NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F022487

Metagenome / Metatranscriptome Family F022487

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F022487
Family Type Metagenome / Metatranscriptome
Number of Sequences 214
Average Sequence Length 48 residues
Representative Sequence MPIRGSPNGARHPRPQAGRDRPEWVVAINRNAWSQSIGIAGRNHPVR
Number of Associated Samples 193
Number of Associated Scaffolds 214

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 94.29 %
% of genes near scaffold ends (potentially truncated) 87.85 %
% of genes from short scaffolds (< 2000 bps) 62.15 %
Associated GOLD sequencing projects 187
AlphaFold2 3D model prediction Yes
3D model pTM-score0.30

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (92.056 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(26.636 % of family members)
Environment Ontology (ENVO) Unclassified
(19.626 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(46.729 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 26.67%    β-sheet: 0.00%    Coil/Unstructured: 73.33%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.30
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 214 Family Scaffolds
PF00665rve 36.45
PF08483Obsolete Pfam Family 16.82
PF03401TctC 0.93
PF01464SLT 0.93
PF10098DUF2336 0.47
PF13338AbiEi_4 0.47
PF04392ABC_sub_bind 0.47
PF05598DUF772 0.47
PF00578AhpC-TSA 0.47
PF00118Cpn60_TCP1 0.47
PF08327AHSA1 0.47
PF00589Phage_integrase 0.47
PF13467RHH_4 0.47
PF01695IstB_IS21 0.47
PF13546DDE_5 0.47
PF13560HTH_31 0.47
PF13505OMP_b-brl 0.47
PF06114Peptidase_M78 0.47
PF00561Abhydrolase_1 0.47

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 214 Family Scaffolds
COG2801Transposase InsO and inactivated derivativesMobilome: prophages, transposons [X] 36.45
COG2826Transposase and inactivated derivatives, IS30 familyMobilome: prophages, transposons [X] 36.45
COG3316Transposase (or an inactivated derivative), DDE domainMobilome: prophages, transposons [X] 36.45
COG4584TransposaseMobilome: prophages, transposons [X] 36.45
COG3181Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctCEnergy production and conversion [C] 0.93
COG0459Chaperonin GroEL (HSP60 family)Posttranslational modification, protein turnover, chaperones [O] 0.47
COG1484DNA replication protein DnaCReplication, recombination and repair [L] 0.47
COG2984ABC-type uncharacterized transport system, periplasmic componentGeneral function prediction only [R] 0.47


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms92.06 %
UnclassifiedrootN/A7.94 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908028|beta3_all_NODE_178652_len_3315_cov_18_015083All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3365Open in IMG/M
2124908035|B3_GZOS_CLC_ConsensusfromContig57339All Organisms → cellular organisms → Bacteria3176Open in IMG/M
2170459002|FZY7DQ102GDWOOAll Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium algeriense530Open in IMG/M
2170459005|F1BAP7Q01B127NAll Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium algeriense534Open in IMG/M
3300001180|JGI12695J13573_1002236All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Cereibacter → Cereibacter changlensis1343Open in IMG/M
3300001402|JGI20195J14853_1007634All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2846Open in IMG/M
3300001652|JGI20274J16320_100024All Organisms → cellular organisms → Bacteria2793Open in IMG/M
3300001867|JGI12627J18819_10020630All Organisms → cellular organisms → Bacteria2685Open in IMG/M
3300002069|JGIcombinedJ21912_10031055All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae2481Open in IMG/M
3300002245|JGIcombinedJ26739_100204570All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Cereibacter → Cereibacter sphaeroides1866Open in IMG/M
3300003369|JGI24140J50213_10016339All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp.2804Open in IMG/M
3300003970|Ga0063602_102391All Organisms → cellular organisms → Bacteria → Proteobacteria2983Open in IMG/M
3300003990|Ga0055455_10051837All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Gluconacetobacter → Gluconacetobacter sacchari1125Open in IMG/M
3300003996|Ga0055467_10218147All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria593Open in IMG/M
3300004047|Ga0055499_10023974All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria838Open in IMG/M
3300004065|Ga0055481_10354106All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria623Open in IMG/M
3300004779|Ga0062380_10517976All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria531Open in IMG/M
3300005177|Ga0066690_10601698All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria734Open in IMG/M
3300005183|Ga0068993_10303615All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales577Open in IMG/M
3300005206|Ga0068995_10039138All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria819Open in IMG/M
3300005332|Ga0066388_101498707All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1179Open in IMG/M
3300005531|Ga0070738_10004173All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria17747Open in IMG/M
3300005713|Ga0066905_100027788All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3152Open in IMG/M
3300005834|Ga0068851_10198696All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Cereibacter → Cereibacter changlensis1118Open in IMG/M
3300005921|Ga0070766_10039897All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp.2599Open in IMG/M
3300005938|Ga0066795_10085853All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria934Open in IMG/M
3300006049|Ga0075417_10640114All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria543Open in IMG/M
3300006050|Ga0075028_100087878All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Cereibacter → Cereibacter changlensis1564Open in IMG/M
