Basic Information | |
---|---|
Family ID | F022157 |
Family Type | Metagenome |
Number of Sequences | 215 |
Average Sequence Length | 39 residues |
Representative Sequence | MWDVLVTFMLMLFGAFVVIAFGAILIWTLYLLQNEADND |
Number of Associated Samples | 116 |
Number of Associated Scaffolds | 215 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 87.44 % |
% of genes near scaffold ends (potentially truncated) | 17.21 % |
% of genes from short scaffolds (< 2000 bps) | 69.77 % |
Associated GOLD sequencing projects | 100 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.59 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (38.605 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (32.093 % of family members) |
Environment Ontology (ENVO) | Unclassified (80.000 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (84.186 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 55.22% β-sheet: 0.00% Coil/Unstructured: 44.78% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.59 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 215 Family Scaffolds |
---|---|---|
PF08291 | Peptidase_M15_3 | 10.23 |
PF13412 | HTH_24 | 8.84 |
PF09588 | YqaJ | 7.44 |
PF02592 | Vut_1 | 3.26 |
PF00149 | Metallophos | 1.86 |
PF08774 | VRR_NUC | 1.86 |
PF12705 | PDDEXK_1 | 1.40 |
PF06067 | DUF932 | 1.40 |
PF01807 | zf-CHC2 | 1.40 |
PF01047 | MarR | 1.40 |
PF13392 | HNH_3 | 0.93 |
PF01870 | Hjc | 0.93 |
PF08241 | Methyltransf_11 | 0.93 |
PF11753 | DUF3310 | 0.93 |
PF03245 | Phage_lysis | 0.93 |
PF06378 | DUF1071 | 0.93 |
PF05866 | RusA | 0.47 |
PF07120 | DUF1376 | 0.47 |
PF00145 | DNA_methylase | 0.47 |
PF03237 | Terminase_6N | 0.47 |
PF00182 | Glyco_hydro_19 | 0.47 |
PF01612 | DNA_pol_A_exo1 | 0.47 |
PF04404 | ERF | 0.47 |
PF00166 | Cpn10 | 0.47 |
PF01391 | Collagen | 0.47 |
PF00476 | DNA_pol_A | 0.47 |
COG ID | Name | Functional Category | % Frequency in 215 Family Scaffolds |
---|---|---|---|
COG1738 | Queuosine precursor transporter YhhQ, DUF165 family | Translation, ribosomal structure and biogenesis [J] | 3.26 |
COG0358 | DNA primase (bacterial type) | Replication, recombination and repair [L] | 1.40 |
COG1591 | Holliday junction resolvase Hjc, archaeal type | Replication, recombination and repair [L] | 0.93 |
COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 0.47 |
COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 0.47 |
COG0749 | DNA polymerase I, 3'-5' exonuclease and polymerase domains | Replication, recombination and repair [L] | 0.47 |
COG3179 | Chitinase, GH19 family | Carbohydrate transport and metabolism [G] | 0.47 |
COG3756 | Uncharacterized conserved protein YdaU, DUF1376 family | Function unknown [S] | 0.47 |
COG3979 | Chitodextrinase | Carbohydrate transport and metabolism [G] | 0.47 |
COG4570 | Holliday junction resolvase RusA (prophage-encoded endonuclease) | Replication, recombination and repair [L] | 0.47 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 77.21 % |
Unclassified | root | N/A | 22.79 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300003277|JGI25908J49247_10004454 | All Organisms → Viruses → Predicted Viral | 4482 | Open in IMG/M |
3300003277|JGI25908J49247_10004465 | All Organisms → Viruses → Predicted Viral | 4477 | Open in IMG/M |
3300003277|JGI25908J49247_10017515 | All Organisms → Viruses → Predicted Viral | 2162 | Open in IMG/M |
3300003277|JGI25908J49247_10033028 | All Organisms → Viruses → Predicted Viral | 1449 | Open in IMG/M |
3300003277|JGI25908J49247_10039397 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1286 | Open in IMG/M |
3300003277|JGI25908J49247_10068883 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 888 | Open in IMG/M |
3300003277|JGI25908J49247_10101617 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 692 | Open in IMG/M |
3300003388|JGI25910J50241_10013110 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2958 | Open in IMG/M |
3300003393|JGI25909J50240_1014950 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1844 | Open in IMG/M |
3300003394|JGI25907J50239_1044310 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 918 | Open in IMG/M |
3300003986|Ga0063233_10056566 | All Organisms → Viruses → Predicted Viral | 1100 | Open in IMG/M |
3300004096|Ga0066177_10360026 | Not Available | 626 | Open in IMG/M |
3300004124|Ga0066178_10012237 | All Organisms → Viruses → Predicted Viral | 1840 | Open in IMG/M |
3300004128|Ga0066180_10022560 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2003 | Open in IMG/M |
3300004448|Ga0065861_1098491 | All Organisms → Viruses → Predicted Viral | 1910 | Open in IMG/M |
3300004448|Ga0065861_1105194 | All Organisms → Viruses → Predicted Viral | 1220 | Open in IMG/M |
3300004460|Ga0066222_1059404 | All Organisms → cellular organisms → Bacteria | 2031 | Open in IMG/M |
3300004481|Ga0069718_14831161 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 828 | Open in IMG/M |
3300005581|Ga0049081_10025422 | All Organisms → Viruses → Predicted Viral | 2247 | Open in IMG/M |
3300005581|Ga0049081_10072709 | All Organisms → Viruses → Predicted Viral | 1293 | Open in IMG/M |
3300005582|Ga0049080_10000304 | Not Available | 15976 | Open in IMG/M |
3300005582|Ga0049080_10116901 | Not Available | 903 | Open in IMG/M |
3300005582|Ga0049080_10132917 | Not Available | 838 | Open in IMG/M |
3300005583|Ga0049085_10315623 | Not Available | 507 | Open in IMG/M |
3300005662|Ga0078894_10361269 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1315 | Open in IMG/M |
3300006014|Ga0073919_1031214 | Not Available | 509 | Open in IMG/M |
3300006805|Ga0075464_10541244 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 714 | Open in IMG/M |
3300007559|Ga0102828_1078496 | Not Available | 789 | Open in IMG/M |
3300007708|Ga0102859_1198759 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 596 | Open in IMG/M |
3300007735|Ga0104988_10518 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 16789 | Open in IMG/M |
3300007972|Ga0105745_1264733 | Not Available | 555 | Open in IMG/M |
3300007973|Ga0105746_1009471 | Not Available | 2755 | Open in IMG/M |
3300007973|Ga0105746_1107763 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 919 | Open in IMG/M |
3300008266|Ga0114363_1024292 | All Organisms → Viruses → Predicted Viral | 2630 | Open in IMG/M |
