Basic Information | |
---|---|
Family ID | F022216 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 215 |
Average Sequence Length | 45 residues |
Representative Sequence | VSDPRVSTGPSDEQRRRIRRNAIVLALLALGIYVAFIASGVMGLRG |
Number of Associated Samples | 98 |
Number of Associated Scaffolds | 215 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 80.93 % |
% of genes near scaffold ends (potentially truncated) | 16.74 % |
% of genes from short scaffolds (< 2000 bps) | 82.79 % |
Associated GOLD sequencing projects | 80 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.50 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (88.837 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil (17.209 % of family members) |
Environment Ontology (ENVO) | Unclassified (24.186 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Sediment (non-saline) (30.233 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 44.59% β-sheet: 0.00% Coil/Unstructured: 55.41% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 215 Family Scaffolds |
---|---|---|
PF04442 | CtaG_Cox11 | 41.86 |
PF00115 | COX1 | 35.81 |
PF00510 | COX3 | 10.70 |
PF02104 | SURF1 | 0.93 |
PF02790 | COX2_TM | 0.93 |
PF10003 | DUF2244 | 0.93 |
PF01138 | RNase_PH | 0.47 |
PF08241 | Methyltransf_11 | 0.47 |
PF02628 | COX15-CtaA | 0.47 |
PF13361 | UvrD_C | 0.47 |
PF02630 | SCO1-SenC | 0.47 |
PF05194 | UreE_C | 0.47 |
PF00561 | Abhydrolase_1 | 0.47 |
COG ID | Name | Functional Category | % Frequency in 215 Family Scaffolds |
---|---|---|---|
COG3175 | Cytochrome c oxidase assembly protein Cox11 | Posttranslational modification, protein turnover, chaperones [O] | 41.86 |
COG1845 | Heme/copper-type cytochrome/quinol oxidase, subunit 3 | Energy production and conversion [C] | 10.70 |
COG1622 | Heme/copper-type cytochrome/quinol oxidase, subunit 2 | Energy production and conversion [C] | 0.93 |
COG3346 | Cytochrome oxidase assembly protein ShyY1 | Posttranslational modification, protein turnover, chaperones [O] | 0.93 |
COG0689 | Ribonuclease PH | Translation, ribosomal structure and biogenesis [J] | 0.47 |
COG1185 | Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) | Translation, ribosomal structure and biogenesis [J] | 0.47 |
COG1225 | Peroxiredoxin | Posttranslational modification, protein turnover, chaperones [O] | 0.47 |
COG1612 | Heme A synthase | Coenzyme transport and metabolism [H] | 0.47 |
COG1999 | Cytochrome oxidase Cu insertion factor, SCO1/SenC/PrrC family | Posttranslational modification, protein turnover, chaperones [O] | 0.47 |
COG2123 | Exosome complex RNA-binding protein Rrp42, RNase PH superfamily | Intracellular trafficking, secretion, and vesicular transport [U] | 0.47 |
COG2371 | Urease accessory protein UreE | Posttranslational modification, protein turnover, chaperones [O] | 0.47 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 89.30 % |
Unclassified | root | N/A | 10.70 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300003858|Ga0031656_10003896 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales | 6104 | Open in IMG/M |
3300003858|Ga0031656_10020823 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae | 2734 | Open in IMG/M |
3300003858|Ga0031656_10042703 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1831 | Open in IMG/M |
3300003858|Ga0031656_10145471 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 833 | Open in IMG/M |
3300003858|Ga0031656_10337418 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 508 | Open in IMG/M |
3300003910|JGI26437J51864_10025590 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1262 | Open in IMG/M |
3300003910|JGI26437J51864_10134328 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 565 | Open in IMG/M |
3300004029|Ga0055442_10032976 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1290 | Open in IMG/M |
3300004048|Ga0055494_10056437 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 769 | Open in IMG/M |
3300004048|Ga0055494_10067206 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 723 | Open in IMG/M |
3300004048|Ga0055494_10124974 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae | 577 | Open in IMG/M |
3300004049|Ga0055493_10000813 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2773 | Open in IMG/M |
3300004049|Ga0055493_10011758 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1258 | Open in IMG/M |
3300004049|Ga0055493_10047829 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 802 | Open in IMG/M |
3300004049|Ga0055493_10105228 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 608 | Open in IMG/M |
3300004050|Ga0055491_10115222 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 678 | Open in IMG/M |
3300004050|Ga0055491_10162268 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 591 | Open in IMG/M |
3300004051|Ga0055492_10039704 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 904 | Open in IMG/M |
3300004057|Ga0055496_10042816 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 942 | Open in IMG/M |
3300004057|Ga0055496_10192763 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 529 | Open in IMG/M |
3300004061|Ga0055487_10076783 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 582 | Open in IMG/M |
3300004151|Ga0066602_10405642 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 613 | Open in IMG/M |
3300004151|Ga0066602_10422890 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 601 | Open in IMG/M |
3300004155|Ga0066600_10443815 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 623 | Open in IMG/M |
3300005182|Ga0069000_10008917 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1694 | Open in IMG/M |
3300005216|Ga0068994_10001386 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3484 | Open in IMG/M |
3300006224|Ga0079037_100017374 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 4947 | Open in IMG/M |
3300006224|Ga0079037_100047286 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae | 3337 | Open in IMG/M |
3300006224|Ga0079037_100150999 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2033 | Open in IMG/M |
3300006224|Ga0079037_100178217 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales | 1888 | Open in IMG/M |
3300006224|Ga0079037_100275225 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1550 | Open in IMG/M |
3300006224|Ga0079037_100333583 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales | 1417 | Open in IMG/M |
3300006224|Ga0079037_100371803 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae | 1346 | Open in IMG/M |
3300006224|Ga0079037_100406618 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1289 | Open in IMG/M |
3300006224|Ga0079037_100451546 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1226 | Open in IMG/M |
3300006224|Ga0079037_100479961 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales | 1190 | Open in IMG/M |
3300006224|Ga0079037_101012080 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 822 | Open in IMG/M |
3300006224|Ga0079037_101872088 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 599 | Open in IMG/M |
3300006224|Ga0079037_101972058 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 583 | Open in IMG/M |
3300006224|Ga0079037_102218152 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 548 | Open in IMG/M |
3300006224|Ga0079037_102296878 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 538 | Open in IMG/M |