3300006050|Ga0075028_100754164All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria590Open in IMG/M
3300006086|Ga0075019_10474785All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria773Open in IMG/M
3300006578|Ga0074059_12000589All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria738Open in IMG/M
3300006638|Ga0075522_10342260All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium717Open in IMG/M
3300006800|Ga0066660_11156429All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria609Open in IMG/M
3300006854|Ga0075425_101771460All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria694Open in IMG/M
3300006881|Ga0068865_100262891All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Cereibacter → Cereibacter changlensis1367Open in IMG/M
3300006950|Ga0075524_10348195All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria651Open in IMG/M
3300007522|Ga0105053_10436968All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1100Open in IMG/M
3300009032|Ga0105048_10960571All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae736Open in IMG/M
3300009084|Ga0105046_11334577All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium551Open in IMG/M
3300009094|Ga0111539_10405054All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Cereibacter → Cereibacter changlensis1589Open in IMG/M
3300009101|Ga0105247_11782613All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria511Open in IMG/M
3300009163|Ga0114970_10178205All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1263Open in IMG/M
3300009177|Ga0105248_12282841All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium algeriense616Open in IMG/M
3300009545|Ga0105237_10363336All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Cereibacter → Cereibacter changlensis1452Open in IMG/M
3300009826|Ga0123355_10436510All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Cereibacter → Cereibacter changlensis1661Open in IMG/M
3300010361|Ga0126378_11110558All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium algeriense891Open in IMG/M
3300010373|Ga0134128_12228240All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria603Open in IMG/M
3300010375|Ga0105239_10756295All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1112Open in IMG/M
3300010376|Ga0126381_103319556Not Available635Open in IMG/M
3300010379|Ga0136449_100245620All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3333Open in IMG/M
3300010396|Ga0134126_10349245Not Available1726Open in IMG/M
3300010399|Ga0134127_10647247All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1091Open in IMG/M
3300010403|Ga0134123_13168185All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria529Open in IMG/M
3300011411|Ga0153933_1026594All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Cereibacter → Cereibacter changlensis1363Open in IMG/M
3300012356|Ga0137371_10626032All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria826Open in IMG/M
3300012900|Ga0157292_10202068All Organisms → cellular organisms → Bacteria → Proteobacteria665Open in IMG/M
3300012915|Ga0157302_10044720All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae1229Open in IMG/M
3300012957|Ga0164303_10569044All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium tropiciagri740Open in IMG/M
3300013308|Ga0157375_10280492All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1829Open in IMG/M
3300014052|Ga0120109_1102471All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria662Open in IMG/M
3300014318|Ga0075351_1004158All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1887Open in IMG/M
3300014496|Ga0182011_10088346All Organisms → cellular organisms → Bacteria → Proteobacteria2167Open in IMG/M
3300015159|Ga0167630_1075163All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria557Open in IMG/M
3300015209|Ga0167629_1089294All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria954Open in IMG/M
3300015371|Ga0132258_11114003All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1995Open in IMG/M
3300015371|Ga0132258_12381679All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. PH101326Open in IMG/M
3300015372|Ga0132256_100096477All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2870Open in IMG/M
3300016270|Ga0182036_10921933All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria717Open in IMG/M
3300017937|Ga0187809_10314970Not Available579Open in IMG/M
3300017995|Ga0187816_10375914All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium algeriense630Open in IMG/M
3300017996|Ga0187891_1080376All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium algeriense1276Open in IMG/M
3300018017|Ga0187872_10376504All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium algeriense605Open in IMG/M
3300018017|Ga0187872_10495055All Organisms → cellular organisms → Bacteria → Proteobacteria507Open in IMG/M
3300018037|Ga0187883_10199633All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium algeriense1026Open in IMG/M
3300018058|Ga0187766_10121508All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Cereibacter → Cereibacter changlensis1602Open in IMG/M
3300018088|Ga0187771_10618487All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria918Open in IMG/M
3300020150|Ga0187768_1006512All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Cereibacter → Cereibacter changlensis2356Open in IMG/M
3300020155|Ga0194050_1038826All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1295Open in IMG/M
3300020155|Ga0194050_1182221All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria572Open in IMG/M
3300020197|Ga0194128_10554583All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300020579|Ga0210407_10051875All Organisms → cellular organisms → Bacteria3064Open in IMG/M