3300008448|Ga0114876_1181250 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 733 | Open in IMG/M |
3300008450|Ga0114880_1095328 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1161 | Open in IMG/M |
3300008450|Ga0114880_1159799 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 801 | Open in IMG/M |
3300009026|Ga0102829_1154538 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 734 | Open in IMG/M |
3300009056|Ga0102860_1090225 | Not Available | 847 | Open in IMG/M |
3300009068|Ga0114973_10005410 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8684 | Open in IMG/M |
3300009068|Ga0114973_10061817 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2184 | Open in IMG/M |
3300009068|Ga0114973_10091360 | All Organisms → Viruses → Predicted Viral | 1738 | Open in IMG/M |
3300009068|Ga0114973_10325715 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 815 | Open in IMG/M |
3300009068|Ga0114973_10497343 | Not Available | 632 | Open in IMG/M |
3300009151|Ga0114962_10001433 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 20598 | Open in IMG/M |
3300009151|Ga0114962_10001717 | Not Available | 18724 | Open in IMG/M |
3300009151|Ga0114962_10004355 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 11273 | Open in IMG/M |
3300009151|Ga0114962_10026029 | All Organisms → Viruses → Predicted Viral | 4067 | Open in IMG/M |
3300009151|Ga0114962_10036257 | Not Available | 3344 | Open in IMG/M |
3300009151|Ga0114962_10144731 | All Organisms → Viruses → Predicted Viral | 1434 | Open in IMG/M |
3300009152|Ga0114980_10013007 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5297 | Open in IMG/M |
3300009152|Ga0114980_10056432 | All Organisms → Viruses → Predicted Viral | 2374 | Open in IMG/M |
3300009152|Ga0114980_10128548 | All Organisms → Viruses → Predicted Viral | 1507 | Open in IMG/M |
3300009152|Ga0114980_10441368 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 744 | Open in IMG/M |
3300009154|Ga0114963_10169657 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1281 | Open in IMG/M |
3300009155|Ga0114968_10024929 | All Organisms → Viruses → Predicted Viral | 4072 | Open in IMG/M |
3300009155|Ga0114968_10027314 | All Organisms → Viruses → Predicted Viral | 3860 | Open in IMG/M |
3300009155|Ga0114968_10049580 | All Organisms → Viruses → Predicted Viral | 2708 | Open in IMG/M |
3300009155|Ga0114968_10136973 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1464 | Open in IMG/M |
3300009155|Ga0114968_10330042 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 846 | Open in IMG/M |
3300009159|Ga0114978_10062579 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 2526 | Open in IMG/M |
3300009159|Ga0114978_10111343 | Not Available | 1797 | Open in IMG/M |
3300009159|Ga0114978_10404044 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 817 | Open in IMG/M |
3300009159|Ga0114978_10593671 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 641 | Open in IMG/M |
3300009163|Ga0114970_10050556 | All Organisms → Viruses → Predicted Viral | 2687 | Open in IMG/M |
3300009163|Ga0114970_10069809 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2225 | Open in IMG/M |
3300009163|Ga0114970_10178345 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1262 | Open in IMG/M |
3300009164|Ga0114975_10212322 | All Organisms → Viruses → Predicted Viral | 1091 | Open in IMG/M |
3300009164|Ga0114975_10284336 | Not Available | 919 | Open in IMG/M |
3300009180|Ga0114979_10260970 | All Organisms → Viruses → Predicted Viral | 1036 | Open in IMG/M |
3300009181|Ga0114969_10492046 | Not Available | 687 | Open in IMG/M |
3300009183|Ga0114974_10087057 | All Organisms → Viruses → Predicted Viral | 2027 | Open in IMG/M |
3300009183|Ga0114974_10448276 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 731 | Open in IMG/M |
3300009183|Ga0114974_10467212 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 712 | Open in IMG/M |
3300009184|Ga0114976_10550232 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 590 | Open in IMG/M |
3300009419|Ga0114982_1006962 | All Organisms → Viruses → Predicted Viral | 4192 | Open in IMG/M |
3300010160|Ga0114967_10596189 | Not Available | 531 | Open in IMG/M |
3300010334|Ga0136644_10025604 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3950 | Open in IMG/M |
3300010885|Ga0133913_10274601 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4471 | Open in IMG/M |
3300010885|Ga0133913_10979900 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2188 | Open in IMG/M |
3300010885|Ga0133913_11691386 | All Organisms → Viruses → Predicted Viral | 1591 | Open in IMG/M |
3300010885|Ga0133913_11805474 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1530 | Open in IMG/M |
3300010885|Ga0133913_11886119 | All Organisms → Viruses → Predicted Viral | 1491 | Open in IMG/M |
3300012012|Ga0153799_1003236 | All Organisms → Viruses → Predicted Viral | 4254 | Open in IMG/M |
3300012017|Ga0153801_1084149 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 560 | Open in IMG/M |
3300012663|Ga0157203_1006179 | All Organisms → Viruses → Predicted Viral | 2217 | Open in IMG/M |
3300012665|Ga0157210_1005495 | All Organisms → Viruses → Predicted Viral | 2573 | Open in IMG/M |
3300013004|Ga0164293_10136519 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1839 | Open in IMG/M |
3300013005|Ga0164292_10072102 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2658 | Open in IMG/M |
3300013005|Ga0164292_10175591 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1544 | Open in IMG/M |
3300013006|Ga0164294_10141940 | All Organisms → Viruses → Predicted Viral | 1743 | Open in IMG/M |
3300013285|Ga0136642_1021662 | Not Available | 1875 | Open in IMG/M |
3300013286|Ga0136641_1035752 | All Organisms → cellular organisms → Bacteria | 1480 | Open in IMG/M |
3300013286|Ga0136641_1049364 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1227 | Open in IMG/M |
3300013295|Ga0170791_14404481 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 666 | Open in IMG/M |
3300013295|Ga0170791_14789003 | Not Available | 909 | Open in IMG/M |
3300013372|Ga0177922_10093328 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1470 | Open in IMG/M |
3300013372|Ga0177922_11194877 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 780 | Open in IMG/M |
3300014050|Ga0119952_1028305 | All Organisms → Viruses → Predicted Viral | 1750 | Open in IMG/M |