3300006930|Ga0079303_10029231 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales | 1840 | Open in IMG/M |
3300009009|Ga0105105_10069132 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae | 1640 | Open in IMG/M |
3300009009|Ga0105105_10085384 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1497 | Open in IMG/M |
3300009009|Ga0105105_10673856 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 612 | Open in IMG/M |
3300009075|Ga0105090_10055749 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2469 | Open in IMG/M |
3300009075|Ga0105090_10084983 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1980 | Open in IMG/M |
3300009075|Ga0105090_10091317 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1906 | Open in IMG/M |
3300009075|Ga0105090_10158739 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1409 | Open in IMG/M |
3300009075|Ga0105090_10195451 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1254 | Open in IMG/M |
3300009075|Ga0105090_10531107 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 715 | Open in IMG/M |
3300009075|Ga0105090_10844289 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 557 | Open in IMG/M |
3300009075|Ga0105090_10952107 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 524 | Open in IMG/M |
3300009078|Ga0105106_11071028 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 572 | Open in IMG/M |
3300009081|Ga0105098_10397195 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 683 | Open in IMG/M |
3300009081|Ga0105098_10552067 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 594 | Open in IMG/M |
3300009085|Ga0105103_10298644 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 877 | Open in IMG/M |
3300009085|Ga0105103_10518806 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 670 | Open in IMG/M |
3300009087|Ga0105107_10277453 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1169 | Open in IMG/M |
3300009091|Ga0102851_10371448 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1429 | Open in IMG/M |
3300009091|Ga0102851_10576039 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1172 | Open in IMG/M |
3300009091|Ga0102851_10926966 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 942 | Open in IMG/M |
3300009091|Ga0102851_11380071 | Not Available | 782 | Open in IMG/M |
3300009091|Ga0102851_11577631 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 734 | Open in IMG/M |
3300009091|Ga0102851_12350214 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 608 | Open in IMG/M |
3300009095|Ga0079224_103929162 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 588 | Open in IMG/M |
3300009111|Ga0115026_10191641 | Not Available | 1357 | Open in IMG/M |
3300009111|Ga0115026_11278885 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 601 | Open in IMG/M |
3300009120|Ga0117941_1013740 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2156 | Open in IMG/M |
3300009131|Ga0115027_11078904 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 634 | Open in IMG/M |
3300009131|Ga0115027_11440505 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 562 | Open in IMG/M |
3300009165|Ga0105102_10780355 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 542 | Open in IMG/M |
3300009167|Ga0113563_11011578 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 957 | Open in IMG/M |
3300009167|Ga0113563_11043833 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 943 | Open in IMG/M |
3300009167|Ga0113563_11740698 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 740 | Open in IMG/M |
3300009167|Ga0113563_12571686 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 615 | Open in IMG/M |
3300009169|Ga0105097_10383998 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 780 | Open in IMG/M |
3300009179|Ga0115028_10514352 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 873 | Open in IMG/M |
3300009179|Ga0115028_10625730 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 808 | Open in IMG/M |
3300009430|Ga0114938_1000104 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 65428 | Open in IMG/M |
3300009430|Ga0114938_1004271 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 8024 | Open in IMG/M |
3300009430|Ga0114938_1005972 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales | 6330 | Open in IMG/M |
3300009430|Ga0114938_1378104 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 515 | Open in IMG/M |
3300009455|Ga0114939_10327429 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 656 | Open in IMG/M |
3300009509|Ga0123573_10036826 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 5318 | Open in IMG/M |
3300009509|Ga0123573_10038033 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 5222 | Open in IMG/M |
3300009509|Ga0123573_10152985 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2309 | Open in IMG/M |
3300009509|Ga0123573_10176391 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2122 | Open in IMG/M |
3300009509|Ga0123573_10217309 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae | 1880 | Open in IMG/M |
3300009509|Ga0123573_10804488 | Not Available | 881 | Open in IMG/M |
3300009771|Ga0116155_10109130 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae | 1226 | Open in IMG/M |
3300010412|Ga0136852_10001129 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 29301 | Open in IMG/M |
3300010412|Ga0136852_10049519 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 4409 | Open in IMG/M |
3300010412|Ga0136852_10161778 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2258 | Open in IMG/M |
3300010412|Ga0136852_10529158 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix → Tolypothrix campylonemoides → Tolypothrix campylonemoides VB511288 | 1141 | Open in IMG/M |
3300010412|Ga0136852_11116387 | Not Available | 749 | Open in IMG/M |
3300010429|Ga0116241_10698503 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 782 | Open in IMG/M |
3300014257|Ga0075319_1040534 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 813 | Open in IMG/M |
3300014259|Ga0075311_1005678 | All Organisms → cellular organisms → Bacteria | 2049 | Open in IMG/M |
3300014267|Ga0075313_1121652 | Not Available | 656 | Open in IMG/M |
3300014305|Ga0075349_1188150 | Not Available | 501 | Open in IMG/M |
3300014306|Ga0075346_1053694 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 803 | Open in IMG/M |
3300014312|Ga0075345_1185628 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 518 | Open in IMG/M |
3300014316|Ga0075339_1019220 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1608 | Open in IMG/M |
3300014316|Ga0075339_1246868 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 515 | Open in IMG/M |
3300015216|Ga0182875_10044174 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 583 | Open in IMG/M |
3300020048|Ga0207193_1178054 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1722 | Open in IMG/M |
3300020190|Ga0194118_10085980 | Not Available | 1958 | Open in IMG/M |
3300021316|Ga0210351_1162615 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix → Tolypothrix campylonemoides → Tolypothrix campylonemoides VB511288 | 660 | Open in IMG/M |
3300022213|Ga0224500_10097025 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1126 | Open in IMG/M |
3300024056|Ga0124853_1060264 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 664 | Open in IMG/M |