3300020579|Ga0210407_10059595All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2857Open in IMG/M
3300020579|Ga0210407_10622792All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria840Open in IMG/M
3300020580|Ga0210403_10058228All Organisms → cellular organisms → Bacteria3094Open in IMG/M
3300020581|Ga0210399_10070192All Organisms → cellular organisms → Bacteria2835Open in IMG/M
3300020581|Ga0210399_10830852All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria753Open in IMG/M
3300020582|Ga0210395_10061646All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2751Open in IMG/M
3300020583|Ga0210401_10084737All Organisms → cellular organisms → Bacteria2981Open in IMG/M
3300020583|Ga0210401_11526348All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria525Open in IMG/M
3300021063|Ga0206227_1063856All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria690Open in IMG/M
3300021168|Ga0210406_10233447All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1515Open in IMG/M
3300021170|Ga0210400_10682557All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria845Open in IMG/M
3300021171|Ga0210405_11226233All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium algeriense554Open in IMG/M
3300021178|Ga0210408_10010626All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium7659Open in IMG/M
3300021180|Ga0210396_10050182All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium3826Open in IMG/M
3300021180|Ga0210396_11007487Not Available705Open in IMG/M
3300021405|Ga0210387_10065335All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2962Open in IMG/M
3300021405|Ga0210387_10076998All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2742Open in IMG/M
3300021406|Ga0210386_10075978All Organisms → cellular organisms → Bacteria2712Open in IMG/M
3300021407|Ga0210383_10959977All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria726Open in IMG/M
3300021420|Ga0210394_10075524All Organisms → cellular organisms → Bacteria2915Open in IMG/M
3300021420|Ga0210394_11217636All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium algeriense646Open in IMG/M
3300021420|Ga0210394_11703475All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria528Open in IMG/M
3300021470|Ga0194051_1017782All Organisms → cellular organisms → Bacteria2849Open in IMG/M
3300021474|Ga0210390_10046394All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium3562Open in IMG/M
3300021475|Ga0210392_10044027All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2710Open in IMG/M
3300021475|Ga0210392_10206460All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Cereibacter → Cereibacter changlensis1373Open in IMG/M
3300021476|Ga0187846_10068839Not Available1545Open in IMG/M
3300021477|Ga0210398_10761226All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria781Open in IMG/M
3300021477|Ga0210398_10882554Not Available717Open in IMG/M
3300021478|Ga0210402_10083302All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2849Open in IMG/M
3300021478|Ga0210402_10226652Not Available1722Open in IMG/M
3300021479|Ga0210410_11642212Not Available536Open in IMG/M
3300021516|Ga0194045_1108774All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria690Open in IMG/M
3300021560|Ga0126371_13150966All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium algeriense558Open in IMG/M
3300022726|Ga0242654_10146506All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria785Open in IMG/M
3300022886|Ga0247746_1104720All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria694Open in IMG/M
3300023071|Ga0247752_1083675All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria535Open in IMG/M
3300023184|Ga0214919_10277661All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1176Open in IMG/M
3300023266|Ga0247789_1123580All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria529Open in IMG/M
3300025315|Ga0207697_10485886All Organisms → cellular organisms → Bacteria → Proteobacteria546Open in IMG/M
3300025553|Ga0208080_1023943All Organisms → cellular organisms → Bacteria1986Open in IMG/M
3300025588|Ga0208586_1051041All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria936Open in IMG/M
3300025627|Ga0208220_1098673All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria787Open in IMG/M
3300025633|Ga0208480_1008014All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3479Open in IMG/M
3300025878|Ga0209584_10435417All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria507Open in IMG/M
3300025906|Ga0207699_10965439All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria630Open in IMG/M
3300025915|Ga0207693_10444855Not Available1013Open in IMG/M
3300025919|Ga0207657_10116098All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2206Open in IMG/M
3300025923|Ga0207681_10172989All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Cereibacter → Cereibacter changlensis1638Open in IMG/M
3300025926|Ga0207659_10456979All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1076Open in IMG/M
3300025926|Ga0207659_11046755All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria702Open in IMG/M
3300025927|Ga0207687_11379911All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium algeriense606Open in IMG/M
3300025929|Ga0207664_11237289All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria665Open in IMG/M
3300025932|Ga0207690_11154296All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria646Open in IMG/M
3300025941|Ga0207711_10315595All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Cereibacter → Cereibacter changlensis1443Open in IMG/M
3300026049|Ga0208781_1014538All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium algeriense659Open in IMG/M