3300014050|Ga0119952_1104377 | Not Available | 659 | Open in IMG/M |
3300015050|Ga0181338_1002717 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3098 | Open in IMG/M |
3300017701|Ga0181364_1009868 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1612 | Open in IMG/M |
3300017701|Ga0181364_1026513 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 943 | Open in IMG/M |
3300017716|Ga0181350_1006807 | All Organisms → Viruses → Predicted Viral | 3285 | Open in IMG/M |
3300017716|Ga0181350_1079758 | Not Available | 829 | Open in IMG/M |
3300017716|Ga0181350_1081570 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 817 | Open in IMG/M |
3300017716|Ga0181350_1102607 | Not Available | 702 | Open in IMG/M |
3300017716|Ga0181350_1151790 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 540 | Open in IMG/M |
3300017722|Ga0181347_1193359 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 538 | Open in IMG/M |
3300017722|Ga0181347_1214185 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 502 | Open in IMG/M |
3300017723|Ga0181362_1047568 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 896 | Open in IMG/M |
3300017736|Ga0181365_1028739 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1403 | Open in IMG/M |
3300017736|Ga0181365_1159647 | Not Available | 532 | Open in IMG/M |
3300017754|Ga0181344_1009720 | All Organisms → Viruses → Predicted Viral | 3112 | Open in IMG/M |
3300017754|Ga0181344_1063174 | All Organisms → Viruses → Predicted Viral | 1095 | Open in IMG/M |
3300017754|Ga0181344_1167403 | Not Available | 624 | Open in IMG/M |
3300017761|Ga0181356_1013547 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3070 | Open in IMG/M |
3300017761|Ga0181356_1063083 | All Organisms → Viruses → Predicted Viral | 1257 | Open in IMG/M |
3300017761|Ga0181356_1069879 | All Organisms → Viruses → Predicted Viral | 1180 | Open in IMG/M |
3300017761|Ga0181356_1125353 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 816 | Open in IMG/M |
3300017766|Ga0181343_1064929 | All Organisms → Viruses → Predicted Viral | 1060 | Open in IMG/M |
3300017774|Ga0181358_1150063 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 797 | Open in IMG/M |
3300017774|Ga0181358_1276676 | Not Available | 519 | Open in IMG/M |
3300017774|Ga0181358_1276807 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 519 | Open in IMG/M |
3300017777|Ga0181357_1086078 | All Organisms → Viruses → Predicted Viral | 1200 | Open in IMG/M |
3300017777|Ga0181357_1276213 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 577 | Open in IMG/M |
3300017778|Ga0181349_1064831 | Not Available | 1409 | Open in IMG/M |
3300017778|Ga0181349_1110499 | All Organisms → Viruses → Predicted Viral | 1021 | Open in IMG/M |
3300017780|Ga0181346_1222313 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 671 | Open in IMG/M |
3300017784|Ga0181348_1097169 | All Organisms → Viruses → Predicted Viral | 1152 | Open in IMG/M |
3300019781|Ga0181360_102083 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1651 | Open in IMG/M |
3300019783|Ga0181361_100279 | All Organisms → Viruses → Predicted Viral | 2732 | Open in IMG/M |
3300019784|Ga0181359_1000006 | Not Available | 49804 | Open in IMG/M |
3300019784|Ga0181359_1010854 | All Organisms → Viruses → Predicted Viral | 3251 | Open in IMG/M |
3300019784|Ga0181359_1019316 | All Organisms → Viruses → Predicted Viral | 2566 | Open in IMG/M |
3300019784|Ga0181359_1019952 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2530 | Open in IMG/M |
3300019784|Ga0181359_1028894 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2134 | Open in IMG/M |
3300019784|Ga0181359_1038863 | All Organisms → Viruses → Predicted Viral | 1843 | Open in IMG/M |
3300019784|Ga0181359_1038872 | All Organisms → Viruses → Predicted Viral | 1843 | Open in IMG/M |
3300019784|Ga0181359_1048335 | All Organisms → Viruses → Predicted Viral | 1642 | Open in IMG/M |
3300019784|Ga0181359_1064666 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1394 | Open in IMG/M |
3300019784|Ga0181359_1107930 | All Organisms → Viruses → Predicted Viral | 1012 | Open in IMG/M |
3300019784|Ga0181359_1162017 | Not Available | 757 | Open in IMG/M |
3300019784|Ga0181359_1223318 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 590 | Open in IMG/M |
3300020141|Ga0211732_1468394 | Not Available | 679 | Open in IMG/M |
3300020151|Ga0211736_10510482 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 11695 | Open in IMG/M |
3300021354|Ga0194047_10255825 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 679 | Open in IMG/M |
3300021952|Ga0213921_1001169 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7154 | Open in IMG/M |
3300022190|Ga0181354_1005435 | All Organisms → Viruses → Predicted Viral | 3400 | Open in IMG/M |
3300022190|Ga0181354_1025613 | All Organisms → Viruses → Predicted Viral | 1902 | Open in IMG/M |
3300022190|Ga0181354_1048265 | All Organisms → Viruses → Predicted Viral | 1416 | Open in IMG/M |
3300022190|Ga0181354_1055172 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1321 | Open in IMG/M |
3300022190|Ga0181354_1056406 | All Organisms → Viruses → Predicted Viral | 1306 | Open in IMG/M |
3300022190|Ga0181354_1188127 | Not Available | 623 | Open in IMG/M |
3300022407|Ga0181351_1045421 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1846 | Open in IMG/M |
3300022407|Ga0181351_1194036 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 686 | Open in IMG/M |
3300022407|Ga0181351_1221980 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 612 | Open in IMG/M |
3300022752|Ga0214917_10002429 | Not Available | 22599 | Open in IMG/M |
3300022752|Ga0214917_10039444 | All Organisms → Viruses → Predicted Viral | 3377 | Open in IMG/M |
3300022752|Ga0214917_10112250 | All Organisms → Viruses → Predicted Viral | 1549 | Open in IMG/M |
3300022752|Ga0214917_10457097 | Not Available | 507 | Open in IMG/M |
3300023174|Ga0214921_10001970 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 34346 | Open in IMG/M |
3300023174|Ga0214921_10020412 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7095 | Open in IMG/M |
3300023174|Ga0214921_10089330 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2379 | Open in IMG/M |