3300025106|Ga0209398_1000770 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 18543 | Open in IMG/M |
3300025106|Ga0209398_1016307 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2296 | Open in IMG/M |
3300025566|Ga0210140_1073911 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix → Tolypothrix campylonemoides → Tolypothrix campylonemoides VB511288 | 672 | Open in IMG/M |
3300025566|Ga0210140_1135337 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 516 | Open in IMG/M |
3300025943|Ga0210125_1012179 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 1215 | Open in IMG/M |
3300025950|Ga0210134_1019060 | Not Available | 959 | Open in IMG/M |
3300025950|Ga0210134_1041545 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 642 | Open in IMG/M |
3300025958|Ga0210069_1012454 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1136 | Open in IMG/M |
3300025958|Ga0210069_1014566 | Not Available | 1054 | Open in IMG/M |
3300025964|Ga0210127_1019033 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 790 | Open in IMG/M |
3300025968|Ga0210103_1024352 | Not Available | 1037 | Open in IMG/M |
3300025968|Ga0210103_1055030 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 656 | Open in IMG/M |
3300026069|Ga0208539_1031498 | Not Available | 548 | Open in IMG/M |
3300026347|Ga0256809_1000008 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 6930 | Open in IMG/M |
3300026349|Ga0256811_1002919 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1349 | Open in IMG/M |
3300026373|Ga0256817_1000346 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2931 | Open in IMG/M |
3300026477|Ga0256807_1018208 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1094 | Open in IMG/M |
3300026477|Ga0256807_1018924 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1077 | Open in IMG/M |
3300026486|Ga0256820_1010395 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1216 | Open in IMG/M |
3300026486|Ga0256820_1016677 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1005 | Open in IMG/M |
3300026501|Ga0256806_1019421 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1146 | Open in IMG/M |
3300027683|Ga0209392_1001630 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 5889 | Open in IMG/M |
3300027683|Ga0209392_1007075 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 3327 | Open in IMG/M |
3300027683|Ga0209392_1017029 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 2291 | Open in IMG/M |
3300027683|Ga0209392_1030412 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1745 | Open in IMG/M |
3300027683|Ga0209392_1088953 | All Organisms → cellular organisms → Eukaryota | 988 | Open in IMG/M |
3300027693|Ga0209704_1043090 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1222 | Open in IMG/M |
3300027715|Ga0208665_10055897 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 1161 | Open in IMG/M |
3300027719|Ga0209467_1054713 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1605 | Open in IMG/M |
3300027721|Ga0209492_1048113 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1502 | Open in IMG/M |
3300027721|Ga0209492_1163970 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix → Tolypothrix campylonemoides → Tolypothrix campylonemoides VB511288 | 772 | Open in IMG/M |
3300027721|Ga0209492_1185068 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 718 | Open in IMG/M |
3300027721|Ga0209492_1325589 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 508 | Open in IMG/M |
3300027726|Ga0209285_10112995 | Not Available | 833 | Open in IMG/M |
3300027792|Ga0209287_10256305 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 669 | Open in IMG/M |
3300027841|Ga0209262_10563174 | Not Available | 554 | Open in IMG/M |
3300027871|Ga0209397_10004164 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 3214 | Open in IMG/M |
3300027871|Ga0209397_10111684 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 1163 | Open in IMG/M |
3300027871|Ga0209397_10259902 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 819 | Open in IMG/M |
3300027871|Ga0209397_10447693 | Not Available | 637 | Open in IMG/M |
3300027871|Ga0209397_10506855 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 600 | Open in IMG/M |
3300027871|Ga0209397_10578370 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 561 | Open in IMG/M |
3300027877|Ga0209293_10056639 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1632 | Open in IMG/M |
3300027877|Ga0209293_10086872 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 1385 | Open in IMG/M |
3300027877|Ga0209293_10558205 | Not Available | 603 | Open in IMG/M |
3300027877|Ga0209293_10714735 | Not Available | 531 | Open in IMG/M |
3300027885|Ga0209450_10003194 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 8312 | Open in IMG/M |
3300027885|Ga0209450_10162489 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1553 | Open in IMG/M |
3300027885|Ga0209450_10303633 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 1153 | Open in IMG/M |
3300027885|Ga0209450_10535430 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 857 | Open in IMG/M |
3300027885|Ga0209450_10648695 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 769 | Open in IMG/M |
3300027885|Ga0209450_11252852 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 512 | Open in IMG/M |
3300027890|Ga0209496_10578704 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 605 | Open in IMG/M |
3300027890|Ga0209496_10615385 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 588 | Open in IMG/M |
3300027890|Ga0209496_10799460 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 521 | Open in IMG/M |
3300027897|Ga0209254_10007299 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 10196 | Open in IMG/M |
3300027897|Ga0209254_10032300 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 4683 | Open in IMG/M |
3300027897|Ga0209254_10166395 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1793 | Open in IMG/M |
3300027897|Ga0209254_10581198 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 794 | Open in IMG/M |
3300027897|Ga0209254_10987485 | Not Available | 549 | Open in IMG/M |
3300027899|Ga0209668_10008193 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 4807 | Open in IMG/M |
3300027956|Ga0209820_1165302 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix → Tolypothrix campylonemoides → Tolypothrix campylonemoides VB511288 | 614 | Open in IMG/M |
3300033406|Ga0316604_10009967 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 5368 | Open in IMG/M |
3300033406|Ga0316604_10015257 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 4117 | Open in IMG/M |
3300033406|Ga0316604_10468146 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 692 | Open in IMG/M |
3300033406|Ga0316604_10711061 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 552 | Open in IMG/M |
3300033408|Ga0316605_10417381 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 1215 | Open in IMG/M |
3300033408|Ga0316605_11653644 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 622 | Open in IMG/M |
3300033408|Ga0316605_11836557 | Not Available | 589 | Open in IMG/M |
3300033408|Ga0316605_12010137 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 562 | Open in IMG/M |
3300033408|Ga0316605_12194644 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 537 | Open in IMG/M |
3300033408|Ga0316605_12468304 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 505 | Open in IMG/M |