3300026095|Ga0207676_10331275All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Cereibacter → Cereibacter changlensis1401Open in IMG/M
3300026467|Ga0257154_1021476All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium sediminis940Open in IMG/M
3300027069|Ga0208859_1000654All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae3024Open in IMG/M
3300027069|Ga0208859_1000836All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2803Open in IMG/M
3300027105|Ga0207944_1025529All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales508Open in IMG/M
3300027173|Ga0208097_1000826All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2553Open in IMG/M
3300027173|Ga0208097_1018737All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria777Open in IMG/M
3300027297|Ga0208241_1001224All Organisms → cellular organisms → Bacteria2899Open in IMG/M
3300027548|Ga0209523_1020430All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1292Open in IMG/M
3300027565|Ga0209219_1001732All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales4066Open in IMG/M
3300027565|Ga0209219_1022977All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Cereibacter → Cereibacter changlensis1533Open in IMG/M
3300027583|Ga0209527_1007648All Organisms → cellular organisms → Bacteria2250Open in IMG/M
3300027591|Ga0209733_1006183All Organisms → cellular organisms → Bacteria3067Open in IMG/M
3300027819|Ga0209514_10053014All Organisms → cellular organisms → Bacteria2795Open in IMG/M
3300027848|Ga0209390_10467914All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria862Open in IMG/M
3300027870|Ga0209023_10303610All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1012Open in IMG/M
3300027870|Ga0209023_10500415All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria730Open in IMG/M
3300027884|Ga0209275_10022654All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2825Open in IMG/M
3300027954|Ga0209859_1007860All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2168Open in IMG/M
3300027965|Ga0209062_1003124All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium19922Open in IMG/M
(restricted) 3300027970|Ga0247837_1157246All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria999Open in IMG/M
3300027986|Ga0209168_10204208All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria988Open in IMG/M
3300028047|Ga0209526_10024126All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium4261Open in IMG/M
3300028793|Ga0307299_10298914All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria605Open in IMG/M
3300028824|Ga0307310_10024934All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2372Open in IMG/M
3300028906|Ga0308309_10057482All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2837Open in IMG/M
3300031359|Ga0307426_1016669All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3566Open in IMG/M
3300031538|Ga0310888_10582931All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria677Open in IMG/M
3300031544|Ga0318534_10035262All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2751Open in IMG/M
3300031545|Ga0318541_10029434All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2709Open in IMG/M
3300031546|Ga0318538_10025204All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2711Open in IMG/M
3300031549|Ga0318571_10006714All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2526Open in IMG/M
3300031669|Ga0307375_10592275Not Available654Open in IMG/M
3300031720|Ga0307469_10210849All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Cereibacter → Cereibacter changlensis1526Open in IMG/M
3300031723|Ga0318493_10023734All Organisms → cellular organisms → Bacteria → Proteobacteria2727Open in IMG/M
3300031736|Ga0318501_10024058All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2608Open in IMG/M
3300031769|Ga0318526_10012314All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2807Open in IMG/M
3300031780|Ga0318508_1004684All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2809Open in IMG/M
3300031799|Ga0318565_10023498All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2729Open in IMG/M
3300031805|Ga0318497_10029603All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2726Open in IMG/M
3300031819|Ga0318568_10446379All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium806Open in IMG/M
3300031832|Ga0318499_10216656Not Available746Open in IMG/M
3300031860|Ga0318495_10023737All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2645Open in IMG/M
3300031880|Ga0318544_10012058All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2759Open in IMG/M
3300031896|Ga0318551_10024698All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2844Open in IMG/M
3300031897|Ga0318520_10395273All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria844Open in IMG/M
3300031912|Ga0306921_11431086All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium algeriense759Open in IMG/M
3300031942|Ga0310916_10363047All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1231Open in IMG/M
3300031954|Ga0306926_10953065All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1024Open in IMG/M
3300031959|Ga0318530_10012500All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2752Open in IMG/M
3300032000|Ga0310903_10010792All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2813Open in IMG/M
3300032025|Ga0318507_10011942All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2878Open in IMG/M
3300032043|Ga0318556_10024743All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2729Open in IMG/M
3300032044|Ga0318558_10019583All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2716Open in IMG/M
3300032054|Ga0318570_10013808All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2910Open in IMG/M