3300023174|Ga0214921_10358219 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 771 | Open in IMG/M |
3300023174|Ga0214921_10546472 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Rhodopirellula → unclassified Rhodopirellula → Rhodopirellula sp. | 534 | Open in IMG/M |
3300024346|Ga0244775_10717071 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 805 | Open in IMG/M |
3300025606|Ga0207954_1089979 | Not Available | 771 | Open in IMG/M |
3300027393|Ga0209867_1058431 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 582 | Open in IMG/M |
3300027608|Ga0208974_1044017 | All Organisms → Viruses → Predicted Viral | 1302 | Open in IMG/M |
3300027708|Ga0209188_1025461 | All Organisms → Viruses → Predicted Viral | 2926 | Open in IMG/M |
3300027733|Ga0209297_1002502 | Not Available | 10131 | Open in IMG/M |
3300027733|Ga0209297_1005942 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6220 | Open in IMG/M |
3300027734|Ga0209087_1005924 | Not Available | 6530 | Open in IMG/M |
3300027734|Ga0209087_1060082 | All Organisms → Viruses → Predicted Viral | 1706 | Open in IMG/M |
3300027736|Ga0209190_1015109 | Not Available | 4455 | Open in IMG/M |
3300027736|Ga0209190_1369318 | Not Available | 525 | Open in IMG/M |
3300027741|Ga0209085_1009068 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5041 | Open in IMG/M |
3300027741|Ga0209085_1020475 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 3186 | Open in IMG/M |
3300027747|Ga0209189_1110857 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1215 | Open in IMG/M |
3300027747|Ga0209189_1201807 | Not Available | 819 | Open in IMG/M |
3300027749|Ga0209084_1297289 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 610 | Open in IMG/M |
3300027754|Ga0209596_1087699 | Not Available | 1499 | Open in IMG/M |
3300027754|Ga0209596_1217253 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 805 | Open in IMG/M |
3300027754|Ga0209596_1254365 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 719 | Open in IMG/M |
3300027754|Ga0209596_1330038 | Not Available | 596 | Open in IMG/M |
3300027759|Ga0209296_1014804 | All Organisms → Viruses → Predicted Viral | 4567 | Open in IMG/M |
3300027759|Ga0209296_1027546 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3164 | Open in IMG/M |
3300027763|Ga0209088_10091071 | All Organisms → Viruses → Predicted Viral | 1411 | Open in IMG/M |
3300027770|Ga0209086_10130400 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1243 | Open in IMG/M |
3300027782|Ga0209500_10111985 | All Organisms → Viruses → Predicted Viral | 1335 | Open in IMG/M |
3300027785|Ga0209246_10105259 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1106 | Open in IMG/M |
3300027963|Ga0209400_1112767 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfurellales → unclassified Desulfurellales → Desulfurellales bacterium | 1243 | Open in IMG/M |
3300027969|Ga0209191_1123341 | All Organisms → Viruses → Predicted Viral | 1081 | Open in IMG/M |
3300027973|Ga0209298_10204559 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 805 | Open in IMG/M |
3300027973|Ga0209298_10271750 | Not Available | 669 | Open in IMG/M |
3300028025|Ga0247723_1154336 | Not Available | 535 | Open in IMG/M |
3300028392|Ga0304729_1081509 | Not Available | 1135 | Open in IMG/M |
3300031707|Ga0315291_10681074 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 917 | Open in IMG/M |
3300031746|Ga0315293_11289889 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 502 | Open in IMG/M |
3300031772|Ga0315288_11156732 | Not Available | 671 | Open in IMG/M |
3300031786|Ga0315908_11526533 | Not Available | 520 | Open in IMG/M |
3300031873|Ga0315297_10409182 | All Organisms → Viruses → Predicted Viral | 1138 | Open in IMG/M |
3300031952|Ga0315294_10126531 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2619 | Open in IMG/M |
3300031952|Ga0315294_11460451 | Not Available | 537 | Open in IMG/M |
3300031999|Ga0315274_11635876 | Not Available | 602 | Open in IMG/M |
3300032092|Ga0315905_10246705 | All Organisms → Viruses → Predicted Viral | 1735 | Open in IMG/M |
3300032092|Ga0315905_10522866 | All Organisms → Viruses → Predicted Viral | 1088 | Open in IMG/M |
3300032092|Ga0315905_10717531 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 884 | Open in IMG/M |
3300032401|Ga0315275_11426704 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia | 746 | Open in IMG/M |
3300033233|Ga0334722_10095515 | All Organisms → Viruses → Predicted Viral | 2263 | Open in IMG/M |
3300033993|Ga0334994_0286954 | Not Available | 843 | Open in IMG/M |
3300033996|Ga0334979_0112967 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1678 | Open in IMG/M |
3300034106|Ga0335036_0000633 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 32190 | Open in IMG/M |
3300034119|Ga0335054_0782848 | Not Available | 505 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 32.09% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 32.09% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 7.91% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 6.51% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 4.19% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 3.26% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 1.86% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.86% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.40% |
Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 1.40% |
Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 1.40% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.93% |
Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 0.93% |
Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.47% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.47% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 0.47% |
Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.47% |
Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.47% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 0.47% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.47% |
Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.47% |
Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.47% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
3300003388 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN | Environmental | Open in IMG/M |
3300003393 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD | Environmental | Open in IMG/M |
