452All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1096Open in IMG/M
3300012408|Ga0138265_1241612All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1083Open in IMG/M
3300012408|Ga0138265_1328144All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani804Open in IMG/M
3300012415|Ga0138263_1589445All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani541Open in IMG/M
3300012418|Ga0138261_1298457All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1183Open in IMG/M
3300012782|Ga0138268_1389157All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani743Open in IMG/M
3300012952|Ga0163180_10557522All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani865Open in IMG/M
3300012952|Ga0163180_11288512All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani601Open in IMG/M
3300012953|Ga0163179_10251187All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1378Open in IMG/M
3300012953|Ga0163179_11664651All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani579Open in IMG/M
3300012954|Ga0163111_11033977All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani795Open in IMG/M
3300012969|Ga0129332_1276364All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1131Open in IMG/M
3300013004|Ga0164293_10236027All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1299Open in IMG/M
3300016766|Ga0182091_1053450All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani605Open in IMG/M
3300017719|Ga0181390_1124591All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani669Open in IMG/M
3300018410|Ga0181561_10208875All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani952Open in IMG/M
3300018426|Ga0181566_10093647All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani2291Open in IMG/M
3300018622|Ga0188862_1015314All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani705Open in IMG/M
3300018684|Ga0192983_1008440All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii1200Open in IMG/M
3300018692|Ga0192944_1008984All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1247Open in IMG/M
3300018791|Ga0192950_1028619All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani778Open in IMG/M
3300018899|Ga0193090_1117326All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae598Open in IMG/M
3300018928|Ga0193260_10112217All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani590Open in IMG/M
3300018968|Ga0192894_10168888All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani713Open in IMG/M
3300018980|Ga0192961_10153475All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani701Open in IMG/M
3300018983|Ga0193017_10127054All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani858Open in IMG/M
3300019036|Ga0192945_10117004All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani848Open in IMG/M
3300019048|Ga0192981_10088740All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1196Open in IMG/M
3300019048|Ga0192981_10103614All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1113Open in IMG/M
3300019048|Ga0192981_10104491All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1109Open in IMG/M
3300019048|Ga0192981_10178531All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani835Open in IMG/M
3300019048|Ga0192981_10258684All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani663Open in IMG/M
3300019049|Ga0193082_10141198All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1064Open in IMG/M
3300019050|Ga0192966_10175258All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani766Open in IMG/M
3300019123|Ga0192980_1032545All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani997Open in IMG/M
3300019123|Ga0192980_1080258All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani597Open in IMG/M
3300019126|Ga0193144_1055821All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani677Open in IMG/M
3300019149|Ga0188870_10041894All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1097Open in IMG/M
3300020074|Ga0194113_10338466All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1126Open in IMG/M
3300020159|Ga0211734_11355950All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani627Open in IMG/M
3300020160|Ga0211733_10248749All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani778Open in IMG/M
3300020183|Ga0194115_10246344All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani848Open in IMG/M
3300020196|Ga0194124_10144772All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1284Open in IMG/M
3300020205|Ga0211731_10337657All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1271Open in IMG/M
3300020525|Ga0207938_1035892All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani750Open in IMG/M
3300021169|Ga0206687_1585405All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani912Open in IMG/M
3300021350|Ga0206692_1433506All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani818Open in IMG/M
3300021365|Ga0206123_10116130All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1259Open in IMG/M
3300021902|Ga0063086_1061261All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1165Open in IMG/M
3300021913|Ga0063104_1039102All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani967Open in IMG/M
3300021925|Ga0063096_1069930All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani503Open in IMG/M
3300021927|Ga0063103_1089927All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani501Open in IMG/M
3300021927|Ga0063103_1127068All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani582Open in IMG/M
3300021941|Ga0063102_1044393All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani885Open in IMG/M
3300021942|Ga0063098_1087838All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani747Open in IMG/M
3300021950|Ga0063101_1119685All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani844Open in IMG/M
3300021950|Ga0063101_1134107All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani914Open in IMG/M
3300021957|Ga0222717_10156619All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1382Open in IMG/M
3300021962|Ga0222713_10037293All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium3836Open in IMG/M
3300024343|Ga0244777_10388050All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani871Open in IMG/M
3300024343|Ga0244777_10652632All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani633Open in IMG/M
3300025138|Ga0209634_1192967All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani786Open in IMG/M
3300025626|Ga0209716_1178665All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani526Open in IMG/M
3300025680|Ga0209306_1046916All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1403Open in IMG/M
3300025699|Ga0209715_1084614All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1217Open in IMG/M
3300025809|Ga0209199_1296990All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani504Open in IMG/M
3300025849|Ga0209603_1280766All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani591Open in IMG/M
3300025849|Ga0209603_1294363All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani570Open in IMG/M
3300025869|Ga0209308_10170783All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani984Open in IMG/M