3300032076|Ga0306924_10145868All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2708Open in IMG/M
3300032076|Ga0306924_11528635All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales707Open in IMG/M
3300032091|Ga0318577_10020450All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2744Open in IMG/M
3300032094|Ga0318540_10457205Not Available617Open in IMG/M
3300032164|Ga0315283_12051948All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium algeriense567Open in IMG/M
3300032205|Ga0307472_100041609All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2782Open in IMG/M
3300032805|Ga0335078_10222009All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2603Open in IMG/M
3300032828|Ga0335080_10663654All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1090Open in IMG/M
3300032892|Ga0335081_10265193All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2305Open in IMG/M
3300032955|Ga0335076_10673763All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Ruegeria → unclassified Ruegeria → Ruegeria sp. PR1b916Open in IMG/M
3300033002|Ga0346503_1025989All Organisms → cellular organisms → Bacteria2920Open in IMG/M
3300033004|Ga0335084_10126302All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2659Open in IMG/M
3300033134|Ga0335073_11842470Not Available563Open in IMG/M
3300033412|Ga0310810_10152437All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2682Open in IMG/M
3300033475|Ga0310811_10166786All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2746Open in IMG/M
3300033502|Ga0326731_1111176All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria630Open in IMG/M
3300033824|Ga0334840_013683All Organisms → cellular organisms → Bacteria2833Open in IMG/M
3300034155|Ga0370498_028388All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1203Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil26.64%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil7.48%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil4.67%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.27%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.27%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands2.80%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.34%
Anoxic Zone FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater1.87%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland1.87%
FreshwaterEnvironmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater1.87%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.87%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.87%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.40%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.40%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.40%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.40%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.40%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.40%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.40%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment0.93%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.93%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.93%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Soil0.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.93%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.93%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.93%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.93%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.93%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.93%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.93%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.93%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.93%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.93%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.93%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater0.47%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.47%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.47%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.47%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment0.47%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater0.47%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh0.47%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.47%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil0.47%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil0.47%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.47%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Contaminated → Soil0.47%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.47%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen0.47%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.47%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.47%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand0.47%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil0.47%
Deep Subsurface SedimentEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment0.47%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.47%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.47%
BiofilmEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm0.47%
Termite GutHost-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut0.47%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.47%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.47%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.47%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.47%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.47%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.47%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.47%
Attine Ant Fungus GardensHost-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens0.47%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908028Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog Site B3EnvironmentalOpen in IMG/M