3300003394 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN | Environmental | Open in IMG/M |
3300003986 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN (v2) | Environmental | Open in IMG/M |
3300004096 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 2) | Environmental | Open in IMG/M |
3300004124 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SD (version 2) | Environmental | Open in IMG/M |
3300004128 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN (version 2) | Environmental | Open in IMG/M |
3300004448 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
3300004460 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
3300005583 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF | Environmental | Open in IMG/M |
3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
3300006014 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T3_25-Nov-14 | Environmental | Open in IMG/M |
3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
3300007708 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 | Environmental | Open in IMG/M |
3300007735 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea ? 2014Oct | Environmental | Open in IMG/M |
3300007972 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460ABC_3.0um | Environmental | Open in IMG/M |
3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
3300009056 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-3 | Environmental | Open in IMG/M |
3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
3300009419 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT | Environmental | Open in IMG/M |
3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
3300010334 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2) | Environmental | Open in IMG/M |
3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
3300012012 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m | Environmental | Open in IMG/M |
3300012017 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m | Environmental | Open in IMG/M |
3300012663 | Freshwater microbial communities from Indian River, Ontario, Canada - S50 | Environmental | Open in IMG/M |
3300012665 | Freshwater microbial communities from Talbot River, Ontario, Canada - S11 | Environmental | Open in IMG/M |
3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
3300013006 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaG | Environmental | Open in IMG/M |
3300013285 | Freshwater microbial communities from Lower Cathedral Lake, Yosemite National Park, California, USA - 13028-31Y | Environmental | Open in IMG/M |
3300013286 | Freshwater microbial communities from Elizabeth Lake, Yosemite National Park, California, USA - 13020-23Y | Environmental | Open in IMG/M |
3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
3300014050 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007B | Environmental | Open in IMG/M |
3300015050 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300019781 | Freshwater viral communities from Lake Michigan, USA - Sp13.ND.MM15.S.D | Environmental | Open in IMG/M |
3300019783 | Freshwater viral communities from Lake Michigan, USA - Sp13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
3300021354 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L221-5m | Environmental | Open in IMG/M |
3300021952 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 20-17 MG | Environmental | Open in IMG/M |
3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
3300025606 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA0M (SPAdes) | Environmental | Open in IMG/M |
3300027393 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_4-Nov-14 (SPAdes) | Environmental | Open in IMG/M |
3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027708 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027741 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027747 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027749 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027770 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027973 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
3300028392 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG (v2) | Environmental | Open in IMG/M |
3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
3300031786 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA124 | Environmental | Open in IMG/M |
3300031873 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0 | Environmental | Open in IMG/M |
3300031952 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40 | Environmental | Open in IMG/M |
3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
3300032401 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0 | Environmental | Open in IMG/M |
3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
3300034119 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Jul2015-rr0166 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI25908J49247_100044549 | 3300003277 | Freshwater Lake | MWDVLVTFMLMMFGAFVVIAFGAILIGALYFLQNEADND* |
JGI25908J49247_100044656 | 3300003277 | Freshwater Lake | MWDVAVTFMLMMFGAFTVIAFGAILIWTLYLLQNGGHDDC* |
JGI25908J49247_100175152 | 3300003277 | Freshwater Lake | MWDVAVTFMFMMFGGLTMIFFGLMLIFILYFLQNEVDND* |
JGI25908J49247_100330286 | 3300003277 | Freshwater Lake | MWDVLVTFMLMLFGAFAVIAFGVILIGALYFLQNEADND* |
JGI25908J49247_100393974 | 3300003277 | Freshwater Lake | MWDVVVTVTLMAFGAFVVIAFGVILIWTLYLLQNEADND* |
JGI25908J49247_100688832 | 3300003277 | Freshwater Lake | MWDVLVTFMLMMFGGLTMIFFGAMLIFILYFLQNEVDND* |
JGI25908J49247_101016172 | 3300003277 | Freshwater Lake | MWDVLVTFMLMLFGGLTMIFFGAMLIFILYFLQNEVDNDR* |
JGI25910J50241_100131108 | 3300003388 | Freshwater Lake | MWDVVVTVTLMLFGAFVVIAFGAILICALYLIQNGDRDD* |
JGI25909J50240_10149505 | 3300003393 | Freshwater Lake | MWDVLVTVTLMAFGAFVVIAFGVILIWTLYLLQNEADND* |
JGI25907J50239_10443101 | 3300003394 | Freshwater Lake | MESSLMWDVLVTFMLMMFGGLTMIFFGAMLIFILYFLQNEVDND |
Ga0063233_100565664 | 3300003986 | Freshwater Lake | MWDVAVTFMLMMFGAFIVVAFGAILIWTLYLIQNGDRDD* |
Ga0066177_103600263 | 3300004096 | Freshwater Lake | MWDVAVTFMLMMFGAFTVIAFGAILIWALYVFQKGVDDE* |
Ga0066178_100122372 | 3300004124 | Freshwater Lake | MWDVAVTFMLMMFGAFTVIAFGAILIWTLYLLQNGDRDDC* |