3300025869|Ga0209308_10217624All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani837Open in IMG/M
3300025881|Ga0209309_10192945All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani991Open in IMG/M
3300025887|Ga0208544_10231848All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani747Open in IMG/M
3300025887|Ga0208544_10301575All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani624Open in IMG/M
3300025890|Ga0209631_10154088All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1235Open in IMG/M
3300025890|Ga0209631_10188526All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1073Open in IMG/M
3300026182|Ga0208275_1022082All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1347Open in IMG/M
3300027752|Ga0209192_10072687All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1480Open in IMG/M
3300027771|Ga0209279_10049229All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1200Open in IMG/M
3300027771|Ga0209279_10270639All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani520Open in IMG/M
3300027801|Ga0209091_10335424All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani704Open in IMG/M
3300027810|Ga0209302_10108660All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1390Open in IMG/M
3300027810|Ga0209302_10117438All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1326Open in IMG/M
3300027833|Ga0209092_10183549All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1187Open in IMG/M
3300027833|Ga0209092_10300490All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani869Open in IMG/M
3300027833|Ga0209092_10375773All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani750Open in IMG/M
3300027849|Ga0209712_10342945All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani845Open in IMG/M
3300027849|Ga0209712_10390033All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani785Open in IMG/M
3300027885|Ga0209450_10469633All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani920Open in IMG/M
3300028335|Ga0247566_1048652All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani704Open in IMG/M
3300030653|Ga0307402_10764638All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani563Open in IMG/M
3300030671|Ga0307403_10327128All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani819Open in IMG/M
3300030699|Ga0307398_10546370All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani640Open in IMG/M
3300030709|Ga0307400_10597891All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani691Open in IMG/M
3300030709|Ga0307400_10737064All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani611Open in IMG/M
3300030788|Ga0073964_11191241All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani653Open in IMG/M
3300031522|Ga0307388_10200467All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1207Open in IMG/M
3300031522|Ga0307388_10254388All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1091Open in IMG/M
3300031523|Ga0307492_10121460All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani901Open in IMG/M
3300031569|Ga0307489_10058493All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani2139Open in IMG/M
3300031569|Ga0307489_10170391All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1326Open in IMG/M
3300031569|Ga0307489_10346052All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani975Open in IMG/M
3300031710|Ga0307386_10706414All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani539Open in IMG/M
3300031729|Ga0307391_10264579All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani925Open in IMG/M
3300031729|Ga0307391_10633628All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani607Open in IMG/M
3300031734|Ga0307397_10278206All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani756Open in IMG/M
3300031734|Ga0307397_10357105All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani670Open in IMG/M
3300031734|Ga0307397_10417181All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani621Open in IMG/M
3300031734|Ga0307397_10625664All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani505Open in IMG/M
3300031735|Ga0307394_10445871All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani520Open in IMG/M
3300031750|Ga0307389_10793161All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani621Open in IMG/M
3300031758|Ga0315907_10542659All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani912Open in IMG/M
3300031758|Ga0315907_11276467All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani509Open in IMG/M
3300031784|Ga0315899_11136253All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani682Open in IMG/M
3300032463|Ga0314684_10531906All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani688Open in IMG/M
3300032491|Ga0314675_10358441All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani729Open in IMG/M
3300032517|Ga0314688_10206841All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1006Open in IMG/M
3300032518|Ga0314689_10133226All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1231Open in IMG/M
3300032616|Ga0314671_10365442All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani788Open in IMG/M
3300032616|Ga0314671_10464523All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani690Open in IMG/M
3300032617|Ga0314683_10635857All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani655Open in IMG/M
3300032651|Ga0314685_10498379All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani670Open in IMG/M
3300032723|Ga0314703_10274233All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani698Open in IMG/M
3300032727|Ga0314693_10452043All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani701Open in IMG/M
3300032733|Ga0314714_10489573All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani689Open in IMG/M
3300032733|Ga0314714_10631222All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani590Open in IMG/M
3300032742|Ga0314710_10194268All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani822Open in IMG/M
3300032745|Ga0314704_10396911All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani764Open in IMG/M
3300032745|Ga0314704_10418518All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani741Open in IMG/M
3300032745|Ga0314704_10708916All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani542Open in IMG/M
3300032747|Ga0314712_10256885All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani831Open in IMG/M
3300032752|Ga0314700_10220822All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani979Open in IMG/M
3300034022|Ga0335005_0295706All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani964Open in IMG/M