2124908035Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog Site B3EnvironmentalOpen in IMG/M
2170459002Grass soil microbial communities from Rothamsted Park, UK - March 2009 direct MP BIO 1O1 lysis 0-21 cmEnvironmentalOpen in IMG/M
2170459005Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cmEnvironmentalOpen in IMG/M
3300001180Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3EnvironmentalOpen in IMG/M
3300001402Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 deep-092012EnvironmentalOpen in IMG/M
3300001652Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF040EnvironmentalOpen in IMG/M
3300001867Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705)EnvironmentalOpen in IMG/M
3300002069Barrow Graham LP Ref core NGADG0002-212 (Barrow Graham LP Ref core NGADG0002-212,NGADG0004-211, ASSEMBLY_DATE=20131010)EnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300003369Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 002-22AEnvironmentalOpen in IMG/M
3300003970Enrichment cultures from Lake Fryxell 39872EnvironmentalOpen in IMG/M
3300003990Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragC_D2EnvironmentalOpen in IMG/M
3300003996Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2EnvironmentalOpen in IMG/M
3300004047Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqC_D1EnvironmentalOpen in IMG/M
3300004065Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_PWC_D2EnvironmentalOpen in IMG/M
3300004779Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3FreshEnvironmentalOpen in IMG/M
3300005177Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139EnvironmentalOpen in IMG/M
3300005183Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1EnvironmentalOpen in IMG/M
3300005206Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D2EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005531Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2EnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005834Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2Host-AssociatedOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300005938Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191EnvironmentalOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006086Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013EnvironmentalOpen in IMG/M
3300006174Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014EnvironmentalOpen in IMG/M
3300006578Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006638Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-AEnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006950Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost154B-oneEnvironmentalOpen in IMG/M
3300007522Freshwater microbial communities from Lake Bonney liftoff mats and glacier meltwater in Antarctica - BON-01EnvironmentalOpen in IMG/M
3300009032Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-05EnvironmentalOpen in IMG/M
3300009084Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-03 (megahit assembly)EnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009163Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaGEnvironmentalOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009826Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1Host-AssociatedOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300011411Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ017 MetaGHost-AssociatedOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012900Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S179-409R-1EnvironmentalOpen in IMG/M
3300012915Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2EnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014052Permafrost microbial communities from Nunavut, Canada - A23_35cm_12MEnvironmentalOpen in IMG/M
3300014318Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D1_rdEnvironmentalOpen in IMG/M
3300014496Permafrost microbial communities from Stordalen Mire, Sweden - 711E1D metaGEnvironmentalOpen in IMG/M
3300015159Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G3C, Proglacial river margin, by glacier terminus)EnvironmentalOpen in IMG/M
3300015209Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G3B, Proglacial river margin, by glacier terminus)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300017937Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4EnvironmentalOpen in IMG/M
3300017995Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1EnvironmentalOpen in IMG/M
3300017996Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_40EnvironmentalOpen in IMG/M
3300018017Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40EnvironmentalOpen in IMG/M
3300018037Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10EnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018088Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MGEnvironmentalOpen in IMG/M
3300020150Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_20_MGEnvironmentalOpen in IMG/M
3300020155Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L239-10mEnvironmentalOpen in IMG/M
3300020197Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015037 Kigoma Deep Cast 65mEnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021063Subsurface sediment microbial communities from Mancos shale, Colorado, United States - Mancos D4EnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021470Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L239-20mEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300021476Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2)EnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021516Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L626-11mEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022726Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022886Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S079-202R-5EnvironmentalOpen in IMG/M