Ga0066180_100225606 | 3300004128 | Freshwater Lake | GLAMWDVVVTMTLMLFGAFTVIVFGAIFIWALYLIQNGNRNDK* |
Ga0065861_10984912 | 3300004448 | Marine | MWDVTVTFMLMFFGAFTMIFWGALLIWVLWLLQNGDYDD* |
Ga0065861_11051942 | 3300004448 | Marine | MWDVAVTFMLMMFGAFVIVAFGAILIWSLYFIQKGVDDE* |
Ga0066222_10594041 | 3300004460 | Marine | MWDVLVTFMLMLFGAFIVIAFGAVLIGALYFLQNEADND* |
Ga0069718_148311613 | 3300004481 | Sediment | MWDVVVTVTLMLFGAFTVIVFGAILIWALYLLQNRNDNDK* |
Ga0049081_100254222 | 3300005581 | Freshwater Lentic | MWDVLVTFMLMAFGAFIVIAFGVILIWVLYLLQNEVDHE* |
Ga0049081_100727092 | 3300005581 | Freshwater Lentic | MWDVLVTFMLMLFGAFVVIAFGAILIGALYFLQNEADND* |
Ga0049080_1000030427 | 3300005582 | Freshwater Lentic | MWDVLVTFMLMAFGAFIVIAFGVILIWTLYLLQNEADND* |
Ga0049080_101169013 | 3300005582 | Freshwater Lentic | MWDVAVTFMLMMFGAFIVVAFGAILIWTLYIIQNGDRDD* |
Ga0049080_101329172 | 3300005582 | Freshwater Lentic | MWDVAVTFMLMLFGAFTVIAFGAILIWTLYIIQNGDRDE* |
Ga0049085_103156232 | 3300005583 | Freshwater Lentic | MESSLMWDVAVTFMFMMFGGLTMIFFGLMLIFILYFLQNEVDND* |
Ga0078894_103612694 | 3300005662 | Freshwater Lake | MWDVLVTFLLMAFGGFVVIAFGIILIWVLYLLQNEADHE* |
Ga0073919_10312141 | 3300006014 | Sand | MEGSLMWDVLVTFMLMLFGAFFVIAFGAILIGALYFLQNE |
Ga0075464_105412442 | 3300006805 | Aqueous | MWDVLVTFMLMLFGAFVVIAFGAILIGTLYFLQKEADND* |
Ga0102828_10784962 | 3300007559 | Estuarine | MWDVAVTFMLMMFGAFVVVAFGAILIGALYFLQNEADND* |
Ga0102859_11987592 | 3300007708 | Estuarine | MWDVLVTFMLMMFGAFVVIAFGAILIGALYFLQNEVDHE* |
Ga0104988_1051818 | 3300007735 | Freshwater | MWDVFVTFILMAFGAFIVIAFGAILIWVLYLLQNEVDND* |
Ga0105745_12647332 | 3300007972 | Estuary Water | MWDVAVTFMLMGFGAFVIVAFGVILIGALYFLQNEADND* |
Ga0105746_10094714 | 3300007973 | Estuary Water | MWDVVVTFMLMAFGAFVVIAFGVILIWTLYLLQNEADND* |
Ga0105746_11077631 | 3300007973 | Estuary Water | MWDVLLTFMLMMFGGFVVVAFGAILIGALYFLQNEADNE* |
Ga0114363_10242924 | 3300008266 | Freshwater, Plankton | MWDVAVTFMLMMFGGLTMIFFGAMLIFILYFLQNEVDND* |
Ga0114876_11812502 | 3300008448 | Freshwater Lake | MWDVVVTVTLMAFGAFIVIAFGVILIWTLYLLQNEADND* |
Ga0114880_10953285 | 3300008450 | Freshwater Lake | MWDVLVTFMLMLFGGLTMIFFGAMLIFILYFLQNEVDND |
Ga0114880_11597993 | 3300008450 | Freshwater Lake | MWDVLVTFMLMMFGGLTMIFFGAMLIFILYFLQNEVDNDL* |
Ga0102829_11545381 | 3300009026 | Estuarine | MEGSLMWDVAVTFMLMMFGAFVVVAFGAILIGALYFLQNEADND* |
Ga0102860_10902252 | 3300009056 | Estuarine | MWDVLVTFMLMMFGAFVVVAFGAILIGALYFLQNEADND* |
Ga0114973_100054102 | 3300009068 | Freshwater Lake | MWDVAVTFMLMLFGAFTLIAFGAILIWTLYIIQNGDRDE* |
Ga0114973_100618171 | 3300009068 | Freshwater Lake | MEGSLMWDVLVTFLLMAFGGFAVIAFGVILVWVLYFLQNEVDHE* |
Ga0114973_100913602 | 3300009068 | Freshwater Lake | MWDVVVTFMLMMFGAFIVVAFGVILIWTLYLIQNGDRDD* |
Ga0114973_103257152 | 3300009068 | Freshwater Lake | MWDVVVTFTLMAFGAFVVIAFGVILIWTLYLLQNEADND* |
Ga0114973_104973431 | 3300009068 | Freshwater Lake | VTFMLMMFGAFVVVAFGAVLIWSLYVFQKGVDDE* |
Ga0114962_1000143312 | 3300009151 | Freshwater Lake | MWDVLVTFMLMMFGAFAVIFFGAMLIFVLYLLQNEADYD* |
Ga0114962_1000171710 | 3300009151 | Freshwater Lake | MWDVAVTFMLMMFGAFIVVAFGAILIWVLYIVQNVD* |
Ga0114962_100043554 | 3300009151 | Freshwater Lake | MWDVSVTFMLMFFGAFTMIFWGALLIWVLYLLQNEADND* |
Ga0114962_100260298 | 3300009151 | Freshwater Lake | MWDVAVTFMLMMFGAFVVVAFGAVLIWTLYVFQKGVDDE* |
Ga0114962_100362572 | 3300009151 | Freshwater Lake | MWDVLVTFMLMFFGAFVVIAFGAILIWALYIIQNEVDHD* |
Ga0114962_101447312 | 3300009151 | Freshwater Lake | MWDVAVTFMLMMFGAFVVVAFGAILIWALYVFQKGVDDE* |
Ga0114980_100130075 | 3300009152 | Freshwater Lake | MWDVLVTFMLMAFGGFAVIAFGVILVWVLYFLQNEVDNE* |
Ga0114980_100564326 | 3300009152 | Freshwater Lake | MWDILVTFMLMMFGAFVVVVFGAILIWTIYLLQNEADND* |
Ga0114980_101285485 | 3300009152 | Freshwater Lake | MWDVLVTFILMMFGGLTMIFFGAMLICILYFLQNEVDND* |
Ga0114980_104413681 | 3300009152 | Freshwater Lake | SLMWDVLVTFMLMMFGAFFVIAFGVILIWVLYLLQNEVDHD* |
Ga0114963_101696575 | 3300009154 | Freshwater Lake | MWDVSVTFMLMLFGAFTMIFWGALLIWVLYLLQNEADND* |
Ga0114968_100249297 | 3300009155 | Freshwater Lake | MWDVAVTFMLMMFGAFVVVAFGAVLIWSLYVFQKGVDDE* |
Ga0114968_100273147 | 3300009155 | Freshwater Lake | MWDVTVTFILMFFGAFTMIFWGALLIWVLYLLQNEADND* |
Ga0114968_100495803 | 3300009155 | Freshwater Lake | MWDVLVTFMLMAFGGFAVIAFGIILVWVLYFLQNEVDNE* |
Ga0114968_101369732 | 3300009155 | Freshwater Lake | MWDVLVTFMLMLFGAFIVIAFGAILIGALYFLQNEADND* |
Ga0114968_103300422 | 3300009155 | Freshwater Lake | MWDVLVTFTLMAFGAFVVIAFGVILIWTLYLLQNEADND* |
Ga0114978_100625795 | 3300009159 | Freshwater Lake | MWDVAVTFMFMFFGAFIVIAFGALLIWMLYLIQNGVDDE* |
Ga0114978_101113434 | 3300009159 | Freshwater Lake | MWDVLVTFMLMAFGGFAVIAFGVILIWVLYFLQNEVDNE* |
Ga0114978_104040442 | 3300009159 | Freshwater Lake | MWDILVTFMLMMFGAFVVVVFGAILIWTLYLLQNEADND* |
Ga0114978_105936711 | 3300009159 | Freshwater Lake | MWDVLVTFMLMMFGAFFVIAFGVILIWVLYLLQNEVDHD* |
Ga0114970_100505567 | 3300009163 | Freshwater Lake | MWDVAVTFMLMMFGAFTVIAFGAILIWALYVFQNGVDDE* |
Ga0114970_100698094 | 3300009163 | Freshwater Lake | MWDVLVTFLLMAFGGFAVIAFGVILVWVLYFLQNEVDHE* |
Ga0114970_101783453 | 3300009163 | Freshwater Lake | MWDVLVTFILMAFGGFAVIAFGVILVWVLYFLQNEVDNE* |
Ga0114975_102123226 | 3300009164 | Freshwater Lake | MEGSLMWDVLVTFMLMAFGGFAVIAFGVILVWVLYFLQNEIDHE* |
Ga0114975_102843361 | 3300009164 | Freshwater Lake | MWDVLVTFMLMMFGAFVVIAFGAILIGALYFLQKEADND* |
Ga0114979_102609702 | 3300009180 | Freshwater Lake | MWDVLVTFMLMLFGAFVVIAFGAVLIGALYFLQSEADHD* |
Ga0114969_104920463 | 3300009181 | Freshwater Lake | MWDVAVTFILMGFGAFTVITFGVILILVLHVLQNGGDDE* |
Ga0114974_100870576 | 3300009183 | Freshwater Lake | MWDVAVTFMLMMFGGLTMIFFGAMLIFILYFLQKEVDND* |
Ga0114974_104482764 | 3300009183 | Freshwater Lake | VLVTFMLMLFGAFIVIAFGAILIGALYFLQNEADND* |
Ga0114974_104672121 | 3300009183 | Freshwater Lake | MWDVLVTFTLMLFGGFVVIAFGAILIGALYFLQNEADHD* |
Ga0114976_105502323 | 3300009184 | Freshwater Lake | MEGRLMWDVTVTFTLMLFGAFTMIFWGALLIWVLYLLQNEADND* |
Ga0114982_10069624 | 3300009419 | Deep Subsurface | MWDVLVTFMLMLFGAFVVIAFGAILIGALYFLQKEADND* |
Ga0114967_105961891 | 3300010160 | Freshwater Lake | MWDVAVTFMLMLFGAFIVITFGAVLIGALYFLQNEADND* |
Ga0136644_100256041 | 3300010334 | Freshwater Lake | DVLVTFMLMMFGAFAVIFFGAMLIFVLYLLQNEADYD* |
Ga0133913_102746019 | 3300010885 | Freshwater Lake | MWDVAVTFMLMMFGAFVVIAFGAILIWVLYLLQNED* |
Ga0133913_109799005 | 3300010885 | Freshwater Lake | MWDVLVTFMLMAFGGFAVIAFGVILVWVLYFLQNEIDHE* |