3300034355|Ga0335039_0303139All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani845Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine27.31%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine14.81%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine11.11%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater8.33%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine3.70%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous3.24%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater2.78%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine2.78%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton1.85%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake1.85%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater1.39%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake1.39%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater1.39%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater1.39%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater1.39%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine1.39%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh1.39%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine1.39%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.93%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water0.93%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine0.93%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.93%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater0.46%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment0.46%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.46%
Marine PlanktonEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine Plankton0.46%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater0.46%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater0.46%
Sea-Ice BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine0.46%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine0.46%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine0.46%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater0.46%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater0.46%
Saline LakeEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake0.46%
Meromictic PondEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond0.46%
Macroalgal SurfaceHost-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface0.46%
Surface Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water0.46%
Ice Edge, Mcmurdo Sound, AntarcticaEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ice Edge, Mcmurdo Sound, Antarctica0.46%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
204323100210 m water depthEnvironmentalOpen in IMG/M
3300000130Marine microbial communities from chronically polluted sediments in Adventfjord, Norway - Svalbard Archipelago station 2 sample NOR 15_50mEnvironmentalOpen in IMG/M
3300000136Marine microbial communities from chronically polluted sediments in Antarctica - King George Island site S1 sample ANT 02_9.5mEnvironmentalOpen in IMG/M
3300000949Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY94Host-AssociatedOpen in IMG/M
3300001354Pelagic Microbial community sample from North Sea - COGITO 998_met_05EnvironmentalOpen in IMG/M
3300001816Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM41, ROCA_DNA031_2.0um_3kEnvironmentalOpen in IMG/M
3300002835Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)EnvironmentalOpen in IMG/M
3300004788Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005069Metagenomes from Harmful Algal Blooms in Lake Erie, HABS-E2014-0024EnvironmentalOpen in IMG/M
3300005516Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF49BEnvironmentalOpen in IMG/M
3300005838Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S2LV_130m_DNAEnvironmentalOpen in IMG/M
3300005941Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697EnvironmentalOpen in IMG/M
3300006165Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNAEnvironmentalOpen in IMG/M
3300006425Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006641Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNAEnvironmentalOpen in IMG/M
3300007169Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Bottom layer) 8 sequencing projectsEnvironmentalOpen in IMG/M
3300007513Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 250-2.7um, replicate bEnvironmentalOpen in IMG/M
3300007548Estuarine microbial communities from the Columbia River estuary - metaG 1548B-3EnvironmentalOpen in IMG/M
3300007864Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461B_3.0umEnvironmentalOpen in IMG/M
3300007956Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1459A_0.2umEnvironmentalOpen in IMG/M
3300007981Estuarine microbial communities from the Columbia River estuary - metaG 1556A-3EnvironmentalOpen in IMG/M
3300008108Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NAEnvironmentalOpen in IMG/M
3300008113Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NAEnvironmentalOpen in IMG/M
3300008119Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0110-C-NAEnvironmentalOpen in IMG/M
3300008938Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 4AEnvironmentalOpen in IMG/M
3300008952Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 250-2.7umEnvironmentalOpen in IMG/M
3300009003Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.725EnvironmentalOpen in IMG/M
3300009071Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405EnvironmentalOpen in IMG/M
3300009077Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328EnvironmentalOpen in IMG/M
3300009079Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741EnvironmentalOpen in IMG/M
3300009080Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759EnvironmentalOpen in IMG/M
3300009182Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaGEnvironmentalOpen in IMG/M
3300009193Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321EnvironmentalOpen in IMG/M
3300009263Eukaryotic communities of water from the North Atlantic ocean - ACM27EnvironmentalOpen in IMG/M
3300009422Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138EnvironmentalOpen in IMG/M
3300009432Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M MetagenomeEnvironmentalOpen in IMG/M
3300009434Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516EnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009441Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M MetagenomeEnvironmentalOpen in IMG/M
3300009442Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519EnvironmentalOpen in IMG/M
3300009466Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 2m depth; DNA IDBA-UDEnvironmentalOpen in IMG/M
3300009495Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531EnvironmentalOpen in IMG/M
3300009497Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503EnvironmentalOpen in IMG/M
3300009507Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607EnvironmentalOpen in IMG/M
3300009544Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean- Svalbard ARC20M MetagenomeEnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009606Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009677Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009785Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130EnvironmentalOpen in IMG/M
3300012036Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Filla 2 #698EnvironmentalOpen in IMG/M