3300023071Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S019-104C-5EnvironmentalOpen in IMG/M
3300023184Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503EnvironmentalOpen in IMG/M
3300023266Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S220-509R-4EnvironmentalOpen in IMG/M
3300025315Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)Host-AssociatedOpen in IMG/M
3300025553Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 deep-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300025588Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-3 shallow-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025627Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-1 deep-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300025633Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-1 shallow-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300025878Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D (SPAdes)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025919Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026049Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqB_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026467Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-AEnvironmentalOpen in IMG/M
3300027069Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF002 (SPAdes)EnvironmentalOpen in IMG/M
3300027105Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF018 (SPAdes)EnvironmentalOpen in IMG/M
3300027173Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF036 (SPAdes)EnvironmentalOpen in IMG/M
3300027297Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF047 (SPAdes)EnvironmentalOpen in IMG/M
3300027548Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027565Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027583Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027591Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027819Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW37 contaminated, 5.8 m (SPAdes)EnvironmentalOpen in IMG/M
3300027848Freshwater microbial communities from Lake Bonney liftoff mats and glacier meltwater in Antarctica - BON-01 (SPAdes)EnvironmentalOpen in IMG/M
3300027870Freshwater and sediment microbial communities from Lake Erie, Canada (SPAdes)EnvironmentalOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300027954Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_50_60 (SPAdes)EnvironmentalOpen in IMG/M
3300027965Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2 (SPAdes)EnvironmentalOpen in IMG/M
3300027970 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14.5mEnvironmentalOpen in IMG/M
3300027986Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028047Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300028793Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159EnvironmentalOpen in IMG/M
3300028824Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300031359Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1603-40EnvironmentalOpen in IMG/M
3300031538Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1EnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031549Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24EnvironmentalOpen in IMG/M
3300031669Soil microbial communities from Risofladan, Vaasa, Finland - TR-1EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031769Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24EnvironmentalOpen in IMG/M
3300031779Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22EnvironmentalOpen in IMG/M
3300031780Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21EnvironmentalOpen in IMG/M
3300031799Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031832Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25EnvironmentalOpen in IMG/M
3300031860Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25EnvironmentalOpen in IMG/M
3300031880Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031959Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24EnvironmentalOpen in IMG/M
3300032000Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3EnvironmentalOpen in IMG/M
3300032025Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032044Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20EnvironmentalOpen in IMG/M
3300032054Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032091Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25EnvironmentalOpen in IMG/M
3300032094Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25EnvironmentalOpen in IMG/M
3300032164Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033002Soil microbial community from agricultural field in Dibrughar, Assam, India - D1EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M
3300033475Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YCEnvironmentalOpen in IMG/M
3300033502Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF9FY SIP fractionEnvironmentalOpen in IMG/M
3300033824Peat soil microbial communities from Stordalen Mire, Sweden - 714 S2 5-9EnvironmentalOpen in IMG/M
3300034155Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_05D_17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
beta3_all_008660702124908028SoilMPVRRSPNGARHVRPQPGRNRPERVVAINRNAWSQSVGTGGRNHPVRA
B3_GZOS_CLC_006520502124908035SoilMPVRRSPNGARHVRPQPGRNRPERVVAINRNAWSQSVGTGGRNHPVRAIQELPCV
E1_033056502170459002Grass SoilMPIRGSPNGARHPRPQAGRNRPEWVVAINRNGWSQSIVTAGRDHPVRAPE
E41_115242402170459005Grass SoilNGVRHTRPQPGRDRPEWVVAILRNEWSQSIVIGGRNQPVRPRYGGFMSTRAL