Ga0133913_116913866 | 3300010885 | Freshwater Lake | MWDVAVTFMFMFFGAFVVIAFGALLIWALYLIQNGVDDE* |
Ga0133913_118054741 | 3300010885 | Freshwater Lake | MWDVLVTFMLMAFGGFAVIAFGVILVWVLYFLQNEVDHE* |
Ga0133913_118861193 | 3300010885 | Freshwater Lake | MWDVLVTFMLMLFGAFVVVVFGAILIWTLYLLQNEADND* |
Ga0153799_10032366 | 3300012012 | Freshwater | MWDVLVTFMLMAFGAFIVIAFGVILIWVLYLLQNEVDHD* |
Ga0153801_10841492 | 3300012017 | Freshwater | MWDVAVTFMLMMFGAFIVIAFGVILIWMLYLLQNEADND* |
Ga0157203_10061793 | 3300012663 | Freshwater | MWDVAITFMFMMFGGLTMIFFGAMLIFILYFLQNEVDND* |
Ga0157210_10054956 | 3300012665 | Freshwater | MWDVLVTFMLMLFGMFTVIAFGAILIWALYVFQNGVDDE* |
Ga0164293_101365196 | 3300013004 | Freshwater | MWDVLVTVTLMAFGAFVVIAFGIILIWVLYLLQNEVDHE* |
Ga0164292_100721024 | 3300013005 | Freshwater | MWDVLVTVTLMAFGAFVVIAFGIILIWVLYLLQNEADHE* |
Ga0164292_101755917 | 3300013005 | Freshwater | MEGSLMWDVAVTFMLMMFGAFVVIAFGAILIGALYFLQNEADND* |
Ga0164294_101419406 | 3300013006 | Freshwater | MWDVVVTVTLMLFGAFVVIAFGAVLICTLYLIQNGDRDD* |
Ga0136642_10216623 | 3300013285 | Freshwater | MWDVAVTFMLMFFGAFVVIAFGAILIWTLYLLQNEADND* |
Ga0136641_10357524 | 3300013286 | Freshwater | MWDVTVTFMLMMFGAFTMIFFGALLIWVLYLLQNEVDHD* |
Ga0136641_10493643 | 3300013286 | Freshwater | MWDVAVTFMLMMFGAFVVIAFGAILIWTLYLLQNEVDND* |
Ga0170791_144044811 | 3300013295 | Freshwater | MWDVSVTFMLMLFGAFTMIFWGALLIWVLYLLQNE |
Ga0170791_147890034 | 3300013295 | Freshwater | VEGSLMWDVLVTFILMAFGGFAVIAFGVILVWVLYFLQNEVDNE* |
Ga0177922_100933281 | 3300013372 | Freshwater | MWDVLVTVTLMAFGAFVVIAFGVILLWTLYLLQNEADND* |
Ga0177922_111948772 | 3300013372 | Freshwater | MWDVLVTFMLMLFGAFVVIAFGVILIWVLYLLQNEVDHE* |
Ga0119952_10283055 | 3300014050 | Freshwater | MWDVLVTFMLMLFGAFIVIAFGAILIGALYFLQKEVDND* |
Ga0119952_11043772 | 3300014050 | Freshwater | MWDVAVTFMLMMFGAFTVIAFGAILIWALYVFQKGVDDD* |
Ga0181338_10027177 | 3300015050 | Freshwater Lake | MWDVAVTFMLMLFGAFTVIAFGAILIWTLYIIQNGDRDD* |
Ga0181364_10098685 | 3300017701 | Freshwater Lake | MWDVLVTFMLMMFGAFVVIAFGAILIGALYLLQNEADND |
Ga0181364_10265134 | 3300017701 | Freshwater Lake | GQIKETLMWDVLVTFMLMLFGAFAVIAFGVILIGALYFLQNEADND |
Ga0181350_100680710 | 3300017716 | Freshwater Lake | MWDVLVTFMLMLFGAFAVIAFGVILIWMLYLLQNEADND |
Ga0181350_10797583 | 3300017716 | Freshwater Lake | MWDVAVTFMLMMFGGLTMIFFGAMLIFILYFLQNKVDND |
Ga0181350_10815702 | 3300017716 | Freshwater Lake | MWDVGVTFMLMGFGAFVIVAFGVILIGALYFLQNEADND |
Ga0181350_11026074 | 3300017716 | Freshwater Lake | AMWDVAVTFMLMLFGAFTVIAFGAILIWTLYIIQNGDRDD |
Ga0181350_11517903 | 3300017716 | Freshwater Lake | DVLVTVMLIMFGGLTMIFFSAMLIFILYFLQNEVDND |
Ga0181347_11933592 | 3300017722 | Freshwater Lake | MWDVVVTVTLMAFGAFVVIAFGVILIWTLYLLQNGDDN |
Ga0181347_12141853 | 3300017722 | Freshwater Lake | SLMWDVLVTFMLMLFGGLTMIFFGAMLIFILYFLQNEVDNDR |
Ga0181362_10475682 | 3300017723 | Freshwater Lake | MWDVVVTVTLMAFGAFVVIAFGVILIWTLYLLQNEAYND |
Ga0181365_10287394 | 3300017736 | Freshwater Lake | LVTFMLMMFGGLTMIFFGAMLIFILYFLQNEVDND |
Ga0181365_11596471 | 3300017736 | Freshwater Lake | MEGSLMWDVAVTFMLMMFGGLTMIFFGAMLIFILYF |
Ga0181344_10097207 | 3300017754 | Freshwater Lake | MWDVLVTFLLMAFGGFVVIAFGIILIWVLYLLQNEVDHE |
Ga0181344_10631745 | 3300017754 | Freshwater Lake | MWDVVVTVTLMLFGAFVVIAFGAILICALYLIQNGDRDE |
Ga0181344_11674033 | 3300017754 | Freshwater Lake | MWDVAVTFILMGFGAFTVITFGVILILVLHVLQNGDRDD |
Ga0181356_10135478 | 3300017761 | Freshwater Lake | MWDVVVTVTLMLFGAFVVIAFGVILICALYLIQNGDRDD |
Ga0181356_10630832 | 3300017761 | Freshwater Lake | MWDVLVTFMLMLFGAFIVIAFGAILIGALYFLQNEADHE |
Ga0181356_10698791 | 3300017761 | Freshwater Lake | MWDVAVTFMLMMFGAFTVIAFGAILIWTLYLLQNGGHDD |
Ga0181356_11253531 | 3300017761 | Freshwater Lake | TLMWDVAVTFMLMMFGGLTMIFFGAMLIFILYFLQNEVDNDR |
Ga0181343_10649292 | 3300017766 | Freshwater Lake | MWDVAVTFMLMMFGAFAVLFFGAMLIWVLYIIQNGENDDQI |
Ga0181358_11500634 | 3300017774 | Freshwater Lake | LMWDVLVTFMLMLFGGLTMIFFGAMLIFILYFLQNEVDNDR |
Ga0181358_12766762 | 3300017774 | Freshwater Lake | MWDVAVTFMLMMFGAFTVIAFGAILIWTLYIIQNGDRDD |
Ga0181358_12768071 | 3300017774 | Freshwater Lake | GSLMWDVLVTFTLMAFGAFVVIAFGVILIWTLYLLQNEADND |
Ga0181357_10860782 | 3300017777 | Freshwater Lake | MWDVAVTFMLMMFGGLTMIFFGVMLIFILYFLQNEVDNDR |
Ga0181357_12762133 | 3300017777 | Freshwater Lake | LMWDVLVTVTLMAFGAFVVIAFGVILIWTLYLLQNEADND |
Ga0181349_10648311 | 3300017778 | Freshwater Lake | MWDVAVTFMLMMFGAFTVIAFGAILIWALYVFQKG |
Ga0181349_11104994 | 3300017778 | Freshwater Lake | MWDVLVTVTLMAFGAFVVISFGVILIWTLYLLQNEADND |
Ga0181346_12223134 | 3300017780 | Freshwater Lake | ADMWDVAVTFMLMMFGAFIVVAFGVILIWTLYLIQNGDRDD |
Ga0181348_10971694 | 3300017784 | Freshwater Lake | MWDVLVTFMLMLFGGLTMIFFGVMLIFILYFLQNEVDNDR |
Ga0181360_1020832 | 3300019781 | Freshwater Lake | MWDVVVTVTLMLFGAFVVIAFGAILICALYLIQNGDRDD |
Ga0181361_1002795 | 3300019783 | Freshwater Lake | MWDVAVTFMLMMFGAFTVIAFGAILIWTLYLLQNGGHDDC |
Ga0181359_100000633 | 3300019784 | Freshwater Lake | MWDVAVTFMLMMFGAFTVIAFGAILIWALYVFQKGVDDE |
Ga0181359_10108546 | 3300019784 | Freshwater Lake | MWDVAVTFMLMLFGAFTVIAFGAILIWTLYIIQNGDRDD |
Ga0181359_10193163 | 3300019784 | Freshwater Lake | MWDVLVTFMLMMFGAFVVIAFGAILIGALYFLQNEADND |
Ga0181359_10199527 | 3300019784 | Freshwater Lake | MWDVVVTMTLMLFGAFTVIVFGAIFIWALYLIQNGNRNDK |
Ga0181359_10288943 | 3300019784 | Freshwater Lake | MWDVLVTFMLMLFGGLTMIFFGAMLIFILYFLQNEVDNDR |
Ga0181359_10388632 | 3300019784 | Freshwater Lake | MWDVLVTFMLMLFGAFAVIAFGVILIGALYFLQNEADND |
Ga0181359_10388722 | 3300019784 | Freshwater Lake | MWDVLVTFMLMLFGAFVVIAFGAILIGALYFLQNEADND |
Ga0181359_10483355 | 3300019784 | Freshwater Lake | MWDVAVTFMLMFFGAFIVIAFGAILIWTLYIIQNGDRDE |
Ga0181359_10646666 | 3300019784 | Freshwater Lake | MWDVLVTVTLMAFGAFVVIAFGVILIWTLYLLQNEADND |
Ga0181359_11079301 | 3300019784 | Freshwater Lake | MWDVTVTFMLMLFGAFVVIAFGAILIGALYFLQNEADND |
Ga0181359_11620172 | 3300019784 | Freshwater Lake | MWDVAVTFMLMGFGAFVIVAFGVILIGALYFLQNEADND |
Ga0181359_12233182 | 3300019784 | Freshwater Lake | MWDVAVTFMLMMFGGLTMIFFGAMLIFILYFLQNEVDND |
Ga0211732_14683942 | 3300020141 | Freshwater | MWDVLVTFMLMSFGAFFVIAFGAILIWVLYLLQNEVDHE |
Ga0211736_1051048213 | 3300020151 | Freshwater | MWDVLVTFMLMAFGAFVVIAFGAILIWVLYLLQNEVDHE |
Ga0194047_102558253 | 3300021354 | Anoxic Zone Freshwater | MWDVAVTFMLMLFGAFIVVAFGAILIWVLYIVQNVD |