3300012408Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 192hr light incubation - RNA23.A_192.20151118 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012415Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA15.ICE_1m.20151115 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012418Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 72hr light incubation - RNA12.A_72.20151113 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012782Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA30.ICE_1m.20151125 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012952Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 4 MetagenomeEnvironmentalOpen in IMG/M
3300012953Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 MetagenomeEnvironmentalOpen in IMG/M
3300012954Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaGEnvironmentalOpen in IMG/M
3300012969Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013004Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaGEnvironmentalOpen in IMG/M
3300016766Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041409AS metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017719Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21EnvironmentalOpen in IMG/M
3300018410Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011510BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018426Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101402AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018622Metatranscriptome of marine microbial communities from Baltic Sea - GS684_3p0_dTEnvironmentalOpen in IMG/M
3300018684Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782225-ERR1712160)EnvironmentalOpen in IMG/M
3300018692Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782155-ERR1712153)EnvironmentalOpen in IMG/M
3300018791Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001390 (ERX1782108-ERR1712085)EnvironmentalOpen in IMG/M
3300018899Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001029 (ERX1809754-ERR1740133)EnvironmentalOpen in IMG/M
3300018928Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_093 - TARA_N000001111 (ERX1789573-ERR1719386)EnvironmentalOpen in IMG/M
3300018968Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000713 (ERX1782205-ERR1712096)EnvironmentalOpen in IMG/M
3300018980Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127)EnvironmentalOpen in IMG/M
3300018983Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_138 - TARA_N000002997 (ERX1782408-ERR1712000)EnvironmentalOpen in IMG/M
3300019036Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782404-ERR1712086)EnvironmentalOpen in IMG/M
3300019048Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782209-ERR1712166)EnvironmentalOpen in IMG/M
3300019049Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_064 - TARA_N000000531 (ERX1782179-ERR1712232)EnvironmentalOpen in IMG/M
3300019050Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001438 (ERX1782371-ERR1711865)EnvironmentalOpen in IMG/M
3300019123Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782390-ERR1712195)EnvironmentalOpen in IMG/M
3300019126Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000695 (ERX1782402-ERR1712043)EnvironmentalOpen in IMG/M
3300019149Metatranscriptome of marine microbial communities from Baltic Sea - GS695_3p0_dTEnvironmentalOpen in IMG/M
3300020074Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200mEnvironmentalOpen in IMG/M
3300020159Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1EnvironmentalOpen in IMG/M
3300020160Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1EnvironmentalOpen in IMG/M
3300020183Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surfaceEnvironmentalOpen in IMG/M
3300020196Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015031 Kigoma Deep Cast 0mEnvironmentalOpen in IMG/M
3300020205Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1EnvironmentalOpen in IMG/M
3300020525Freshwater microbial communities from Lake Mendota, WI - 05MAR2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300021169Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021350Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021365Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1EnvironmentalOpen in IMG/M
3300021902Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-1S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021913Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-130M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021925Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-51M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021927Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-122M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021941Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-120M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021942Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-61M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021950Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-118M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021957Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18DEnvironmentalOpen in IMG/M
3300021962Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649DEnvironmentalOpen in IMG/M
3300024343Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fractionEnvironmentalOpen in IMG/M
3300025138Marine viral communities from the Pacific Ocean - LP-40 (SPAdes)EnvironmentalOpen in IMG/M
3300025626Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 (SPAdes)EnvironmentalOpen in IMG/M
3300025680Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328 (SPAdes)EnvironmentalOpen in IMG/M
3300025699Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503 (SPAdes)EnvironmentalOpen in IMG/M
3300025809Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523 (SPAdes)EnvironmentalOpen in IMG/M
3300025849Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 (SPAdes)EnvironmentalOpen in IMG/M
3300025869Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 (SPAdes)EnvironmentalOpen in IMG/M
3300025881Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412 (SPAdes)EnvironmentalOpen in IMG/M
3300025887Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025890Pelagic Microbial community sample from North Sea - COGITO 998_met_08 (SPAdes)EnvironmentalOpen in IMG/M
3300026182Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF49B (SPAdes)EnvironmentalOpen in IMG/M
3300027752Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 (SPAdes)EnvironmentalOpen in IMG/M
3300027771Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027801Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 (SPAdes)EnvironmentalOpen in IMG/M
3300027810Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027833Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027849Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027885Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW (SPAdes)EnvironmentalOpen in IMG/M
3300028335Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 14R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030653Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-29 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030671Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-34 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030699Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-11 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030709Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-17 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030788Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_R_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031522Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031523Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SI3LEnvironmentalOpen in IMG/M