3300033413|Ga0316603_10573331 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 1044 | Open in IMG/M |
3300033413|Ga0316603_11025578 | Not Available | 779 | Open in IMG/M |
3300033413|Ga0316603_11723895 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 593 | Open in IMG/M |
3300033414|Ga0316619_10128041 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 1696 | Open in IMG/M |
3300033416|Ga0316622_100076324 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 3270 | Open in IMG/M |
3300033416|Ga0316622_100249309 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 1925 | Open in IMG/M |
3300033416|Ga0316622_100629182 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1236 | Open in IMG/M |
3300033416|Ga0316622_101704844 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 734 | Open in IMG/M |
3300033416|Ga0316622_101899508 | Not Available | 692 | Open in IMG/M |
3300033418|Ga0316625_102078791 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 561 | Open in IMG/M |
3300033419|Ga0316601_100611966 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1060 | Open in IMG/M |
3300033419|Ga0316601_100765243 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 952 | Open in IMG/M |
3300033419|Ga0316601_101283960 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 735 | Open in IMG/M |
3300033419|Ga0316601_102565736 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 512 | Open in IMG/M |
3300033434|Ga0316613_10020797 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 3634 | Open in IMG/M |
3300033480|Ga0316620_11754524 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 616 | Open in IMG/M |
3300033482|Ga0316627_102005660 | Not Available | 600 | Open in IMG/M |
3300033483|Ga0316629_10818816 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 716 | Open in IMG/M |
3300033485|Ga0316626_10777745 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 838 | Open in IMG/M |
3300033485|Ga0316626_11775176 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 557 | Open in IMG/M |
3300033488|Ga0316621_10709561 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix → Tolypothrix campylonemoides → Tolypothrix campylonemoides VB511288 | 727 | Open in IMG/M |
3300033513|Ga0316628_101563660 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 879 | Open in IMG/M |
3300033521|Ga0316616_101721209 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 821 | Open in IMG/M |
3300033521|Ga0316616_102408912 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 704 | Open in IMG/M |
3300033521|Ga0316616_103271338 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 610 | Open in IMG/M |
3300033521|Ga0316616_104177774 | Not Available | 543 | Open in IMG/M |
3300033557|Ga0316617_100055686 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 2491 | Open in IMG/M |
3300034052|Ga0373889_042546 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 697 | Open in IMG/M |
3300034052|Ga0373889_064398 | Not Available | 585 | Open in IMG/M |
3300034053|Ga0373890_051393 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 635 | Open in IMG/M |
3300034076|Ga0373898_048510 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 656 | Open in IMG/M |
3300034080|Ga0373897_068385 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 683 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 17.21% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 14.88% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 12.09% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 12.09% |
Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 8.84% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 8.84% |
Mangrove Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Mangrove Sediment | 5.12% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 4.19% |
Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment | 3.72% |
Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 3.26% |
Freshwater | Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater | 2.33% |
Sediment Slurry | Engineered → Bioremediation → Metal → Unclassified → Unclassified → Sediment Slurry | 2.33% |
Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.93% |
Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 0.93% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.47% |
Microbial Mat | Environmental → Aquatic → Freshwater → Lake → Unclassified → Microbial Mat | 0.47% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 0.47% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.47% |
Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.47% |
Lake Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Lake Sediment | 0.47% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Agricultural Soil | 0.47% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300003858 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI | Environmental | Open in IMG/M |
3300003910 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW | Environmental | Open in IMG/M |
3300004029 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Bullhead_CordB_D2 | Environmental | Open in IMG/M |
3300004048 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleA_D2 | Environmental | Open in IMG/M |
3300004049 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLC_D2 | Environmental | Open in IMG/M |
3300004050 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLA_D2 | Environmental | Open in IMG/M |
3300004051 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLB_D2 | Environmental | Open in IMG/M |
3300004057 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleC_D2 | Environmental | Open in IMG/M |
3300004061 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqC_D2 | Environmental | Open in IMG/M |
3300004151 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - High cellulose week 5 | Environmental | Open in IMG/M |
3300004155 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Low cellulose week 11 | Environmental | Open in IMG/M |
3300005182 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Tolay_CordA_D2 | Environmental | Open in IMG/M |
3300005216 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_CattailNLA_D2 | Environmental | Open in IMG/M |
3300006224 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaG | Environmental | Open in IMG/M |
3300006930 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWC | Environmental | Open in IMG/M |
3300009009 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
3300009075 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
3300009078 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
3300009087 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
3300009091 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300009095 | Agricultural soil microbial communities from Utah to study Nitrogen management - Steer compost 2015 | Environmental | Open in IMG/M |
3300009111 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 | Environmental | Open in IMG/M |
3300009120 | Lake sediment microbial communities from Tanners Lake, St. Paul, MN | Environmental | Open in IMG/M |
3300009131 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 | Environmental | Open in IMG/M |
3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
3300009167 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2) | Environmental | Open in IMG/M |
3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