Ga0213921_100116917 | 3300021952 | Freshwater | MWDVLVTFILMMFGAFMVIAIGVIFISALWYLQNEVDND |
Ga0181354_10054352 | 3300022190 | Freshwater Lake | MWDVAVTFMLMMFGAFIVVAFGAILIWTLYLIQNGDRDD |
Ga0181354_10256135 | 3300022190 | Freshwater Lake | MWDVAVTFMLMMFGAFTVIAFGAILIWTLYLLQNGDRDDC |
Ga0181354_10482656 | 3300022190 | Freshwater Lake | MWDVLVTFMLMMFGGLTMIFFGAMLIFILYFVQNEVDND |
Ga0181354_10551722 | 3300022190 | Freshwater Lake | MWDVLVTFMLMMFGGLTMIFFGAMLIFILYFLQNEVDND |
Ga0181354_10564062 | 3300022190 | Freshwater Lake | MWDVAVTFMFMMFGGLTMIFFGLMLIFILYFLQNEVDND |
Ga0181354_11881272 | 3300022190 | Freshwater Lake | MWDVLVTFMLMAFGAFAVIAFGVILIWVLYLLQNEVDHE |
Ga0181351_10454215 | 3300022407 | Freshwater Lake | MWDVLVTFMLMAFGAFIVIAFGVILIWTLYLLQNEADND |
Ga0181351_11940364 | 3300022407 | Freshwater Lake | EAMWDVAVTFMLMLFGAFTVIAFGAILIWTLYIIQNGDRDD |
Ga0181351_12219802 | 3300022407 | Freshwater Lake | MWDVAVTFMLMMFGGLTMIFFGAMLIFILYFLQNEVNND |
Ga0214917_1000242923 | 3300022752 | Freshwater | MWDVAVTFMLMMFGAFTVIAFGAILIWALYVFQNGVDDE |
Ga0214917_100394447 | 3300022752 | Freshwater | MWDVLVTFMLMLFGAFVIIAFGAILIGALYFIQKEVDHD |
Ga0214917_101122503 | 3300022752 | Freshwater | MWDVLVTFMLMLFGAFVVIAFGAILIGALYFLQKEVDND |
Ga0214917_104570972 | 3300022752 | Freshwater | MWDVLVTFMLMLFGAFIVIAFGAVLIGALYFLQNEADND |
Ga0214921_1000197027 | 3300023174 | Freshwater | MWDVLVTFMLMLFGAFVVIAFGAILIWTLYLLQNEADND |
Ga0214921_1002041212 | 3300023174 | Freshwater | MWDVAVTFMLMMFGAFVVVAFGAILIWALYVFQKGVDDE |
Ga0214921_100893307 | 3300023174 | Freshwater | MWDVLVTFMLMMFGAFVVVVFGAILIWTLYLLQNEADND |
Ga0214921_103582192 | 3300023174 | Freshwater | MWDVLVTFMLMLFGAFIVIAFGAILIGALYFLQKEVDND |
Ga0214921_105464722 | 3300023174 | Freshwater | MWDVVVTFMLMMFGAFVVIAFGAILIWVLYFLQNED |
Ga0244775_107170713 | 3300024346 | Estuarine | MWDVAVTFMLMMFGAFVVVAFGAILIGALYFLQNEADND |
Ga0207954_10899791 | 3300025606 | Freshwater | WDVAVTFMLMFFGAFVVIAFGAILIWTLYLLQNEADND |
Ga0209867_10584313 | 3300027393 | Sand | MWDVVVTVTLMAFGAFVVIAFGVILIWTLYLLQNEADND |
Ga0208974_10440174 | 3300027608 | Freshwater Lentic | MWDVLVTFMLMAFGAFIVIAFGVILIWVLYLLQNEVDHE |
Ga0209188_10254617 | 3300027708 | Freshwater Lake | MWDVSVTFMLMLFGAFTMIFWGALLIWVLYLLQNEADND |
Ga0209297_100250223 | 3300027733 | Freshwater Lake | MWDVLVTFMLMLFGAFVVVVFGAILIWTLYLLQNEADND |
Ga0209297_100594213 | 3300027733 | Freshwater Lake | MWDVLVTFMLMAFGGFAVIAFGVILVWVLYFLQNEVDNE |
Ga0209087_10059244 | 3300027734 | Freshwater Lake | MWDVVVTVTLMGFGAFTVITFGVILILVLHVLQNGGDDD |
Ga0209087_10600821 | 3300027734 | Freshwater Lake | MWDVLVTFMLMLFGAFIVIAFGAILIGALYFLQNEADND |
Ga0209190_10151098 | 3300027736 | Freshwater Lake | MEGSLMWDVLVTFLLMAFGGFAVIAFGVILVWVLYFLQNEVDHE |
Ga0209190_13693183 | 3300027736 | Freshwater Lake | VGDFKMWDVLVTFMLMAFGGFAVIAFGVILVWVLYFLQNEVDNE |
Ga0209085_100906813 | 3300027741 | Freshwater Lake | MWDVSVTFILMFFGAFTMIFWGALLIWVLYLLQNEADND |
Ga0209085_10204752 | 3300027741 | Freshwater Lake | MWDVLVTFMLMMFGAFAVIFFGAMLIFVLYLLQNEADYD |
Ga0209189_11108573 | 3300027747 | Freshwater Lake | MWDVAVTFMLMMFGAFIVVAFGAILIWVLYIVQNVD |
Ga0209189_12018074 | 3300027747 | Freshwater Lake | LMWDVLVTFMLMMFGAFAVIFFGAMLIFVLYLLQNEADYD |
Ga0209084_12972894 | 3300027749 | Freshwater Lake | MWDVAVTFMLMMFGAFVVVAFGAVLIWTLYVFQKGVDDE |
Ga0209596_10876994 | 3300027754 | Freshwater Lake | MWDVAVTFMLMLFGAFTLIAFGAILIWTLYIIQNGDRDE |
Ga0209596_12172532 | 3300027754 | Freshwater Lake | MEGSLMWDVLVTFTLMAFGAFVVIAFGVILIWTLYLLQNEADND |
Ga0209596_12543653 | 3300027754 | Freshwater Lake | VLVTFTLMAFGAFVVIAFGVILIWTLYLLQNEADND |
Ga0209596_13300383 | 3300027754 | Freshwater Lake | MWDVAVTFILMGFGAFTVITFGVILILVLHVLQNGGDDE |
Ga0209296_10148043 | 3300027759 | Freshwater Lake | MWDVLVTFMLMMFGAFVVIAFGAILIGALYFLQKEADND |
Ga0209296_10275462 | 3300027759 | Freshwater Lake | MWDILVTFMLMMFGAFVVVVFGAILIWTLYLLQNEADND |
Ga0209088_100910711 | 3300027763 | Freshwater Lake | EMWDVAVTFMFMFFGAFIVIAFGALLIWMLYLIQNGVDDE |
Ga0209086_101304003 | 3300027770 | Freshwater Lake | MWDVLVTFTLMAFGAFVVIAFGVILIWTLYLLQNEADND |
Ga0209500_101119851 | 3300027782 | Freshwater Lake | MWDVAVTFMFMFFGAFIVIAFGALLIWMLYLIQNGVDDE |
Ga0209246_101052595 | 3300027785 | Freshwater Lake | MWDVLVTFMLMMFGGLTMIFFGAMLIFILYFLQNEVDN |
Ga0209400_11127674 | 3300027963 | Freshwater Lake | MWDVLVTFMLMAFGGFAVIAFGIILVWVLYFLQNEVDNE |
Ga0209191_11233412 | 3300027969 | Freshwater Lake | MWDVLVTFMLMAFGGFAVIAFGVILVWVLYFLQNEIDHE |
Ga0209298_102045592 | 3300027973 | Freshwater Lake | MWDVLVTFMLMMFGAFAVIAFGVILIGALYFLQSEADHD |
Ga0209298_102717501 | 3300027973 | Freshwater Lake | MWDILVTFMLMMFGAFVVVVFGAILIWTLYLLQNE |
Ga0247723_11543362 | 3300028025 | Deep Subsurface Sediment | MWDVLVTFMLMLFGAFVVIAFGAILIGTLYFLQKEADND |
Ga0304729_10815092 | 3300028392 | Freshwater Lake | MWDVAVTFMLMMFGAFVVVAFGAVLIWMLYVFQKGVDDE |
Ga0315291_106810743 | 3300031707 | Sediment | MWDVLVTFLLMAFGGFAVIAFGVILVWVLYFLQNEVDHE |
Ga0315293_112898893 | 3300031746 | Sediment | EGSLMWDVLVTFMLMMFGGLTMIFFGAMLIFILYFLQNEVDND |
Ga0315288_111567322 | 3300031772 | Sediment | MWDVLVTFLLMAFGGFAVIAFGVILVWVLYFLQNEIDHE |
Ga0315908_115265332 | 3300031786 | Freshwater | MWDVAVTFMLMMFGGLTMIFFGAMLIFILYFLQNEVDNDR |
Ga0315297_104091824 | 3300031873 | Sediment | MWDVLVTFMLMMFGGLTMIFFGAMLIFILYFLQNEVD |
Ga0315294_101265317 | 3300031952 | Sediment | MWDVLVTFLLMAFGGFAVIAFGAILIGALYFLQNEADND |
Ga0315294_114604513 | 3300031952 | Sediment | MWDVVVTVTLMLFGAFIVIAFGAILIWALYLIQNGDRNDK |
Ga0315274_116358762 | 3300031999 | Sediment | MWDVLVTFMLMIFGAFAVIAFGAILIGALYFLQNEADHD |
Ga0315905_102467054 | 3300032092 | Freshwater | MWDVLVTFMLMMFGGLTMIFFGAMLIFILYFLQNEVDNDL |
Ga0315905_105228663 | 3300032092 | Freshwater | MWDVLVTVTLMLFGAFVVIAFGAILICTLYLIQNGDRDE |
Ga0315905_107175313 | 3300032092 | Freshwater | MWDVAVTFMLMGFGAFVIVAFGVILIGALYFLQKEADND |
Ga0315275_114267041 | 3300032401 | Sediment | WDVLVTFMLMAFGGFAVIAFGVILVWVLYFLQNEIDHE |
Ga0334722_100955158 | 3300033233 | Sediment | MWDVAVTFMLMLFGAFIVVAFGAILIWTLYLIQNGDRDE |
Ga0334994_0286954_527_646 | 3300033993 | Freshwater | MWDVLVTFMLMMFGAFVVVAFGAILIGALYFLQNEADND |
Ga0334979_0112967_744_863 | 3300033996 | Freshwater | MWDVLVTVTLMAFGAFVVIAFGIILIWVLYLLQNEADHE |
Ga0335036_0000633_22792_22911 | 3300034106 | Freshwater | MWDVLVTFMLMMFGAFVVIAFGAILIGALYFLQNEADNE |
Ga0335054_0782848_108_227 | 3300034119 | Freshwater | MWDVLVTFLLMAFGAFFVVAFGLILIWVLYLLQNEADHE |
⦗Top⦘ |