3300031569Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2EnvironmentalOpen in IMG/M
3300031710Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031729Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031734Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031735Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031750Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031758Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123EnvironmentalOpen in IMG/M
3300031784Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112EnvironmentalOpen in IMG/M
3300032463Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032491Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032517Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032518Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032616Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032617Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032651Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032723Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad8_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032727Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032733Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb12_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032742Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad11_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032745Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad8_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032747Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad11_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032752Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300034022Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Apr2018-rr0058EnvironmentalOpen in IMG/M
3300034355Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Oct2015-rr0135EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
10m_14193302043231002MarineYIHTINNIYDKNLLIKQPVIIKPRREHDPYEMNEIKGTRMPDYSGISKDRDIYGELGWIPNFNVKCAKNNDARHVTNREYFDGPMNYHVTFNNSTMTNSEFFR
SA_S2_NOR15_50mDRAFT_1023562413300000130MarineILLKPRREHDPYEMNEIKGTRMPDYSNISKDRDIYGELGWIPNFNVKCSKNNGKRHATNREYFDGPMNYHVTFNNSTMTNSEFFR*
KGI_S1_ANT02_95mDRAFT_1011722923300000136MarineMNEFKGTRMPDYSKIVKERDVYGELGWIPNFGVKCSKDNTKRHSTNREYFDQPLNYHATFNNSTMTNSEFFR*
BBAY94_1010608913300000949Macroalgal SurfaceMNEIKGTRMPDYSGISKDRDIYGELGWIPNFNVKCAKNNDVRHVTNREYFDGPMNYHVTFNNSTMTNSEFFR*
JGI20155J14468_1022716213300001354Pelagic MarineMNEIKGTRMPDYSNVSKDRDIYGELGWIPNFNVKCSKNNQLRHPHTREYFDGPMNYHVTFNNSTMTNSEFFRQNAPKKSVAKERV*
ACM41_10451923300001816Marine PlanktonVLVKAKREPDPYEMNDIKGTRMPDYSGVSKDRDIYGELGWIPNFNVKCSKNNNVRHSTNREYFDGPMNYHVTFNNSTMTNSEFFR*
B570J40625_10076378813300002835FreshwaterMPDYTGVTKTRDIHGELGWIPNFNVKCSKNNDVRYPTNREFFDGPMNYHVTFNNSTMTNSEFFR*
B570J40625_10096091523300002835FreshwaterMKPKRELDPFEMNEVKGTRMPDYSGVTKDRDIYGELGWIPNFNVKCSKNNEARHVTNREYFDGPMNYHVTFNNSTMTNSEFFR*
Ga0007742_1089739213300004788Freshwater LakeMPDYAGVTKTRDIHGELGWIPNFNVKCSKNNDARYPSNREYFDGPMNYHVTFNNSTMTNSEFFR*
Ga0071350_104329823300005069FreshwaterMPDYTKLSKERDIYGELGWVPNFNVKCSKNNTKLYPTYREFFDIPKNYATTFNNSSMTNPEFFR*
Ga0066831_1000519083300005516MarineMNEIKGTRMPDYSGISKDRDIYGELGWIPNFNIKCSKNNDVRHGGNREYFDGPMNYHVTFNNSTMT
Ga0008649_1024594123300005838MarineMNEIKGTRMPDYSVISKDRDIYGELGWIPNFNVKCSKNNNVRHTTNREYFDGPMNYHVTFNNSTMTNSEFFRQNAPSKSV
Ga0070743_1001213873300005941EstuarineLLKPRREHDPYEMNEIKGTRMPDYSHVSKDRDIYGELGWIPNFNVKCSKNNHIRHVSNREYFDGPMNYHVTFNNSTMTNSEFFR*
Ga0075443_1014486523300006165MarineMPDYTKLAKERDIYGELGWIGNFNVKCSKNNHKLYPTYREFFDGPKNYHNTFNNSTMTNNEFFR*
Ga0075443_1022045623300006165MarineMPDYSNVSKDRDIYGELGWIPNFNVKCSKNNNLRHPTNREYFDGPMNYHVTFNNSTMTNSEFFR*
Ga0075486_168381023300006425AqueousMNEIKGTRMPDYSGVSKDRDIYGELGWIPNFNVKCSKNNDARHTTNREYFDGPMNYHVTFNNSTMTNS*
Ga0075471_1021072623300006641AqueousMPDYTKLALDRDVYGELGWIQNFNVKCSKDNERLYPTYREFFDGPKNYHCRFNTANMTNSEFFR*
Ga0075467_1027433623300006803AqueousMDPYEMNEFKGTRMPDYTEVARDRDIYGELGWIPNFQTKVSKNNNARHADAREYFDGPMNYHTTYNNSTMTNSEFFRHNAPENSVAKEKVQTMSVFNRS*
Ga0075467_1038543913300006803AqueousMDPYEMNEFKGTRMPDYTVVAKDRDIYGELGWIPNFNVKCSKNNDIRHATSREYFDGPMNYHTTFNNSTMTNSEFFR*
Ga0102976_117724923300007169Freshwater LakeVKGTRMPDYSKVSKERDIYGELGWIPNFNVKFSKNNHKLYPTYREFFDYPKNYHNQFNNQTMTNQEFFRQNAP*
Ga0105019_102160213300007513MarineLVKARREHDPYEMNEIKGTRMPDYSGVSKDRDIYGELGWIPNFNVKCSKNNNARHATNREYFDGPMNYHVTFNNSTMTNSEFFR*
Ga0102877_114470323300007548EstuarineMPDYSGVSKDRDIYGELGWIPNFNVKVSKNNDLRHPTMREFFDGPMNYHTTFNNSTMTNSEFFRQNAPSNSVAREKVQTV
Ga0105749_113159813300007864Estuary WaterLVKAKREPDPYEMNDIKGTRMPDYSGVSKDRDIYGELGWIPNFNVKCSKNNNARHGTNREYFDGPMNYHVTFNNSTMTNSEFFRQNAPANSVAREKV*
Ga0105741_109636723300007956Estuary WaterMNEIKGTRMPDYSGVSKDRDIYGELGWIPNFNVKCSKNNNARHATNREYFDGPMNYHVTFNNSTMTNSEFFRQNAPAKSVAREKVQTLSV*
Ga0102904_103091523300007981EstuarineMNQPQRQLDPYDENEVKGTRMPDYTKLSKERDIYGELGWIGNFNVKCSKNNHKLYPTYREFFDGPKNYHNTFNNSTMTNNEFFR*
Ga0114341_1023848713300008108Freshwater, PlanktonMPDYTGVTKNRDIHGELGWIPNFNVKCSKNNNDRYPTNREMFDAPMNYHVSFNNSTMTNSEFFR*
Ga0114341_1035139413300008108Freshwater, PlanktonMPDYSGVTKIRDIHGELGWIPNFNVKCSKNNDARYPTNREYFDGPMNYHVTFNNSTMTNSEFFR*
Ga0114346_133507513300008113Freshwater, PlanktonMPDYSKVSKERDIYGELGWIPNFNVKYSKNNQKLYPTYREFFDYPKNYHNQFNNQTMTNQEFFRQNAP*
Ga0114354_111807013300008119Freshwater, PlanktonMKPKRELDPYEMNEVKGTRMPDYSGVTKDRDIYGELGWIPNFNVKCSKNNDDRHVTNREYFDGPMNYHVTFNNSTMTNSEFFR*
Ga0103741_106306113300008938Ice Edge, Mcmurdo Sound, AntarcticaYSHVSKDRDIYGELGWIPNFNVKCSKNNNARHTGNREYFDGPMNYHVTFNNSTMTNSEFFRQNAPSKSVARERVQTMSV*
Ga0115651_129731923300008952MarineMPDYTVLSKDRDIYGELGWIPNFNVKCSKNNDIRHPTNREYFDGPMNYHVTFNNSTMTNSEFFRQNAPENSVAKERVQTMSVFNKSALGSTMRST*
Ga0102813_106228023300009003EstuarineMNEIKGTRMPDYSVISKDRDIYGELGWIPNFNVKCSKNNDARHTTNREYFDGPMNYHVTFNNSTMTNSEFFRQNAPSKSVARERV*
Ga0102813_115610813300009003EstuarineMNEIKGTRMPDYSGISKDRDIYGELGWIPNFNVKCSKNNDDRHVTNRETFDGPMNYHVTFNNSTMTNSEFFRQNAPSKSVARERVQTMSV*
Ga0115566_1020322013300009071Pelagic MarineMNEIKGTRMPDYSNVSKDRDIYGELGWIPNFNVKCSKNNTKRHPTNREYFDGPMNYHVTFNNSTMTNSEFFRQNAPNKSVARERVQTMSVQNRSKYGSTMRSTQSTF*
Ga0115566_1025930213300009071Pelagic MarineLKPRREHDPYEMNEIKGTRMPDYSHVSKDRDIYGELGWIPNFNVKCSKNNNARHTTNREYFDGPMNYHVTFNNSTMTNSEFFRQNAPSKSVARERVQTMSV*
Ga0115566_1028460223300009071Pelagic MarineLKPRRENDPYEMNEIKGTRMPDYSNVSKDRDIYGELGWIPNFNVKCSKNNQLRHPHTREYFDGPMNYHVTFNNSTMTNSEFFRQNAPKKSVAKERV*
Ga0115566_1028876213300009071Pelagic MarineMKPRRENDPYEMNEIKGTRMPDYSNVSKDRDIYGELGWIPNFNVKCSKNNNLKHPASREYSDGPMNYHVTFNNSTMTNSEFFR*
Ga0115566_1044803723300009071Pelagic MarineLLKPRRENDPYEMNEIKGTRMPDYSNVSKDRDIYGELGWIPNFNVKCSKNNDLRYPTNREYFDGPMNYHVTFNNSTMTNSEFFR*
Ga0115566_1079839123300009071Pelagic MarineLKPRREHDPYEMNEIKGTRMPDYSHVSKDRDIYGELGWIPNFNVKCSKNNHIRHVSNREHFDGPMNYHVTFNNSTMTNSEF
Ga0115552_122165513300009077Pelagic MarineGTRMPDYSNVSKDRDIYGELGWIPNFNVKCSKNNNLKHPASREYFDGPMNYHVTFNNSTMTNSEFFR*