3300009179 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 | Environmental | Open in IMG/M |
3300009430 | Groundwater microbial communities from Big Spring, Nevada to study Microbial Dark Matter (Phase II) - Ash Meadows Big Spring | Environmental | Open in IMG/M |
3300009455 | Groundwater microbial communities from Big Spring, Nevada to study Microbial Dark Matter (Phase II) - Ash Meadows Crystal Spring | Environmental | Open in IMG/M |
3300009509 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_11 | Environmental | Open in IMG/M |
3300009771 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC032_MetaG | Engineered | Open in IMG/M |
3300010412 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_10 | Environmental | Open in IMG/M |
3300010429 | AD_USRAca | Engineered | Open in IMG/M |
3300014257 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleC_D1 | Environmental | Open in IMG/M |
3300014259 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailB_D1 | Environmental | Open in IMG/M |
3300014267 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D1 | Environmental | Open in IMG/M |
3300014305 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleB_D1 | Environmental | Open in IMG/M |
3300014306 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLB_D1 | Environmental | Open in IMG/M |
3300014312 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLA_D1 | Environmental | Open in IMG/M |
3300014316 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_CattailNLC_D1 | Environmental | Open in IMG/M |
3300015216 | Freshwater microbial mat microbial communities from Canadian High Arctic Lake 9K, Kuujjuarapik, Canada - Sample L9Kb | Environmental | Open in IMG/M |
3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
3300020190 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015013 Mahale N5 surface | Environmental | Open in IMG/M |
3300021316 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.485 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022213 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_4_1 | Environmental | Open in IMG/M |
3300024056 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (PacBio error correction) | Environmental | Open in IMG/M |
3300025106 | Groundwater microbial communities from Big Spring, Nevada to study Microbial Dark Matter (Phase II) - Ash Meadows Big Spring (SPAdes) | Environmental | Open in IMG/M |
3300025566 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Bullhead_CordB_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025943 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_CattailNLA_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025950 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLB_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025958 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleB_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025964 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLC_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025968 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLA_D2 (SPAdes) | Environmental | Open in IMG/M |
3300026069 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLC_D1 (SPAdes) | Environmental | Open in IMG/M |
3300026347 | Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 10-16 PU4 | Environmental | Open in IMG/M |
3300026349 | Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 10-16 PU6 | Environmental | Open in IMG/M |
3300026373 | Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 7-17 F6 | Environmental | Open in IMG/M |
3300026477 | Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 10-16 PR5 | Environmental | Open in IMG/M |
3300026486 | Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 7-17 PR6 | Environmental | Open in IMG/M |
3300026501 | Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 10-16 PR4 | Environmental | Open in IMG/M |
3300027683 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 (SPAdes) | Environmental | Open in IMG/M |
3300027693 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 (SPAdes) | Environmental | Open in IMG/M |
3300027715 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWC (SPAdes) | Environmental | Open in IMG/M |
3300027719 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - High cellulose week 11 (SPAdes) | Environmental | Open in IMG/M |
3300027721 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes) | Environmental | Open in IMG/M |
3300027726 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015 (SPAdes) | Environmental | Open in IMG/M |
3300027792 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 (SPAdes) | Environmental | Open in IMG/M |
3300027841 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Low cellulose week 11 (SPAdes) | Environmental | Open in IMG/M |
3300027871 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
3300027877 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
3300027885 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW (SPAdes) | Environmental | Open in IMG/M |
3300027890 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
3300027897 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI (SPAdes) | Environmental | Open in IMG/M |
3300027899 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes) | Environmental | Open in IMG/M |
3300027956 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 (SPAdes) | Environmental | Open in IMG/M |
3300033406 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_CT | Environmental | Open in IMG/M |
3300033408 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCT | Environmental | Open in IMG/M |
3300033413 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCT | Environmental | Open in IMG/M |
3300033414 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_B | Environmental | Open in IMG/M |
3300033416 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D5_C | Environmental | Open in IMG/M |
3300033418 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A | Environmental | Open in IMG/M |
3300033419 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCT | Environmental | Open in IMG/M |
3300033434 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_CT_b | Environmental | Open in IMG/M |
3300033480 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B | Environmental | Open in IMG/M |
3300033482 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C | Environmental | Open in IMG/M |
3300033483 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D1_A | Environmental | Open in IMG/M |
3300033485 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D5_A | Environmental | Open in IMG/M |
3300033488 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D1_C | Environmental | Open in IMG/M |
3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
3300033557 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_B | Environmental | Open in IMG/M |
3300034052 | Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - A1A4.2 | Engineered | Open in IMG/M |
3300034053 | Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - A1A4.3 | Engineered | Open in IMG/M |
3300034076 | Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - A5A4.2 | Engineered | Open in IMG/M |
3300034080 | Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - A5A4.1 | Engineered | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0031656_100038962 | 3300003858 | Freshwater Lake Sediment | VNGPTDEQRRRIRRNAIVLALLAVGIYVAFIASGVLGWRE* |