Ga0102814_1045973613300009079EstuarineMPDYSGVSKDRDIYGELGWIPNFNVKVSKNNDLRHPTMREFFDGPMNYHTTFNNSTMTNSEFFRQNAPSNSVAREKVQTVSVFNKSA
Ga0102815_1050853513300009080EstuarineMPDYSGVSKDRDIYGELGWIPNFNVKVSKNNDLRHPTMREFFDGPMNYHTTFNNSTMTNSEFFRQNAPSNSVAREKVQTVS
Ga0114959_1032149623300009182Freshwater LakeMPKRELDPYEMNEVRGTRMPEYSGVTKNRDIHGELGWIPNFNVKCSKNNDKRHPGNREYFDGPMNYHCTFNNSTMTNSEFFR*
Ga0115551_112378423300009193Pelagic MarineMKPRRENDPYEMNEIKGTRMPDYSNVSKDRDIYGELGWIPNFNVKCSKNNNLKHPASREYFDGPMNYHVTFNNSTMTNSEFFR*
Ga0103872_101353613300009263Surface Ocean WaterLKPRREHDPYEMNEIKGTRMPDYSGVSKDRDIYGELGWIPNFNVKCSKNNNLRHVTNREYFDAPMNYHVTFNNSTMTNSEFFRQNAPSKSVARERVQTMSV*
Ga0114998_1057161613300009422MarineMNDIKGTRMPDYSGVSKDRDIYGELGWIPNFNVKCSKNNNARHGTNREYFDGPMNYHVTFNNSTMTNSEFFRQNAPANSVAREKV*
Ga0115005_1031669233300009432MarineMNEIKGTRMPDYSGISKDRDIYGELGWIPNFNVKCAKNNDDRHTTNREYFDGPMNYHVTFNNSTMTNSEFFRQNAPSKSVARERV*
Ga0115005_1034186623300009432MarineMNEIKGTRMPDYSGISKDRDIYGELGWIPNFNVKCSKNNDDRHVTNRETFDGPMNYHVTFNNSTMTNSEFFR*
Ga0115005_1049586013300009432MarineMNEIKGTRMPDYSGISKDRDIYGELGWIPNFNVKCAKNNDDRHVTNREYFDGPMNYHVTFNNSTMTNSEFFRQNAPSKSVARERVQTMSV*
Ga0115005_1065733523300009432MarineMNEIKGTRMPDYSGISKDRDIYGELGWIPNFNVKCSKNNDDRHVTNRETFDGPMNYHVTFNNSTMTNSEFFRQNAPSKSVARERV*
Ga0115005_1075353113300009432MarineMPDYSGISKDRDIYGELGWIPNFNVKCSKNNDDRHVTNRETFDGPMNYHVTFNNSTMTNSEFFRQNAPSKSVARERVQTMSVQNKSKYGSSMRST*
Ga0115005_1076871513300009432MarineMNEIKGTRMPDYSGISKDRDIYGELGWIPNFNVKCSKNNDDRHVTNRETFDGPMNYHVTFNNSTMTNSEFFRQNAPSKSVARERVQTMSVQNKSKYGSSMRST*
Ga0115005_1119960313300009432MarineVLLKPRREHDPYEMNEIKGTRMPDYSGLSKDRDIYGELGWIPNFNVKCSKNNNKRHTGNREYFDGPMNYHVTFNNSTMTNSEFFR*
Ga0115562_113857913300009434Pelagic MarineMNEIKGTRMPDYSNVSKDRDIYGELGWIPNFNVKCSKNNDVRHPTNREFFDGPMNYHVTFNNSTMTNSEFFR*
Ga0115008_1021017333300009436MarineMNEIKGTRMPDYSGISKDRDIYGELGWIPNFNVKCSKNNDLRHPTNREYFDGPMNYHVTFNNSTMTNSEFFRQNAPAKSVAREKVQTLSV*
Ga0115008_1021110733300009436MarineVLLKPRREHDPYEMNEIKGTRMPDYSGVSKDRDIYGELGWIPNFNVKCSKNNNKRHTGNREYFDGPMNYHVTFNNSTMTNSEFFR*
Ga0115008_1025370623300009436MarineMNEIKGTRMPDYSGVSKDRDIYGELGWIPNFNVKCSKNNNKRHTGNREYFDGPMNYHVTFNNSTMTNSEFFR*
Ga0115008_1027421123300009436MarineMNEIKGTRMPDYSGISKDRDIYGELGWIPNFNVKCAKNNDVRHTTNREYFDGPMNYHVTFNNSTMTNSEFFR*
Ga0115008_1028707513300009436MarineMNEIKGTRMPDYSGISKDRDIYGELGWIPNFNVKCSKNNEARHVTNRETFDGPMNYHVTFNNSTMTNSEFFRQNAPSKSVARERV*
Ga0115008_1053071323300009436MarineLDPYDENEVKGTRMPDYTKLAQERDIYGELGWINNWNVKCSKNNTKLYPTYREYFDGPRNYHTTFNNSTMTNNEFFR*
Ga0115008_1131133013300009436MarineMNEIKGTRMPDYSAVSKDRDIYGELGWIPNFNVKCSKNNVIRHPSNREYFDGPMNYHVTFNNSTMTNSEFFRQNAPNRSVAKEKVQTLSV*
Ga0115008_1159018913300009436MarineMNEIKGTRMPDYSNISKDRDIYGELGWIPNFNVKCSKNNDVRHPTNREFFDGPMNYHVTFNNSTMTNSEFFR*
Ga0115007_1016500023300009441MarineLLKPRREHDPYEMNEIKGTRMPDYSGVSKDRDIYGELGWIPNFNVKCSKNNNQRHGGNREYFDGPMNYHVTFNNSTMTNSEFFRQNAPEKSVARERVQTMSV*
Ga0115007_1016735633300009441MarineMPDYTKLAKERDIYGELGWISNFNVKCSKNNNKLYPTYREYFDGPKNYFTTFNNSTMTNNEFFR*
Ga0115563_114727123300009442Pelagic MarineMNEIKGTRMPDYSNVSKDRDIYGELGWIPNFNVKCSKNNNLRHPTNREYFDGPMNYHVTFNNSTMTNSEFFR*
Ga0126448_101502033300009466Meromictic PondMPDYSGVSKDRDIYGELGWIPNFNVKCSKNNGVRHVTNREYFDGPMNYHVTFNNSTMTNSEFFR*
Ga0115571_121757513300009495Pelagic MarineMNEIKGTRMPDYSGISKDRDIYGELGWIPNFNIKCSKNNDARHVTNRETFDGPMNYHVTFNNSTMTNSEFFRQNAPSKSVARERVQTMSV*
Ga0115571_122000413300009495Pelagic MarineTRMPDYSGISKDRDIYGELGWIPNFNVKCSKNNDDRHVTNRETFDGPMNYHVTFNNSTMTNSEFFRQNAPSKSVARERV*
Ga0115571_125698813300009495Pelagic MarineMNEIKGTRMPDYSGISKDRDIYGELGWIPNFNVKCAKNNDARHVTNREYFDGPMNYHVTFNNSTMTNSEFFR*
Ga0115569_1013214823300009497Pelagic MarineMNEIKGTRMPDYSNVSKDRDIYGELGWIPNFNVKCSKNNDVRHPTNREFFDGPMNYHVTFNNSTMTNSEFFRQNAPVKSVAREKVQTMSV*
Ga0115572_1032396523300009507Pelagic MarineMNEIKGTRMPDYSTVSKDRDIYGELGWIPNFNVKCSKNNNIRHPANREYFDGPMNYHVTFNNSTMTNSEFFRQNAPKRSVAKERVQTMSVQNRSKYGSTMRST*
Ga0115006_1066152923300009544MarineMLKPHRTIDPYDENEIKGTRMPDYAKVAKDRDIYGELGWVNNWSIKCSKENNKRHPTYREYFDGPKNYNTTFNNATMTNSEFFRSNAPKSSVARVTR*
Ga0115103_108362913300009599MarineNDVKGTRMPDYTTVSKERDIYGELGWIPNFNIKCSKNNKARHITNREYFDGPMNYHATFNNSTMTNSEFFR*
Ga0115103_116590113300009599MarineMNEIKGTRMPDYSGISKDRDIYGELGWIPNFNVKCSKNNDDRHVTNRETFDGPMNYHVTFNNSTMTNSEF
Ga0115103_154329313300009599MarineMDPYDENEVKGTRIPEYSRIAKDRDVYGELGWISNFNVKCSKSNAKRHTSFREYFDDPKNYHTTFTNSTLTNSEFFR*
Ga0115103_166779223300009599MarineMNDVKGTRMPDYTSVSKERDIYGELGWIPNFNVKCSKNNKVSHISNREYFDGPLNYHATFNNSTMTNSEFFR*
Ga0115103_178703723300009599MarineMNEIKGTRMPDYSGVSKDRDIYGELGWIPNFNVKCSKNNNARHATNREYFDGPMNYHVTFNNSTMTNSEFFRQNAPAKSV
Ga0115102_1028789013300009606MarineMNDVKGTRMPDYTSVSKERDIYGELGWIPNFNVKCSKNNQVRHVANREYFDGPMNYHATFNNSTMTNSEFFRQNAPSKSVARERV*
Ga0115102_1095251213300009606MarineKREPDPYEMNDIKGTRMPDYSGVSKDRDIYGELGWIPNFNVKCSKNNNARHGTNREYFDGPMNYHVTFNNSTMTNSEFFRQNAPANSVAREKV*
Ga0115104_1013843123300009677MarineMNEIKGTRMPDYSGVSKDRDIYGELGWIPNFNVKCSKNNGKRHTGNREYFDGPMNYHVTFNNSTMTNSEFFR*
Ga0115104_1034249813300009677MarineEIKGTRMPDYSNISKDRDIYGELGWIPNFNVKCSKNNNLRHPSNREYFDGPMNYHVTFNNSTMTNSEFFR*
Ga0115001_1077450123300009785MarineEIKGTRMPDYSGVSKDRDIYGELGWIPNFNVKCSKNNNARHATNREYFDGPMNYHVTFNNSTMTNSEFFRQNAPAKSVAREKVQTLSV*
Ga0136600_103697023300012036Saline LakeMPDYSKVTKDRDVYGELGWIPNFFVKCSKDNTKRHSTNREYFDQPLNYHATFNNSTMTNSEFFRLNAPGNSVAKERI*
Ga0138265_114345223300012408Polar MarineMNEIKGTRMPDYSGISKDRDIYGELGWIPNFNVKCSKNNDARHVTNRETFDGPMNYHVTFNNSTMTNSEFFRQNAPSKSVARERV*
Ga0138265_124161233300012408Polar MarineMNEIKGTRMPDYSGISKDRDIYGELGWIPNFNVKCAKNNDARHVTNREYFDGPMNYHVTFNNSTMTNSEFFRQNAPSKSVARERV*
Ga0138265_132814423300012408Polar MarineRELSQQKIMDPYDENEVKGTRIPEYSKIAKDRDVYGELGWISNFNVKCAKNNNNRHTSFREYFDDPKNYHVTFTNSTLTNSEFFR*
Ga0138263_158944513300012415Polar MarineRINKPRREHDPYEMNEIKGTRMPDYSGISKDRDIYGELGWIPNFNVKCSKNNDARHVTNRETFDGPMNYHVTFNNSTMTNSEFFRQNAPSKSVARERV*
Ga0138261_129845723300012418Polar MarineMDPYDENEVKGTLIPEYSKIAKDRDVYGELGWISNFNVKCAKDNNKRHPTYREYFDGPKNYHTTFTNSTLTNSEFFRQNAPGNSVAH*
Ga0138268_138915713300012782Polar MarineGTRMPDYSGISKDRDIYGELGWIPNFNVKCSKNNDARHVTNRETFDGPMNYHVTFNNSTMTNSEFFRQNAPSKSVARERV*
Ga0163180_1055752223300012952SeawaterMNEIKGTRMPDYSGVSKDRDIYGELGWIPNFNVKCSKNNDARHGTNREYFDGPMNYHVTFNNSTMTNSEFFR*
Ga0163180_1128851213300012952SeawaterMNEIKGTRMPDYSGVSKDRDIYGELGWIPNFNVKCSKNNDKRHTGNREYFDGPMNYHVTFNNSTMTNSEFFR*
Ga0163179_1025118723300012953SeawaterMNEIKGTRMPDYSGVSKDRDIYGELGWIPNFNVKCSKNNDRRHTGNREYFDGPMNYHVTFNNSTMTNSEFFR*
Ga0163179_1166465123300012953SeawaterLLKPRREHDPYEMNEIKGTRMPDYSGVSKDRDIYGELGWIPNFNVKCSKNNDKRHIGNREYFDGPMNYHVTFNNSTMTNSEFFR*
Ga0163111_1103397723300012954Surface SeawaterDPYEMNEIKGTRMPDYSNVSKDRDIYGELGWIPNFNVKCSKNNNLRHPTNREYFDGPMNYHVTFNNSTMTNSEFFR*
Ga0129332_127636423300012969AqueousMNEIKGTRMPDYSGVSKDRDIYGDLGWIPNFNVKCSKNNNARHATNREYFDGPMNYHVTFNNSTMTNSEFFRQNAPAKSVAREKVQTLSV*
Ga0164293_1023602723300013004FreshwaterMKPKRELDPFEINEVKGTRMPDYSGVTKDRDIYGELGWIPNFNVKCSKNNEARHVTNREYFDGPMNYHVTFNNSTMTNSEFFR*
Ga0182091_105345013300016766Salt MarshMPDYSVISKDRDIYGELGWIPNFNVKCSKNNDVRHTTNREYFDGPMNYHVTFNNSTMTNSEFFRQNAPSKSVARERVQTMSV
Ga0181390_112459113300017719SeawaterEPDPYEMNDIKGTRMPDYSGVSKDRDIYGELGWIPNFNVKCSKNNYVRHSTNREYFDGPMNYHVTFNNSTMTNSEFFR
Ga0181561_1020887513300018410Salt MarshMIYPQRQLDPYEENEVKGTRMPDYSKLARERDIYGELGWISNFNVKFSKNNHKLHPSYREFFDGPKNYHNQFNNSTMTNNEFFRQNAPVHSVARLPNKMA
Ga0181566_1009364723300018426Salt MarshLKPRREHDPYEMNEIKGTRMPDYSNVSKDRDIYGELGWIPNFNVKCSKNNHIRHVSNREYFDGPMNYHVTFNNSTMTNSEFFR
Ga0188862_101531423300018622Freshwater LakeNRDNKLIYPQRQLDPYEENEVKGTRMPDYTKLVKQRDIYGELGWIPNFNVKTSKNNNRLHPSFREFFDDPKNYHNTYNNSTLTNFEFFR
Ga0192983_100844043300018684MarineMDPYDENEVKGTRIPEYSKIAKDRDVYGELGWISNFNVKCAKDNNKRHPTYREYFDGPKNYHTTFTNSTLTNSEFFRQNAPGNSVAH
Ga0192944_100898413300018692MarineMNDIKGTRMPDYSGVSKDRDIYGELGWIPNFNVKCSKNNNARHGTNREYFDGPMNYHVTFNNSTMTNSEFFRQNAPANSVAREKV
Ga0192950_102861913300018791MarineAKREPDPYEMNDIKGTRMPDYSGVSKDRDIYGELGWIPNFNVKCSKNNNARHGTNREYFDGPMNYHVTFNNSTMTNSEFFRQNAPANSVAREKV
Ga0193090_111732613300018899MarineMDPYDENEVKGTRIPEYSKIAKDRDVYGELGWISNFNVKCAKNNNNRHTSFREYFDDPKNYHVTFTNSTLTNSEFFR
Ga0193260_1011221723300018928MarineMNEIKGTRMPDYSGVSKDRDIYGELGWIPNFNVKCSKNNNARHTGNREYFDGPMNYHVTFNNSTMTNSEFFR
Ga0192894_1016888813300018968MarineMNEIKGTRMPDYSGVSKDRDIYGELGWIPNFNVKCSKNNHHRHGGNREYFDGPMNYHVTFNNSTMTNSEFFR
Ga0192961_1015347513300018980MarineYSGISKDRDIYGELGWIPNFNVKCSKNNDARHITNREYFDGPMNYHVTFNNSTMTNSEFF
Ga0193017_1012705423300018983MarineLVKARREHDPYEMNEIKGTRMPDYSGVSKDRDIYGELGWIPNFNVKCSKNNNARHATNREYFDGPMNYHVTFNNSTMTNSEFFR
Ga0192945_1011700423300019036MarineMDPYDENEVKGTRIPEYSKIAKDRDVYGELGWISNFNVKCAKNNGKRHTSFREYFDDPKNYHTTFTNSTLTNSEFFR
Ga0192981_1008874023300019048MarineMDPYDENEVKGTRIPEYSKIAKDRDVYGELGWIGNFNVKCAKNNINRHTSFREYFDDPKNYHTTFSNSTLTNSEFFR
Ga0192981_1010361423300019048MarineMNEIKGTRMPDYSGISKDRDIYGELGWIPNFNVKCSKNNDARHVTNRETFDGPMNYHVTFNNSTMTNSEFFRQNAPSKSVARERV
Ga0192981_1010449123300019048MarineMNEIKGTRMPDYSGISKDRDIYGELGWIPNFNVKCAKNNDDRHVTNREYFDGPMNYHVTFNNSTMTNSEFFR
Ga0192981_1017853113300019048MarineMNEIKGTRMPDYSGISKDRDIYGELGWIPNFNVKCSKNNDDRHVTNRETFDGPMNYHVTFNNSTMTNSEFFRQNAPSKSVARERV
Ga0192981_1025868423300019048MarineLIKPRREHDPYEMNEIKGTRMPDYSGVSKDRDIYGELGWIPNFNVKCSKNNNARHGTNREYFDGPMNYHVTFNNSTMTNSEFFR
Ga0193082_1014119813300019049MarineMPDYSGVSKDRDIYGELGWIPNFNVKCSKNNDARHTGNREYFDGPMNYHVTFNNSTMTNSEFFRQNAPEKSVARERVQTMSVQNRSKYGSTMKST
Ga0192966_1017525813300019050MarineFQSKQPVLLKPRRENDPYEMNEIKGTRMPDYSNISKDRDIYGELGWIPNFNVKCSKNNDVRHPTNREFFDGPMNYHVTFNNSTMTNSEFFR
Ga0192980_103254533300019123MarineMDPYDENEVKGTRMPEYSKIIKDRDVYGELGWINNFNVKCAKNNNNRHTSFREYFDDPKNYHVTFTNSTLTNSEFFR
Ga0192980_108025823300019123MarineMDPYDENEVKGTRIPEYSKIAKDRDVYGELGWISNFNVKCAKDNNKRHPTYREYFDGPKNYHTTFTNSTLTNSE
Ga0193144_105582113300019126MarineRMPDYTRLARERDIYGELGWISNFNVKCSKNNNKLYPTYREYFDGPKNYFTTFNNSSMTNNEFFR
Ga0188870_1004189413300019149Freshwater LakeVLLKPRREHDPYEMNEIKGTRMPDYSGVSKDRDIYGELGWIPNFNVKCSKNNNARHTGNREYFDGPMNYHVTFNNSTMTNSEFFRQNAPEKSVARERVQTMSV
Ga0194113_1033846613300020074Freshwater LakeMPDYAGVTKTRDIHGELGWIPNFNVKCSKNNDARYPSNREYFDGPMNYHVTFNNSTMTNSEFFR
Ga0211734_1135595013300020159FreshwaterMKPKRELDPFEMNEVKGTRMPDYSGVTKDRDIYGELGWIPNFNVKCSKNNEARHVTNREYFDGPMNYHVTFNNSTMTNSEFFR
Ga0211733_1024874923300020160FreshwaterMPDYTKLAKERDIYGELGWVPNFNVKCSKNNTKLYPTYREFFDIPKNYSSTFNNSSMTNPEFFR
Ga0194115_1024634423300020183Freshwater LakeMKLRATRIPDYAGVTKNRDIHGELGWIPNFNVKCSKNKIDRYPTNREMFDAPINYHVSFNNSTMINSEFFK
Ga0194124_1014477213300020196Freshwater LakeMPDYAGVSKNRDIHGELGWIPNFNVKCSKNNIDRYPTNREMFDAPMNYHVSFNNSTMTNSEFFR
Ga0211731_1033765713300020205FreshwaterMKPKRELDPYEMNEVKGTRMPDYSGVTKDRDIYGELGWIPNFNVKCSKNNDDRHVTNREYFDGPMNYHVTFNNSTMTNSEFFR
Ga0207938_103589223300020525FreshwaterVTKERDIYGELGWIPNFNVKCSKNNPKRHATFREYFDGPMNYHITFNNSTMTNSEFFR
Ga0206687_158540513300021169SeawaterMNEIKGTRMPDYSGISKDRDIYGELGWIPNFNVKCSKNNDDRHVTNRETFDGPMNYHVTFNNSTMTNSEFFR
Ga0206692_143350613300021350SeawaterQKQPVLLKPRREHDPYEMNEIKGTRMPDYSGVSKDRDIYGELGWIPNFNVKCSKNNDKRHIGNREYFDGPMNYHVTFNNSTMTNSEFFR
Ga0206123_1011613033300021365SeawaterMNEIKGTRMPDYSGVSKDRDIYGELGWIPNFNVKCSKNNDARHTTNREYFDGPMNYHVTFNNSTMTNSEFFRQNAPSKSVARERVQTMSVQNKSKYGSSMRSTQSTF
Ga0063086_106126123300021902MarineLLKPRREHDPYEMNEIKGTRMPDYSGVSKDRDIYGELGWIPNFNVKCSKNNNKRHTGNREYFDGPMNYHVTFNNSTMTNSEFFR
Ga0063104_103910223300021913MarineMDPYDENEVKGTRIPEYSRIAKDRDVYGELGWISNFNVKCSKSNAKRHTSFREYFDDPKNYHTTFTNSTLTNSEFFR
Ga0063096_106993023300021925MarineLLKPRREHDPYEMNEIKGTRMPDYSGVSKDRDIYGELGWIPNFNVKCSKNNNQRHGGNREYFDGPMNYHVTFNNSTMTNSEFFRQNAPEKS
Ga0063103_108992713300021927MarineIKPRREHDPYEMNEIKGTRMPDYSGISKDRDIYGELGWIPNFNVKCAKNNDDRHVTNREYFDGPMNYHVTFNNSTMTNSEFFRQNAPSKSVARERVQTMSV
Ga0063103_112706813300021927MarineMNEIKGTRMPDYSGISKDRDIYGELGWIPNFNVKCSKNNDARHVTNRETFDGPMNYHVTFNNSTMTNSEFFRQNAPSKSVAR
Ga0063102_104439313300021941MarineMNEIKGTRMPDYSGISKDRDIYGELGWIPNFNVKCAKNNDDRHTTNREYFDGPMNYHVTFNNSTMTNSEFFRQNAPSKSVARERV
Ga0063098_108783813300021942MarinePRREHDPYEMNEIKGTRMPDYSHVSKDRDIYGELGWIPNFNVKCSKNNNQRHTTNREYFDGPMNYHVTFNNSTMTNSEFFRQNAPSKSVARERVQTMSV
Ga0063101_111968523300021950MarineMDPYEENEVKGTRIPEYSKIAKDRDVYGELGWISNFNVSCAKNNDKRHTSFREYFDEPKNYHTTFTNSTLTNSEFFR
Ga0063101_113410723300021950MarineMNEIKGTRMPDYSGISKDRDIYGELGWIPNFNVKCSKNNDDRHVTNRETFDGPMNYHVTFNNSTMTNSEFFRQNAPSKSVARERVQTMSVQNKSKYGSSMRST
Ga0222717_1015661913300021957Estuarine WaterVLLKPRREHDPYEMNEIKGTRMPDYSGVSKDRDIYGELGWIPNFNVKCSKNNNARHTGNREYFDGPMNYHVTFNNSTMTNSEFFRQNAPEKSVARERV
Ga0222713_1003729393300021962Estuarine WaterMDPYELNEFKGTRMPDYSAVSKDRDIYGELGWIPNFNVKCSKDNDKRHATCREYFDGPMNYHMTFNNSTMTNSEFFRQNAPENSVARERVQTMSVFNKSQFGSSMKST
Ga0244777_1038805023300024343EstuarineMNQPQRQLDPYDENEVKGTRMPDYTKLSKERDIYGELGWIGNFNVKCSKNNHKLYPTYREFFDGPKNYHNTFNNSTMTNNEFFR
Ga0244777_1065263223300024343EstuarineMPDYSGVSKDRDIYGELGWIPNFNVKVSKNNDLRHPTMREFFDGPMNYHTTFNNSTMTNSEFFRQNA
Ga0209634_119296723300025138MarineMNEIKGTRMPDYSGVSKDRDIYGELGWIPNFNVKCSKNNDKRHIGNREYFDGPMNYHVTFNNSTMTNSEFFRQNAPEKSVARERV
Ga0209716_117866513300025626Pelagic MarineMNEIKGTRMPDYSAVSKDRDIYGELGWIPNFNVKCSKNNVIRHPSNREYFDGPMNYHVTFNNSTMTNSEFFRQNAPNRSVAKEKVQTLSV
Ga0209306_104691623300025680Pelagic MarineMNEIKGTRMPDYSGVSKDRDIYGELGWIPNFNVKCSKNNNARHATNREYFDGPMNYHVTFNNSTMTNSEFFRQNAPAKSVAREKVQTLSV
Ga0209715_108461423300025699Pelagic MarineMNEIKGTRMPDYSNVSKDRDIYGELGWIPNFNVKCSKNNDVRHPTNREFFDGPMNYHVTFNNSTMTNSEFFRQNAPVKSVAREKVQTMSV
Ga0209199_129699023300025809Pelagic MarineMNEIKGTRMPDYSNVSKDRDIYGELGWIPNFNVKCSKNNNLRHPTNREYFDGPMNYHVTFNNSTMTNSEFFR
Ga0209603_128076623300025849Pelagic MarineMNEIKGTRMPDYSTVSKDRDIYGELGWIPNFNVKCSKNNNIRHPANREYFDGPMNYHVTFNNSTMTNSEFFRQNAPKRSVAKERVQTMSVQNRSKYGSTMRST
Ga0209603_129436313300025849Pelagic MarineMNEIKGTRMPDYSGISKDRDIYGELGWIPNFNVKCAKNNDARHVTNREYFDGPMNYHVTFNNSTMTNSEFFR
Ga0209308_1017078323300025869Pelagic MarineLKPRRENDPYEMNEIKGTRMPDYSNVSKDRDIYGELGWIPNFNVKCSKNNQLRHPHTREYFDGPMNYHVTFNNSTMTNSEFFRQNAPKKSVAKERV
Ga0209308_1021762423300025869Pelagic MarineMPDYSNVSKDRDIYGELGWIPNFNVKCSKNNDLRYPTNREYFDGPMNYHVTFNNSTMTNSEFFR
Ga0209309_1019294523300025881Pelagic MarineMKPRRENDPYEMNEIKGTRMPDYSNVSKDRDIYGELGWIPNFNVKCSKNNNLKHPASREYFDGPMNYHVTFNNSTMTNSEFFR
Ga0208544_1023184823300025887AqueousMDPYEMNEFKGTRMPDYTEVARDRDIYGELGWIPNFQTKVSKNNNARHADAREYFDGPMNYHTTYNNSTMTNSEFFRHNAPENSVAKEKVQTMSVFNRS
Ga0208544_1030157523300025887AqueousMDPYEMNEFKGTRMPDYTVVAKDRDIYGELGWIPNFNVKCSKNNDIRHATSREYFDGPMNYHTTFNNSTMTNS
Ga0209631_1015408813300025890Pelagic MarineMNEIKGTRMPDYSGISKDRDIYGELGWIPNFNVKCAKNNDVRHVTNREYFDGPMNYHVTFNNSTMTNSEFFR