Ga0031656_100208232 | 3300003858 | Freshwater Lake Sediment | VSGQRTTAGPSDEQRRRIRRNAIVLALLALGIYVAFIASGVLGLRG* |
Ga0031656_100427032 | 3300003858 | Freshwater Lake Sediment | VSEQPTTAGPTDEQRRRIRRLALLLGLVALGIYVAFIVSGVMRAQG* |
Ga0031656_101454712 | 3300003858 | Freshwater Lake Sediment | VSDPHTNADAADAQRRRVRRTAILLGLVALGIYVAFIASGVMQARG* |
Ga0031656_103374181 | 3300003858 | Freshwater Lake Sediment | VSDPRNSADAADAQRRRVRRTAILLGLVALGIYVAFIASGVMQARG* |
JGI26437J51864_100255902 | 3300003910 | Freshwater Lake Sediment | VSDPRTHADAADAQRRRVRRTAILLGLLALGIYVAFIASG |
JGI26437J51864_101343282 | 3300003910 | Freshwater Lake Sediment | VSDPRTNAETADAQRRRVRRTAILLGLVALGIYVAFIASGVMQARG* |
Ga0055442_100329762 | 3300004029 | Natural And Restored Wetlands | VSDRPASSGRTDEQRRRIRRTTLVLALVALGIYVAFIASGVMQARQ* |
Ga0055494_100564371 | 3300004048 | Natural And Restored Wetlands | QVSDPRVSTGPSDEQRRRIRRNAIVLALLALGIYVAFIASGVLGLRG* |
Ga0055494_100672061 | 3300004048 | Natural And Restored Wetlands | VSEQRTTAGLTDQQRRRIRRNAILLGLVALGIYVAFIASGVIGVRG* |
Ga0055494_101249742 | 3300004048 | Natural And Restored Wetlands | VSDPRVSSGPTDEQRRRIRRNAIVLALVALGIYVAFIASGVMGVRE* |
Ga0055493_100008131 | 3300004049 | Natural And Restored Wetlands | SEPRVSNTRANGPTEQQRRRIRRGALALALLAIGIYVAFIASGVLGWRG* |
Ga0055493_100117582 | 3300004049 | Natural And Restored Wetlands | VNPQRSTAGPTDEQRRRIRRNAVVLGLLALGIYVAFIVSGVMGVRG* |
Ga0055493_100478292 | 3300004049 | Natural And Restored Wetlands | VSEQRTTAGLTDQQRRRIRRNAILLGLVALGIYVAFIASG |
Ga0055493_101052282 | 3300004049 | Natural And Restored Wetlands | VSDPRVSTGPSEEQRRRIRRNALVLALLALGIYVAFIASGVMGLRG* |
Ga0055491_101152222 | 3300004050 | Natural And Restored Wetlands | MTEPTAEQRRRVRRSAIVLAVVAIAIYVAFIASGVLGARG* |
Ga0055491_101622682 | 3300004050 | Natural And Restored Wetlands | VSTGPSEEQRRRIRRNALVLALLALGIYVAFIASGVMGLRG* |
Ga0055492_100397042 | 3300004051 | Natural And Restored Wetlands | VSEQRTTAGLTEQQRRRIRRNAILLGLVALGIYVAFIASGVLGVRG* |
Ga0055496_100428162 | 3300004057 | Natural And Restored Wetlands | VNPQRPTAGPTDEQRRRIRRNAVVLGLLALGIYVAFIVSGVMGVRG* |
Ga0055496_101927632 | 3300004057 | Natural And Restored Wetlands | AGLTDQQRRRIRRNAILLGLVALGIYVAFIASGVIGVRG* |
Ga0055487_100767831 | 3300004061 | Natural And Restored Wetlands | RVSNTRANGPTEQQRRRIRRGALALALLAIGIYVAFIASGVLGWRG* |
Ga0066602_104056422 | 3300004151 | Freshwater | VSEQHSTAGSGEQQRRRIRRNAIVLALVALAIYATFIASGVLGLRG* |
Ga0066602_104228902 | 3300004151 | Freshwater | VSDPRTHADAADAQRRRVRRTAILLGLLALGIYVAFIASGVMQARG* |
Ga0066600_104438152 | 3300004155 | Freshwater | MSGQPATPGPTDEQRRRIRRTALVLALVALGIYVAFIASGVMRAQG* |
Ga0069000_100089173 | 3300005182 | Natural And Restored Wetlands | VSDRPASSGPTDEQRRRIRRTTLVLALVALGIYVAFIASGVMQARQ* |
Ga0068994_100013866 | 3300005216 | Natural And Restored Wetlands | VSNTRANGPTEQQRRRIRRGALALALLAIGIYVAFIASGVLGWRG* |
Ga0079037_1000173748 | 3300006224 | Freshwater Wetlands | VSDPRVSTGPTDEQRRRIRRTTFVLALVALGIYVAFIASGVMQARG* |
Ga0079037_1000472866 | 3300006224 | Freshwater Wetlands | VSEQRSNTAPSDEQRRRIRRTTVLLALVALGIYVAFIASGVMQARG* |
Ga0079037_1001509992 | 3300006224 | Freshwater Wetlands | VSSQPSNAGPTDEQRRRIRRNAIVLGLLALGIYVAFIASGVMGLRG* |
Ga0079037_1001782172 | 3300006224 | Freshwater Wetlands | VNQQRPTAGPTDEQRRRIRRNAIVLGLLALGIYVAFIVSGVMGVRE* |
Ga0079037_1002752253 | 3300006224 | Freshwater Wetlands | VSDPRTSADAADVQRRRVRRTAILLGLLALGIYVAFIASGVMQARG* |
Ga0079037_1003335832 | 3300006224 | Freshwater Wetlands | VNRESSEPGVPTGPTEEQRRRIRRSTVVLALVALAIYVAFIASGVMQARS* |
Ga0079037_1003718033 | 3300006224 | Freshwater Wetlands | VSDSRVSSGPTDEQRRRIRRNAIVLALVALGIYVAFIASGVMGVRE* |
Ga0079037_1004066183 | 3300006224 | Freshwater Wetlands | VSDGRVSTGPNDEQRRRIRRNAIVLALLAVGIYVAFVASGVLGVRR* |
Ga0079037_1004515462 | 3300006224 | Freshwater Wetlands | VSQRPATHGPGDEQRRRIRRNAIVLALLALGIYVAFIASGVMGARG* |
Ga0079037_1004799613 | 3300006224 | Freshwater Wetlands | VSEQRANTGLSNDQRRRIRRNAIVLGLLALGIYVAFIASGVMGLRS* |
Ga0079037_1010120802 | 3300006224 | Freshwater Wetlands | VSEQPATTGPTDEQRRRIRRTALVLALVALGIYATFIASGVMRAQ* |
Ga0079037_1018720882 | 3300006224 | Freshwater Wetlands | VSDPRVSTGPSEEQRRRIRRNAIVLALLALGIYAAFIASGVLGLRG* |
Ga0079037_1019720582 | 3300006224 | Freshwater Wetlands | VSDQQVSTGPSDEQRRRIRRTTVVLALVALGIYVAFIASGVMQARG* |
Ga0079037_1022181522 | 3300006224 | Freshwater Wetlands | VSEQRANTGLSDDQRRRIRRNAVVLGLLALGIYVAFIASGVMGLR* |
Ga0079037_1022968782 | 3300006224 | Freshwater Wetlands | VSDPRVSTGPSDEQRRRIRRNAIVLALLALAIYVAFIASGVLGLRG* |
Ga0079303_100292313 | 3300006930 | Deep Subsurface | VSERPAAQGPTDGQRRRIRRNAIVLALLALGIYAAFIASGVMGARG* |
Ga0105105_100691323 | 3300009009 | Freshwater Sediment | VSEPNANTGPTDEQRRRIRRNAIVLGLLALGIYVAFIASGVLGLRE* |
Ga0105105_100853842 | 3300009009 | Freshwater Sediment | VSDPRNNEHATDAQRRRVRRTAILLGLVALGIYVAFIASGVMQARG* |
Ga0105105_106738562 | 3300009009 | Freshwater Sediment | VSDPRVSTGPSDEQRRRIRRNAIVLALLALGIYVAFIASGVLGLRG* |
Ga0105090_100557493 | 3300009075 | Freshwater Sediment | VSEQPATPGPTDEQRRRIRRTALVLALVALGIYVAFIASGVLRSQG* |
Ga0105090_100849833 | 3300009075 | Freshwater Sediment | VSDQRTNTGLGDDQRRRIRRNAVVLGLLALAIYVAFIASGVLGLRG* |
Ga0105090_100913172 | 3300009075 | Freshwater Sediment | VSDPRVSAGPTDEQRRRIRRTTLVLALVALGIYVAFIASGVMQARG* |
Ga0105090_101587392 | 3300009075 | Freshwater Sediment | VNEPRVNPGPTDEQRRRIRRNAVVLALLALGIYAAFIASGVLGLRG* |
Ga0105090_101954512 | 3300009075 | Freshwater Sediment | VNEPRANPGPTDEQRRRIRRNAVVLALLALGIYVAFIASGVLGLRG* |
Ga0105090_105311072 | 3300009075 | Freshwater Sediment | VSDPRVTGSPSDEQRRRIRRNAIVLALVALGIYVAFIASGVMGVRE* |
Ga0105090_108442892 | 3300009075 | Freshwater Sediment | VSDPRTNADAADAQRRRVRRTAILLGLVALGIYVAFIASGVMQARG* |
Ga0105090_109521071 | 3300009075 | Freshwater Sediment | DEQRRRIRRNAVVLALLALGIYVAFIASGVLGLRG* |
Ga0105106_110710282 | 3300009078 | Freshwater Sediment | EQPTTAGPTDEQRRRIRRTTLVLALVALGIYVAFIASGVMRAQG* |
Ga0105098_103971952 | 3300009081 | Freshwater Sediment | MSDQRTNTGLGDDQRRRIRRNAVVLGLLALAIYVAFIASGVLGLRG* |
Ga0105098_105520671 | 3300009081 | Freshwater Sediment | GAGRQVSEQPATPGPTDEQRRRIRRTALVLALVALGIYVAFIASGVLRSQG* |
Ga0105103_102986442 | 3300009085 | Freshwater Sediment | VSSSPSDEQRRRIRRNAIVLALVALGIYVAFIASGVLGVRE* |
Ga0105103_105188062 | 3300009085 | Freshwater Sediment | VNEPRANPGPTDEQRRRIRRNAVVLALLALGIYAAFIASGVLGLRG* |
Ga0105107_102774532 | 3300009087 | Freshwater Sediment | VNEPRVNPGPTDQQRRRIRRNAVVLALLALGIYAAFIASGVLGLRG* |
Ga0102851_103714483 | 3300009091 | Freshwater Wetlands | VNPQRSTAGPTDEQRRRIRRNAVVLGLLALGIYVAFIVSGVMGARG* |
Ga0102851_105760393 | 3300009091 | Freshwater Wetlands | VSTGPNDEQRRRIRRNAIVLALLAVGIYVAFVASGVLGVRR* |
Ga0102851_109269661 | 3300009091 | Freshwater Wetlands | VNQQRPTAGPTDEQRRRIRRSAILLALLALGIYVAFIASGVLGWRG* |
Ga0102851_113800712 | 3300009091 | Freshwater Wetlands | VSQQPAAGPTDEQRRRIRRNAILLAVTALAIYVTFIASGMLGWRG* |
Ga0102851_115776312 | 3300009091 | Freshwater Wetlands | VTEPRLNADAQRRRIRRTTILLALVALGIYVAFIASGVMQARG* |
Ga0102851_123502142 | 3300009091 | Freshwater Wetlands | VNEPRLKPGPTDEQRRRIRRNAVVLAVLALGIYVAFIASGVLGLRG* |
Ga0079224_1039291622 | 3300009095 | Agricultural Soil | VNEPRLNQGPTDEQRRRIRRNAVVLGLLALGIYVAFIASGVLGLRG* |
Ga0115026_101916413 | 3300009111 | Wetland | VNEPRLNPGPTDEQRRRIRRNAVVLALLALGIYVAFIASGVLGLRG* |
Ga0115026_112788851 | 3300009111 | Wetland | VSQRPATHGPGDEQRRRIRRNALVLGLLALGIYVAFIASGVMGARG* |
Ga0117941_10137402 | 3300009120 | Lake Sediment | VSEQPATTGPTDEQRRRIRRTALVLALVALGIYATFIASGVMRAQG* |
Ga0115027_110789042 | 3300009131 | Wetland | VSEPRLNADAADAQRRRIRRTTILLALVALGIYVAFIASGVMQARG* |
Ga0115027_114405052 | 3300009131 | Wetland | VSERPAAQGPTDGQRRRIRRNAIVLALLALGIYAAFIISGVMGARG* |
Ga0105102_107803552 | 3300009165 | Freshwater Sediment | VSDPRVSTGPSDEQRRRIRRNAIVLALVALGIYVAFIASGVLGVRE* |
Ga0113563_110115782 | 3300009167 | Freshwater Wetlands | VSEQPGTTGPTDEQRRRIRRTALVLALVALGIYATFIASGVMRAQ* |
Ga0113563_110438332 | 3300009167 | Freshwater Wetlands | VSEQCANTGPSDGQRRRIRRNAVVLGLLALGIYVAFIASGVMGLR* |
Ga0113563_117406982 | 3300009167 | Freshwater Wetlands | VSDPRANADAADVQRRRVRRTAILLGLVALGIYVAFIASGVMQARG* |
Ga0113563_125716862 | 3300009167 | Freshwater Wetlands | VSDPRVSTGPSDEQRRRIRRNAIVLALLALGIYVAFIASGVMGLRG* |
Ga0105097_103839981 | 3300009169 | Freshwater Sediment | DEQRRRIRRNAIVLGLLALGIYVAFIVSGVMGVRE* |
Ga0115028_105143522 | 3300009179 | Wetland | VSDPRVSTGPSEEQSRRIRRNAIVLALLALGIYAAFIASGVLGLRG* |
Ga0115028_106257301 | 3300009179 | Wetland | TDGQRRRIRRNAIVLALLALGIYAAFIASGVMGARG* |
Ga0114938_100010441 | 3300009430 | Groundwater | VNEPGLKQGPTDEQRRRIRRNAVVLGLLALGIYVAFIASGVLGLRG* |
Ga0114938_10042713 | 3300009430 | Groundwater | VSEGRASTGTTAEQRRRIRRTTILLVLVALGIYVAFIASGVMKAQP* |
Ga0114938_10059723 | 3300009430 | Groundwater | VTGPTDEQRRRIRRNAIVLALLAVGIYVAFIASGVLGWRE* |
Ga0114938_13781041 | 3300009430 | Groundwater | RGAGRQVNQQRPTAGPTDEQRRRIRRNAIVLGLLALGIYVAFIVSGVMGVRE* |
Ga0114939_103274291 | 3300009455 | Groundwater | VSTQRVDQGPSDEQRRRIRRNAVVLGLLALGIYVAFIASGVLGLRG* |
Ga0123573_100368268 | 3300009509 | Mangrove Sediment | VSEARVNGGPTDEQRRRIRRTTIVLALVALAIYVAFIASGVMQARG* |
Ga0123573_100380335 | 3300009509 | Mangrove Sediment | VSEARVSPGPTDEQRRRIRRTTIVLALVAIAIYVAFIASGVMQARG* |
Ga0123573_101529853 | 3300009509 | Mangrove Sediment | VSDRPLNAGPTGEQRRRIRRTTIVLALVAIAIYVTFIASGVMGRYG* |
Ga0123573_101763912 | 3300009509 | Mangrove Sediment | VNEQRTTAGLTDQQRRRIRRNAILLGLVALGIYVAFIASGVIGVRG* |
Ga0123573_102173092 | 3300009509 | Mangrove Sediment | VSEQRTTAGLTEQQRRRIRRNAILLGLVALGIYVAFIASGVIGVRG* |
Ga0123573_108044882 | 3300009509 | Mangrove Sediment | VSREPSNAGPTDVQRRRIRRNAVVLGLLALGIYVAFIASGVMGLRG* |
Ga0116155_101091302 | 3300009771 | Anaerobic Digestor Sludge | VSDPRTNADAADVQRRRVRRTAILLGLLALGIYVAFIASGVMQARG* |
Ga0136852_1000112920 | 3300010412 | Mangrove Sediment | VNEPRLNQGPTDEQRRRIRRNAVVLALLALGIYVAFIASGVLGLRG* |
Ga0136852_100495197 | 3300010412 | Mangrove Sediment | VSDRPLNAGPTGEQRRRIRRTTIVLALVAIAIYVTFIASGVLGRYG* |
Ga0136852_101617782 | 3300010412 | Mangrove Sediment | VSEPNVNQGPTDEQRRRIRRNAIVLGLLALGIYVAFIASGVLGLRG* |
Ga0136852_105291582 | 3300010412 | Mangrove Sediment | VSREPSNAGPTDEQRRRIRRNAVVLGLLALGIYVAFIASGVMGLRG* |
Ga0136852_111163871 | 3300010412 | Mangrove Sediment | VSGPHVNQGPTEEQRRRIRRNAIVLGLLALGIYVAFIASGVLGLRG* |
Ga0116241_106985032 | 3300010429 | Anaerobic Digestor Sludge | VSEQPTTAGPTDEQRRRIRRTALVLALVALGIYVAFIASGVMRAQG* |
Ga0075319_10405341 | 3300014257 | Natural And Restored Wetlands | VSDPRSNAQAADAQRRRIRRTAILLGLVALGIYVAFIASGVMQARG* |
Ga0075311_10056783 | 3300014259 | Natural And Restored Wetlands | VSQQHPTTGQSDEQRRRIRRNAIVLGLLALGIYVAFIASGVMGVRG* |
Ga0075313_11216522 | 3300014267 | Natural And Restored Wetlands | VSDPRSNAQAADAQRRRVRRTAILLGLVALGIYVAFIASGVMQARG* |
Ga0075349_11881502 | 3300014305 | Natural And Restored Wetlands | VNPQRPTAGPTDEQRRRIRRNAIVLGLLALGIYVAFIASG |
Ga0075346_10536942 | 3300014306 | Natural And Restored Wetlands | VNPQRPTAGPTDEQRRRIRRNAVVLGLLALGIYVAFIVSGVMGARG* |
Ga0075345_11856282 | 3300014312 | Natural And Restored Wetlands | VTEPRLNAGAADAQRRRIRRTTILLALVALGIYVAFIASGVMQARG* |
Ga0075339_10192202 | 3300014316 | Natural And Restored Wetlands | VSDTRANGPTEQQRRRIRRGALALALLAIGIYVAFIASGVLGWRG* |
Ga0075339_12468682 | 3300014316 | Natural And Restored Wetlands | VSDHRVSTGPTDEQRRRIRRSAIVLALVALGIYVAFIASGVLGVRE* |
Ga0182875_100441742 | 3300015216 | Microbial Mat | MPVAEVPGETGQRRRIRRTTLVLALVALGIYVAFIASGVMQARG* |
Ga0207193_11780544 | 3300020048 | Freshwater Lake Sediment | VSDPRTNAEAADAQRRRVRRTAILLGLVALGIYVAFIASGVMQARG |
Ga0194118_100859802 | 3300020190 | Freshwater Lake | VSDPRVSNGPTDEQRRRIRRNAIVLALLAVGIYVAFIASGVLGLRG |
Ga0210351_11626152 | 3300021316 | Estuarine | VSDRPASSGPTDEQRRRIRRTTLVLALVALGIYVAFIASGVMQARQ |
Ga0224500_100970251 | 3300022213 | Sediment | GLSDEQRRRIRRNAIVLALLAVGIYVAFIASGVLGLRG |
Ga0124853_10602642 | 3300024056 | Freshwater Wetlands | VSDPRVSTGPTDEQRRRIRRTTFVLALVALGIYVAFIASGVMQARG |
Ga0209398_100077012 | 3300025106 | Groundwater | VNEPGLKQGPTDEQRRRIRRNAVVLGLLALGIYVAFIASGVLGLRG |
Ga0209398_10163073 | 3300025106 | Groundwater | VTGPTDEQRRRIRRNAIVLALLAVGIYVAFIASGVLGWRE |
Ga0210140_10739112 | 3300025566 | Natural And Restored Wetlands | VSDRPASSGRTDEQRRRIRRTTLVLALVALGIYVAFIASGVMQARQ |
Ga0210140_11353372 | 3300025566 | Natural And Restored Wetlands | GRQVSDRPASSGPTDEQRRRIRRTTLVLALVALGIYVAFIASGVMQARQ |
Ga0210125_10121792 | 3300025943 | Natural And Restored Wetlands | VSNTRANGPTEQQRRRIRRGALALALLAIGIYVAFIASGVLGWRG |
Ga0210134_10190602 | 3300025950 | Natural And Restored Wetlands | VNPQRPTAGPTDEQRRRIRRNAVVLGLLALGIYVAFIVSGVMGARG |
Ga0210134_10415452 | 3300025950 | Natural And Restored Wetlands | VSDPRVSSGPTDEQRRRIRRNAIVLALVALGIYVAFIASGVMGVRE |
Ga0210069_10124542 | 3300025958 | Natural And Restored Wetlands | VSDPRSNAQAADAQRRRVRRTAILLGLVALGIYVAFIASGVMQARG |
Ga0210069_10145662 | 3300025958 | Natural And Restored Wetlands | VSEQRTTAGLTDQQRRRIRRNAILLGLVALGIYVAFIASGVMKAQH |
Ga0210127_10190332 | 3300025964 | Natural And Restored Wetlands | VNPQRSTAGPTDEQRRRIRRNAVVLGLLALGIYVAFIVSGVMGVRG |
Ga0210103_10243522 | 3300025968 | Natural And Restored Wetlands | VSDRPASSGPTDEQRRRIRRTTLVLALVALGIYVAFIASGVMQA |
Ga0210103_10550302 | 3300025968 | Natural And Restored Wetlands | VSDPRVSTGPSEEQRRRIRRNALVLALLALGIYVAFIASGVMGLRG |
Ga0208539_10314981 | 3300026069 | Natural And Restored Wetlands | RRGTGGQVSDPRVSSGPTDEQRRRIRRNAIVLALVALGIYVAFIASGVMQARQ |
Ga0256809_10000087 | 3300026347 | Sediment | VNRDVSGRHATTGPTDEQRRRIRRSAMLLAAVALAIYVTFIASGMLGWRG |
Ga0256811_10029193 | 3300026349 | Sediment | VSESRVNVPTDEQRRRIRRNAIVLALLAIGIYVTFIASGVLGWRG |
Ga0256817_10003464 | 3300026373 | Sediment | VSESRVNGPTDEQRRRIRRNAIVLALLAIGIYVTFIASGVLGWRG |
Ga0256807_10182082 | 3300026477 | Sediment | VSQTRVNTGPTDEQRRRIRRMTIALALVAIAIYVAFIASGVMQARG |
Ga0256807_10189242 | 3300026477 | Sediment | VSEPRPNPGTTDEQRRRIRRNAIVLALLAVGIYVAFIASGVMGLRG |
Ga0256820_10103952 | 3300026486 | Sediment | VNGPSDEQRRRIRRNALVLALLAIGIYVAFIASGVLGWRG |
Ga0256820_10166773 | 3300026486 | Sediment | VSQQQPTAGLTDEQRRRIRRSAIALAFAALAIYVTFIASGMLGWRG |
Ga0256806_10194212 | 3300026501 | Sediment | VNGPTDEQRRRIRRSAIVLALLAIGIYVTFIASGVLGWRG |
Ga0209392_10016303 | 3300027683 | Freshwater Sediment | VSDPRTNADAADAQRRRVRRTAILLGLVALGIYVAFIASGVMQARG |
Ga0209392_10070753 | 3300027683 | Freshwater Sediment | VSDPRVSSSPSDEQRRRIRRNAIVLALVALGIYVAFIASGVLGVRE |
Ga0209392_10170293 | 3300027683 | Freshwater Sediment | VSEQPATPGPTDEQRRRIRRTALVLALVALGIYVAFIASGVLRSQG |
Ga0209392_10304123 | 3300027683 | Freshwater Sediment | VSDPRVSTGPSDEQRRRIRRNAIVLALLALGIYVAFIASGVLGLRG |
Ga0209392_10889532 | 3300027683 | Freshwater Sediment | VSDPRVSTGPSDEQRRRIRRNAIVLALVALGIYVAFIASGVLGVRE |
Ga0209704_10430902 | 3300027693 | Freshwater Sediment | VSSSPSDEQRRRIRRNAIVLALVALGIYVAFIASGVLGVRE |
Ga0208665_100558972 | 3300027715 | Deep Subsurface | VSERPAAQGPTDGQRRRIRRNAIVLALLALGIYAAFIASGVMGARG |