Ga0209631_1018852613300025890Pelagic MarineLLKPRRENDPYEMNEIKGTRMPDYSNVSKDRDIYGELGWIPNFNVKCSKNNDLRYPTNREYFDGPMNYHVTFNNSTMTNSEFFR
Ga0208275_102208223300026182MarineLLKPRREHDPYEMNEIKGTRMPDYSGISKDRDIYGELGWIPNFNIKCSKNNDVRHGGNREYFDGPMNYHVTFNNSTMTNSEFFRQNAPEKSVARERVQTMSV
Ga0209192_1007268723300027752MarineLKPRREHDPYEMNEIKGTRMPDYSHVSKDRDIYGELGWIPNFNVKCSKNNNARHTTNREYFDGPMNYHVTFNNSTMTNSEFFRQNAPSKSVARERVQTMSV
Ga0209279_1004922913300027771MarineLKPRREHDPYEMNEIKGTRMPDYSHVSKDRDIYGELGWIPNFNVKCSKNNNARHTGNREYFDGPMNYHVTFNNSTMTNSEFFRQNAPSKSVARERVQTMSV
Ga0209279_1027063913300027771MarineMPDYSNVSKDRDIYGELGWIPNFNVKCSKNNNLRHPTNREYFDGPMNYHVTFNNSTMTNSEFFR
Ga0209091_1033542413300027801MarineMNDIKGTRMPDYSGVSKDRDIYGELGWIPNFNVKCSKNNNARHGTNREYFDGPMNYHVTFNNSTMTN
Ga0209302_1010866023300027810MarineMPDYTKLAKERDIYGELGWISNFNVKCSKNNNKLYPTYREYFDGPKNYFTTFNNSTMTNNEFFR
Ga0209302_1011743823300027810MarineLLKPRREHDPYEMNEIKGTRMPDYSGVSKDRDIYGELGWIPNFNVKCSKNNNQRHGGNREYFDGPMNYHVTFNNSTMTNSEFFRQNAPEKSVARERVQTMSV
Ga0209092_1018354913300027833MarineMNEIKGTRMPDYSGISKDRDIYGELGWIPNFNVKCSKNNEARHVTNRETFDGPMNYHVTFNNSTMTNSEFFRQNAPSKSVARERV
Ga0209092_1030049013300027833MarineMNEIKGTRMPDYSGISKDRDIYGELGWIPNFNVKCAKNNDVRHTTNREYFDGPMNYHVTFNNSTMTNSEFFR
Ga0209092_1037577333300027833MarineMPDYSGISKDRDIYGELGWIPNFNVKCSKNNDLRHPTNREYFDGPMNYHVTFNNSTMTNSEFFRQNAPAKSVAREKVQTL
Ga0209712_1034294513300027849MarineMNEIKGTRMPDYSGISKDRDIYGELGWIPNFNVKCSKNNDDRHVTNRETFDGPMNYHVTFNNSTMTNSEFFRQNAPSKSVARERVQTMSV
Ga0209712_1039003313300027849MarineRREHDPYEMNEIKGTRMPDYSGISKDRDIYGELGWIPNFNVKCSKNNDDRHVTNRETFDGPMNYHVTFNNSTMTNSEFFRQNAPSKSVARERV
Ga0209450_1046963323300027885Freshwater Lake SedimentMPDYTKLSKERDIYGELGWVPNFNVKCSKNNTKLYPTYREFFDIPKNYATTFNNSSMTNPEFFR
Ga0247566_104865213300028335SeawaterMNEIKGTRMPDYSGVSKDRDIYGELGWIPNFNVKCSKNNNARHSGNREYFDGPMNYHVTFNNSTMTNSEFFRQNAPEKSVARERVQTMSV
Ga0307402_1076463813300030653MarineMNEIKGTRMPDYSGISKDRDIYGELGWIPNFNVKCSKNNDARHVTNRETFDGPMNYHVTFNNSTMTNSEFFRQNAPSKSV
Ga0307403_1032712833300030671MarineLLKPRREHDPYEMNEIKGTRMPDYSGVSKDRDIYGELGWIPNFNVKCSKNNNARHGGNREYFDGPMNYHVTFNNSTMTNSEFFR
Ga0307398_1054637013300030699MarineMPDYSKLAKERDIYGELGWIQNFNVKFSKNNSKLHKDYREFFDGPKNYHNQFNNSTLTNSEFFRQNAP
Ga0307400_1059789113300030709MarineMNEIKGTRMPDYSHVSKDRDIYGELGWIPNFNVKCSKNNNARHTGNREYFDGPMNYHVTFNNSTMTNSEFFRQNAPSKSVARERVQTMSV
Ga0307400_1073706423300030709MarineMNEIKGTRMPDYSNVSKDRDIYGELGWIPNFNVKCSKNNDVRHPTNREFFDGPMNYHVTFNNSTMTNSEFFRQNAPVKSVAREK
Ga0073964_1119124113300030788MarineMSKDRDIYGELGWIPNFNVKCSKNNDMRHISTREYFDGPMNYHVTFNNSTMTNSEFFRQNAPPKSVARERV
Ga0307388_1020046723300031522MarineMNEIKGTRMPDYSGVSKDRDIYGELGWIPNFNVKCSKNNDARHGGNREYFDGPMNYHVTFNNSTMTNSEFFRQNAPEKSVARERV
Ga0307388_1025438813300031522MarineMPDYSGVSKDRDIYGELGWIPNFNVKCSKNNNARHGTNREYFDGPMNYHVTFNNSTMTNSEFFRQNAPANSVAREKV
Ga0307492_1012146013300031523Sea-Ice BrineMNEIKGTRMPDYSGISKDRDIYGELGWIPNFNVKCSKNNDARHITNREYFDGPMNYHVTFNNSTMTNSEFFRQNAPSKSVARERV
Ga0307489_1005849313300031569Sackhole BrineLKPLREHDPYEMNEIKGTRMPDYSNVSKDRDIYGELGWIPNFNVKCSKNNHYRHGSNREYFDGPMNYHVTFNNSTMTNSEFFRQNAPSKSVARERVQTMS
Ga0307489_1017039123300031569Sackhole BrineMIHPQRQLDPYDENEVKGTRMPDYTKLAKERDIYGELGWVPNFNVKCSKNNTKMYPTYREFFDGPKNYSSTFNNSSMTNPEFFR
Ga0307489_1034605213300031569Sackhole BrineMIHPQRQLDPYDENEVKGTRMPDYTKLAKERDIYGELGWVPNFNVKCSKNNNKMYPTYREFFDGPKNYSSTFNNSSMTNPEFFR
Ga0307386_1070641423300031710MarineHYFDKAFQQKQPVLVKPKREHDPYEMNEIKGTRMPDYSTVAKDRDIYGELGWIPNFNVKCAKNNNDRHTTNREYFDGPMNYHVTFNNSTMTNSEFFR
Ga0307391_1026457923300031729MarineMPDYTKLAKERDIYGELGWIGNFNVKCSKNNHKLYPTYREFFDGPKNYHNTFNNSTMTNNEFFR
Ga0307391_1063362833300031729MarineMNEIKGTRMPDYSGISKDRDIYGELGWIPNFNVKCAKNNDDRHTTNREYFDGPKNYHTTFTNSTLTNSEFFRQNAPGNSVAH
Ga0307397_1027820613300031734MarineKTMDPYDENEVKGTRIPEYSRIAKDRDVYGELGWISNFNVKCSKSNAKRHTSFREYFDDPKNYHTTFTNSTLTNSEFFR
Ga0307397_1035710513300031734MarineMNEIKGTRMPDYSGMSKDRDIYGELGWTPNFNIKCSKNNEDRHVTNRETFDGPMNYHVTFNNSTMTNSEFFR
Ga0307397_1041718123300031734MarineEHDPYEMNEIKGTRMPDYSGISKDRDIYGELGWIPNFNVKCSKNNDDRHVTNRETFDGPMNYHVTFNNSTMTNSEFFR
Ga0307397_1062566413300031734MarineLIKPRREHDPYEMNEIKGTRMPDYSGVSKDRDIYGELGWIPNFNVKCSKNNNARHGTNREYFDGPMNYHVTFNNSTMTNSEFFRQNAPSKSVARERV
Ga0307394_1044587123300031735MarineMNEIKGTRMPDYSGISKDRDIYGELGWIPNFNVKCSKNNDDRHVTNRETFDGPMNYHVTFNNS
Ga0307389_1079316113300031750MarinePILVKAKREPDPYEMNDIKGTRMPDYSGVSKDRDIYGELGWIPNFNVKCSKNNNARHGTNREYFDGPMNYHVTFNNSTMTNSEFFRQNAPANSVAREKV
Ga0315907_1054265913300031758FreshwaterPILMKPKRELDPFEMNEVKGTRMPDYSGVTKDRDIYGELGWIPNFNVKCSKNNEARHVTNREYFDGPMNYHVTFNNSTMTNSEFFR
Ga0315907_1127646713300031758FreshwaterMPDYSGVTKIRDIHGELGWIPNFNVKCSKNNDARYPTNREYFDGPMNYHVTFNNSTMT
Ga0315899_1113625313300031784FreshwaterMPDYSGVTKTRDIHGELGWIPNFNVKCSKNNDARYPTNREYFDGPMNYHVTFNNSTMTNSEFFR
Ga0314684_1053190613300032463SeawaterPDYSGVSKDRDIYGELGWIPNFNVKCSKNNNARHGTNREYFDGPMNYHVTFNNSTMTNSEFFRQNAPANSVAREKV
Ga0314675_1035844123300032491SeawaterMNEIKGTRMPYYSTVSKDRDIYGELGWIPNFNVKCSKNNNIRHPANREYFDGPMNYHVTFNNSTMTNSEFFRQNAPKRSVAKERVQTMSV
Ga0314688_1020684123300032517SeawaterMNEIKGTRMPDYSAVSKDRDIYGELGWIPNFNVKCSKNNAIRHPSNREYFDGPMNYHVTFNNSTMTNSEFFRQNAPNRSVAKEKVQTLSV
Ga0314689_1013322613300032518SeawaterLVKAKREPDPYEMNDIKGTRMPDYSGVSKDRDIYGELGWIPNFNVKCSKNNNARHGTNREYFDGPMNYHVTFNNSTMTNSEFFRQNAPANSVAREKV
Ga0314671_1036544213300032616SeawaterDYSGVSKDRDIYGELGWIPNFNVKCSKNNNARHGTNREYFDGPMNYHVTFNNSTMTNSEFFRQNAPANSVAREKV
Ga0314671_1046452313300032616SeawaterPDYSNVSKDRDIYGELGWIPNFNVKCSKNNNLRHPTNREYFDGPMNYHVTFNNSTMTNSEFFRQNAPSKSVAKERVQTMSV
Ga0314683_1063585713300032617SeawaterMRRENDPYEMNEIKGTRMPDYSNVSKDRDIYGELGWIPNFNVKCSKNNDVRHPTNREFFDGPMNYHVTFNNSTMTNSEFFR
Ga0314685_1049837913300032651SeawaterIKGTRMPDYSNVSKDRDIYGELGWIPNFNVKCSKNNNLRHPTNREYFDGPMNYHVTFNNSTMTNSEFFR
Ga0314703_1027423313300032723SeawaterVSKDRDIYGELGWIPNFNVKCSKNNNARHGTNREYFDGPMNYHVTFNNSTMTNSEFFRQNAPANSVAREKV
Ga0314693_1045204323300032727SeawaterEIKGTRMPDYSNVSKDRDIYGELGWIPNFNVKCSKNNNLRHPTNREYFDGPMNYHVTFNNSTMTNSEFFRQNAPSKSVAKERVQTMSV
Ga0314714_1048957333300032733SeawaterVLLKPRRENDPYEMNEIKGTRMPDYSTVSKDRDIYGELGWIPNFNVKCSKNNNIRHPANREYFDGPMNYHVTFNNSTMTNSEFFRQNAPKRSVAKERVQTMSVQNRSKYGSTMRST
Ga0314714_1063122213300032733SeawaterMNEIKGTRMPDYSAVSKDRDIYGELGWIPNFNVKCSKNNAIRHPSNREYFDGPMNYHVTFNNSTMTNSEF
Ga0314710_1019426823300032742SeawaterRMPDYSGVSKDRDIYGELGWIPNFNVKCSKNNNARHGTNREYFDGPMNYHVTFNNSTMTNSEFFRQNAPANSVAREKV
Ga0314704_1039691123300032745SeawaterKPRREHDPYEMNEIKGTRMPDYSGISKDRDIYGELGWIPNFNVKCSKNNDDRHVTNRETFDGPMNYHVTFNNSTMTNSEFFRQNAPSKSVARERV
Ga0314704_1041851813300032745SeawaterPVLLKPRRENDPYEMNEIKGTRMPDYSAVSKDRDIYGELGWIPNFNVKCSKNNVIRHPSNREYFDGPMNYHVTFNNSTMTNSEFFRQNAPNRSVAKEKVQTLSV
Ga0314704_1070891613300032745SeawaterMTHIKNEIKGTRMPDYSGISKDRDIYGELGWIPNFNIKCSKNNDARHVTNRETFDGPMNYHVTFNNSTMTNSEFFRQNAPSKSVARERVQ
Ga0314712_1025688523300032747SeawaterDPYEMNDIKGTRMPDYSGVSKDRDIYGELGWIPNFNVKCSKNNNARHGTNREYFDGPMNYHVTFNNSTMTNSEFFRQNAPANSVAREKV
Ga0314700_1022082233300032752SeawaterVLVKAKREPDPYEMNDIKGTRMPDYSGVSKDRDIYGELGWIPNFNVKCSKNNNARHGTNREYFDGPMNYHVTFNNSTMTNSEFFRQNAPANSVAREKV
Ga0335005_0295706_298_5163300034022FreshwaterMNEIKGTRMPDYTIVTKERDIYGELGWIPNFNVKCSKNNPKRHATFREYFDGPMNYHITFNNSTMTNSEFFR
Ga0335039_0303139_651_8453300034355FreshwaterMPDYSGVTRDRDIYGELGWIPNFNVKCSKNNEARHVTNREYFDGPMNYHVTFNNSTMTNSEFFR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.