Ga0209467_10547132 | 3300027719 | Freshwater | VSDPRTHADAADAQRRRVRRTAILLGLLALGIYVAFIASGVMQARG |
Ga0209492_10481133 | 3300027721 | Freshwater Sediment | VSDPRVSAGPTDEQRRRIRRTTLVLALVALGIYVAFIASGVMQARG |
Ga0209492_11639702 | 3300027721 | Freshwater Sediment | VSEQPATPGPTDEQRRRIRRTALVLALVALGIYVAFIASGVMQAR |
Ga0209492_11850681 | 3300027721 | Freshwater Sediment | DEQRRRIRRNAIVLGLLALGIYVAFIVSGVMGVRE |
Ga0209492_13255892 | 3300027721 | Freshwater Sediment | VNEPRANPGPTDEQRRRIRRNAVVLALLALGIYVAFIASGVLGLRG |
Ga0209285_101129952 | 3300027726 | Freshwater Sediment | VSDPRNNEHATDAQRRRVRRTAILLGLVALGIYVAFIASGVMQARG |
Ga0209287_102563052 | 3300027792 | Freshwater Sediment | VSEPNANTGPTDEQRRRIRRNAIVLGLLALGIYVAFIASGVLGLRE |
Ga0209262_105631742 | 3300027841 | Freshwater | VSDPRVSDGPTDEQRRRIRRTTLVLALVALGIYVAFIASGVMQARG |
Ga0209397_100041645 | 3300027871 | Wetland | VSDPRTSADAADVQRRRVRRTAILLGLLALGIYVAFIASGVMQARG |
Ga0209397_101116842 | 3300027871 | Wetland | VSSQPSNAGPTDEQRRRIRRNAIVLGLLALGIYVAFIASGVMGLRG |
Ga0209397_102599022 | 3300027871 | Wetland | VSEQRSNTAPSDEQRRRIRRTTVLLALVALGIYVAFIASGVMQARG |
Ga0209397_104476932 | 3300027871 | Wetland | VNQQRPTAGPTDEQRRRIRRNAIVLGLLALGIYVAFIVSGVMGVRE |
Ga0209397_105068552 | 3300027871 | Wetland | VSEQRANTGLSDDQRRRIRRNAVVLGLLALGIYVAFIASGVMGLR |
Ga0209397_105783702 | 3300027871 | Wetland | VSDGRVSTGPNDEQRRRIRRNAIVLALLAVGIYVAFVASGVLGVRR |
Ga0209293_100566393 | 3300027877 | Wetland | VNEPRLNPGPTDEQRRRIRRNAVVLAVLALGIYVAFIASGVLGLRG |
Ga0209293_100868722 | 3300027877 | Wetland | VNQQRPTAGPTDERRRRIRRNAIVLGLLAVGIYVAFIVSGVMGVRE |
Ga0209293_105582052 | 3300027877 | Wetland | VSERPAAQGPTDGQRRRIRRNAIVLALLALGIYAAFIA |
Ga0209293_107147352 | 3300027877 | Wetland | VSQQPAAGPTDEQRRRIRRNAILLAVTALAIYVTFIASGMLGWRG |
Ga0209450_100031948 | 3300027885 | Freshwater Lake Sediment | VSQQNSSTGPTDEQRRRIRRNAIVLGLLALAIYAAFIASGVMGVRG |
Ga0209450_101624892 | 3300027885 | Freshwater Lake Sediment | VSTQRVDQGPSDEQRRRIRRNAVVLGLLALGIYVAFIASGVLGLRG |
Ga0209450_103036332 | 3300027885 | Freshwater Lake Sediment | VNGPTDEQRRRIRRNAIVLALLAVGIYVAFIASGVLGWRE |
Ga0209450_105354302 | 3300027885 | Freshwater Lake Sediment | VSEQTATPGPTDEQRRRIRRTALVLALVALGIYVAFIASGVMRAQG |
Ga0209450_106486952 | 3300027885 | Freshwater Lake Sediment | VSGQRTTAGPSDEQRRRIRRNAIVLALLALGIYVAFIASGVLGLRG |
Ga0209450_112528522 | 3300027885 | Freshwater Lake Sediment | VSDPRTNAETADAQRRRVRRTAILLGLVALGIYVAFIASGVMQARG |
Ga0209496_105787041 | 3300027890 | Wetland | SSQPSNAGPTDEQRRRIRRNAIVLGLLALGIYVAFIASGVMGLRG |
Ga0209496_106153851 | 3300027890 | Wetland | GAGRQVNEPRLNADAQRRRIRRTTILLALVALGIYVAFIASGVMQARG |
Ga0209496_107994602 | 3300027890 | Wetland | VSQRPATHGPGDEQRRRIRRNAIVLALLALGIYVAFIASGVMGARG |
Ga0209254_100072992 | 3300027897 | Freshwater Lake Sediment | VSDPRVSVGPTDEQRRRIRRTTLVLALVALGIYVAFIASGVMQARG |
Ga0209254_100323007 | 3300027897 | Freshwater Lake Sediment | VSRPAEGQGAGPDEAQRRRIRRNAALLGLTALGIYVLFIASGVLGWRG |
Ga0209254_101663953 | 3300027897 | Freshwater Lake Sediment | VSEQPTTAGPTDEQRRRIRRLALLLGLVALGIYVAFIVSGVMRAQG |
Ga0209254_105811982 | 3300027897 | Freshwater Lake Sediment | VSDPRAGPGLGDGQRRRIRRNALVLALLALGIYVAFIASGVMGLR |
Ga0209254_109874852 | 3300027897 | Freshwater Lake Sediment | VSDPRTTADAADAQRRRVRRTAILLGLVALGIYVAFIASGVMQAR |
Ga0209668_100081932 | 3300027899 | Freshwater Lake Sediment | VSQRPATSGLTDEQRRRIRRNAIVLGLLALGIYVAFIASGVMGVRG |
Ga0209820_11653022 | 3300027956 | Freshwater Sediment | VNEPRANPGPTDEQRRRIRRNAVVLALLAFGIYVAFIA |
Ga0316604_100099678 | 3300033406 | Soil | VNEPRLNADAQRRRIRRTTILLALVALGIYVAFIASGVMQARG |
Ga0316604_100152572 | 3300033406 | Soil | VNPQRSTAGPTDEQRRRIRRNAVVLGLLALGIYVAFIVSGVMGARG |
Ga0316604_104681462 | 3300033406 | Soil | VSEQPATTGPTDEQRRRIRRTALVLALVALGIYATFIASGVMRAQG |
Ga0316604_107110612 | 3300033406 | Soil | VNEPRLNQGPTDEQRRRIRRNAVVLALLALAIYAAFIASGVLGLRG |
Ga0316605_104173813 | 3300033408 | Soil | VSERPAAQGPTDGQRRRIRRNAIVLALLAFGIYAAFIVSGVMGARG |
Ga0316605_116536442 | 3300033408 | Soil | VSREPVTTGLTDEQRRRIRRTALLLAIVALGIYVAFIASGVMQARG |
Ga0316605_118365572 | 3300033408 | Soil | VSEQRANTGLSNDQRRRIRRNAIVLGLLALGIYVA |
Ga0316605_120101372 | 3300033408 | Soil | VNEPRLNQGPTNEQRRRIRRNAVVLALLALGIYVAFIASGVLGLRG |
Ga0316605_121946441 | 3300033408 | Soil | VSEPRLNADAADAQRRRIRRTTILLALVALGIYVAFIASGVMQARG |
Ga0316605_124683042 | 3300033408 | Soil | VSDTRVNGPTDEQRRRIRRSAILLALLALGIYVAFIASGVLGWRG |
Ga0316603_105733312 | 3300033413 | Soil | VSDSRVSSGPTDEQRRRIRRNAIVLALVALGIYVAFIASGVMGVRE |
Ga0316603_110255782 | 3300033413 | Soil | VNEPRLKPGPTDEQRRRIRRNAVVLALLALGIYVAFIASGVLGLRG |
Ga0316603_117238952 | 3300033413 | Soil | VSDPRVSTGPTDEQRRRIRRTTLVLALVALGIYVAFIASGVMEARG |
Ga0316619_101280412 | 3300033414 | Soil | VSEQPATTGPTDEQRRRIRRTALVLALVALGIYATFIASGVMRAQ |
Ga0316622_1000763242 | 3300033416 | Soil | VNRESSEPGVPTGPTEEQRRRIRRSTVVLALVALAIYVAFIASGVMQARS |
Ga0316622_1002493092 | 3300033416 | Soil | VSEQRANTGLSNDQRRRIRRNAIVLGLLALGIYVAFIASGVMGLRS |
Ga0316622_1006291823 | 3300033416 | Soil | VSDQQVSTGPSDEQRRRIRRTTVVLALVALGIYVAFIASGVMQARG |
Ga0316622_1017048442 | 3300033416 | Soil | VSDPRVSTGPSEEQRRRIRRNAIVLALLALGIYAAFIASGVLGLRG |
Ga0316622_1018995082 | 3300033416 | Soil | VNSQRSTAGPTDEQRRRIRRNAVVLGLLALGIYVAFIVS |
Ga0316625_1020787912 | 3300033418 | Soil | RQVNEPRLNQGPTDEQRRRIRRNAVVLALLALGIYVAFIASGVLGLRG |
Ga0316601_1006119662 | 3300033419 | Soil | VSDPRVSTGPSDEQRRRIRRNAIVLALLALGIYVAFIASGVMGLRG |
Ga0316601_1007652433 | 3300033419 | Soil | VSDPRVSTGPSEEQRRRIRRNAVVLALLAFGIYVAFIASGVLGLRG |
Ga0316601_1012839602 | 3300033419 | Soil | TEPRLNADAQRRRIRRTTILLALVALGIYVAFIASGVMQARG |
Ga0316601_1025657362 | 3300033419 | Soil | VNEPRLKPGPTDEQRRRIRRNAVVLAVLALGIYVAFIASGVLGLRG |
Ga0316613_100207975 | 3300033434 | Soil | VNPQRSTAGPTDEQRRRIRRNAVVLGLLALGIYVAFIVSGVMG |
Ga0316620_117545242 | 3300033480 | Soil | RQVSDPRVSTGPTDEQRRRIRRTTFVLALVALGIYVAFIASGVMQARG |
Ga0316627_1020056602 | 3300033482 | Soil | VNQQRPTAGPTDERRRRIRRNAIVLGLLAVGIYVAFIVS |
Ga0316629_108188162 | 3300033483 | Soil | VSERPATTGPTDEQRRRIRRTALVLALVALGIYATFIASGVMRAQG |
Ga0316626_107777452 | 3300033485 | Soil | VNEPRLDADAQRRRIRRTTILLALVALGIYVAFIASGVMQARG |
Ga0316626_117751761 | 3300033485 | Soil | RQVNQQRPTAGPTDEQRRRIRRNAIVLGLLALGIYVAFIVSGVMGVRE |
Ga0316621_107095612 | 3300033488 | Soil | VNQQRPTAGPTDERRRRIRRIRRNAIVLGLLAVGIYVAFIVSGVMGVRE |
Ga0316628_1015636601 | 3300033513 | Soil | RVSTGPSEEQRRRIRRNAIVLALLALGIYAAFIASGVLGLRG |
Ga0316616_1017212091 | 3300033521 | Soil | DEQRRRIRRNAIVLGLLALGIYVAFIASGVMGLRG |
Ga0316616_1024089121 | 3300033521 | Soil | GQVSDPRVSTGPSDEQRRRIRRNAIVLALLALAIYVAFIASGVLGLRG |
Ga0316616_1032713382 | 3300033521 | Soil | VSQQPAAGPTDEQRRRIRRGAILLAATALAIYVTFIASGMLGWRG |
Ga0316616_1041777742 | 3300033521 | Soil | VNEPRLNPGPTDEQRRRIRRNAVVLALLALGIYVAFIASGVLGLRQ |
Ga0316617_1000556863 | 3300033557 | Soil | VSEQRANTGPSDDQRRRIRRNAVVLGLLALGIYVAFIASGVMGLR |
Ga0373889_042546_247_387 | 3300034052 | Sediment Slurry | VNEQHPTAGQADEQRRRIRRNAIVLGLLALGIYVAFIASGVMGVRG |
Ga0373889_064398_331_471 | 3300034052 | Sediment Slurry | VSEQPATAGPTDEQRRRIRRTALVLALVALGIYVAFIASGVMRAQG |
Ga0373890_051393_369_509 | 3300034053 | Sediment Slurry | VSQRPATNGPTDEQRRRIRRNAIVLGLLALGIYAAFIASGVMGTRG |
Ga0373898_048510_185_325 | 3300034076 | Sediment Slurry | VSEPRTSADAGDAQRRRIRRTAILLGLVALGIYVAFIASGVMQARG |
Ga0373897_068385_526_666 | 3300034080 | Sediment Slurry | VSDPRATTGLSDEQRRRIRRNAIVLGLLALGIYVAFIASGVMGVRG |
⦗Top⦘ |