JGI12695J13573_100223613300001180Forest SoilMPIRRSPNGAGYTRPQPGRDPPEWVVAINRNGWSQSIVIGGRNQSVRP
JGI20195J14853_100763413300001402Arctic Peat SoilMPIRRSPNGAGYTRPQPGRDRPEWVVAINRNAWSQSIGISGRNQPVRAEIEERLIELTSLVHDQT
JGI20274J16320_10002413300001652Forest SoilMPIRGSPNGANHLRPQAGRDRLEQVVAINRNAWSQSIGTAG
JGI12627J18819_1002063043300001867Forest SoilMPIRGSPNGAGYLRPQAGRDCPESVVAINRNGWSQSIGMAGRDRPVR
JGIcombinedJ21912_1003105533300002069Arctic Peat SoilMPIRRSPNGAGYTRPQPGRDRPEWVVAINRNAWXQSIGIXGRNQPVRA
JGIcombinedJ26739_10020457013300002245Forest SoilMPIRGSPNGANHLRPQAGRDRLEQVVAINRNAWSQSIGTAGRNHPVR
JGI24140J50213_1001633913300003369Arctic Peat SoilMPVRRSPNGARHVRPQPGRNRPERVVAINRKAWSQSVGTGGRNHPVRA
Ga0063602_10239143300003970FreshwaterMPIRRSPNGPHYPRPQPGRDHPEQVVAINRNDRSQSIGKGGRNHPVRAVGPS
Ga0055455_1005183713300003990Natural And Restored WetlandsMPIRGSPNGARHPRPQLGRDPPEQVVAINRNGWSQSIGIAGRDHP
Ga0055467_1021814713300003996Natural And Restored WetlandsMPIRRSPNGAHHPRPQPGRDRPEQVVAINRNDRSQSIGTGGR
Ga0055499_1002397413300004047Natural And Restored WetlandsMPIRRSPNDARHPRPQGGRDHPEQVVAINRNDWSQSIGTGGRDHPVRA
Ga0055481_1035410613300004065Natural And Restored WetlandsMPIRRSPNGAHHPRPQPGRDRPEQVVAINRNDRSQSIGTGGRNHPV
Ga0062380_1051797623300004779Wetland SedimentMLIRRSPNGADHTRPQPGRDPPESVVAINRNTWSQSIGIGGRNPPVRAKSHQLHELLA*
Ga0066690_1060169823300005177SoilMPIRRSPNSADHTRPQPGRDHPEWVVAINRNRWSQSIGISGRNQPVRAVR*
Ga0068993_1030361523300005183Natural And Restored WetlandsMPIRRSPSGARHPRPQAGRDRPEWVVAINRNGWSQSIVTAGRNHPVRAPHTGT*
Ga0068995_1003913813300005206Natural And Restored WetlandsMPIRRSPNDARHPRPQGGRDHPEQVVAINRNDWSQSIGTPGRDHPVRA
Ga0066388_10149870733300005332Tropical Forest SoilMPIRRSPNGAGHTGPQSGRDRPEQMVAINRNTWSQSIGISGRNQPVR
Ga0070738_1000417363300005531Surface SoilMPIRGLPNGARHTRPQAGRDRPEWVVAINRSRWSQSIVAGGRNQS*
Ga0066905_10002778843300005713Tropical Forest SoilMPIRGSPNGARHPPSTGGRDRPESVVAIRRNGWPRSIGMSGRDQSESLVAIFRCAQ
Ga0068851_1019869613300005834Corn RhizosphereMPIRGSPNGAYHPHPQAGRDRPEWVVAINRNAWSQSIGIAGRNHPV
Ga0070766_1003989733300005921SoilMPIRGSPNGANHLRPQAGRDRLEQVVAINRNAWSQSIGTAGR
Ga0066795_1008585333300005938SoilMPIRRSPNGARHVRPQPGRNRPERVVAINRNAWSQSVGTGGR
Ga0075417_1064011413300006049Populus RhizosphereMPIRGSPNGARHPRPQAGRDRPEWVVAINRNAWSQSIGTAGRNHPVCATMSI
Ga0075028_10008787813300006050WatershedsMPIRRSPNGAGHTRPQPGRDRPEWVVAINRNARSQS
Ga0075028_10075416423300006050WatershedsMPIRGSPNGARHIPPQAGRDRPEGVVAINRKARSQSIGTGGRNGPVRATIGEARSSWQQV
Ga0075019_1047478513300006086WatershedsMPIRGSPNGAGYLRPQAGRDCPESVVAINRNGWSQSIGMAGRDRPVRA
Ga0075014_10010379223300006174WatershedsMPIRGLPNDVHHTRPQAGRDRPEQVVAINRSGWSQSVVAGGRNQS*
Ga0074059_1200058923300006578SoilMPIRGSPNGANHLRPQAGRDRLEQVVAINRNAWSQSIGT
Ga0075522_1034226033300006638Arctic Peat SoilMPIRGSPNGAGYLRPQAGRDRPESVVAINRNGRSQSIGMAGRD
Ga0066660_1115642913300006800SoilMPIRGSPNGAYHLRPQACRDRPEQVVAINRNAWSQS
Ga0075425_10177146023300006854Populus RhizosphereMPIRRSPNGAGYLRPQAGRDRPESAVAINRNGWSQSIGMAGRHRPVRARQPGDGTGDPPRLVARQ*
Ga0068865_10026289113300006881Miscanthus RhizosphereMPIRGSPNGAYHPHPQAGRDRPEWVVAINRNAWSQSIG
Ga0075524_1034819523300006950Arctic Peat SoilMPVRRSPNGARHVRPQPGRNRPERVVAINRNAWSQSVGTGGR
Ga0105053_1043696813300007522FreshwaterMPIRRSPNGARHVRPQPGRNRPERVVAINRNAWSQSVGIGGRNHPVRA
Ga0105048_1096057123300009032FreshwaterMPIRRSPNGPHYPRPQPGRDHPEQVVAINRNDRSQS
Ga0105046_1133457723300009084FreshwaterMPIRRSPNGARHPRPQHDRDRPEWVVAINRNDWSQSIG
Ga0111539_1040505423300009094Populus RhizosphereMPIRGSPNGAHHPRPQAGRDRPEWVVAINRNAWSQSIGIAGRNQPVRA
Ga0105247_1178261323300009101Switchgrass RhizosphereMPIRGSPNGARHSRPQGGRDPPEWVDAINRNGRSQTIVTDGRDHPVRAD
Ga0114970_1017820513300009163Freshwater LakeMPIRRSPNGARHVRPQPGRNRPERVVAVNRNAWSQSVGIGGRNHP
Ga0105248_1228284123300009177Switchgrass RhizosphereMPIRGSPNGAGYLRPQAARDRPESVVAINRNGWSQSIGMAGRHRPVRAGSLHSSPPASAR
Ga0105237_1036333613300009545Corn RhizosphereMPIRGSPNGARHSRPQGGRDPPEWVDAINRNGRSQTIVTAGRDHPVRAVRLCQYWVTFFDTQSLHSFPSFY
Ga0123355_1043651013300009826Termite GutMPIRRLPNGLRHTHPQAGRDRPEPVVAILRNGWSRSSGMGGRDPPEWVVAINRTKWSRSSGM
Ga0126378_1111055813300010361Tropical Forest SoilPNGAGHTGPQSGRDRPEQMVAINRNAWSQSIGISGRNQPVRAPTRNIAQHSY*
Ga0134128_1222824013300010373Terrestrial SoilMPIRGSPNGAYHPHPQAGRDRPEWVVAINRNAWSQSIGIAGRNHPVRAKLAELVQEA*
Ga0105239_1075629523300010375Corn RhizosphereMERSEAMPIRGSPNGADHPRPQGGRDHPEWVVAINRNGWSQSIGIAGRDHPVCAVMGK*
Ga0126381_10331955633300010376Tropical Forest SoilMPIRGSPDGARHPHPQAGRDRPEWVVAIIRNAWSRSIGIA
Ga0136449_10024562053300010379Peatlands SoilMPIRRSPNGARHTPPQPGRDRPEQVVAINRNAWSQSIGISGRNHPVRA
Ga0134126_1034924513300010396Terrestrial SoilMPIRGSPNGAGYLRPQAGRDRPESVVAINRNARSR
Ga0134127_1064724723300010399Terrestrial SoilMPIRGSPNGAGYLRPQAGRDRPESAVAINRNGWSQSIGMAGRHRPVRAH
Ga0134123_1316818523300010403Terrestrial SoilMPIRGSPNGARHSRPQGGRDRPEWEVAINRNGWSQSFVTAGRDHPVRA
Ga0105246_1088525313300011119Miscanthus RhizosphereMERSEAMPIRGSPNGADHPRPQGGRDHPEWVVAINRNGWSQSIVTAGRDHPVHTFLVAVN
Ga0153933_102659423300011411Attine Ant Fungus GardensMPIRGSPNGARHPRPQVVAIARNGWSRSIGMTEGSNRARITSIAA
Ga0137371_1062603213300012356Vadose Zone SoilMPIRGSPNGAYHPHPQAGRDRPEWVVAIKLNAWSQSIRIAARHHPVRALSRHTRLSSC
Ga0157292_1020206833300012900SoilMPIRGSPNGARHPRPQVGRDRPEWVVAINRNAWSQSIGTAGRNHPVCAACPLKVY
Ga0157302_1004472023300012915SoilMPIRRSPNGAYHPHPQAGRDRPEWVVAINRNAWSQSIGIAGRNHPVRAPQMLF*
Ga0164303_1056904423300012957SoilMERSEAMPIRGSPNGAYHPHPQAGRDRPEWVVAINRNAWSQSIGIAGRNHPVRAENMF
Ga0157375_1028049233300013308Miscanthus RhizosphereMPIRGSPNGARHPRPQAGRDRPEWVVAINRNAWSQSIG
Ga0120109_110247123300014052PermafrostMPIRRSPNGVRHVRPQPGRNRPEWVVAINRNARSQSVGMGGRNHPVRACRRTLDT
Ga0075351_100415833300014318Natural And Restored WetlandsMPIRRSPNDARHPRPQGGRDHPEQVVAINRNVWSQSIGIAGRDHPVRADQWIN*
Ga0182011_1008834633300014496FenMPIRGSPNGAHHPRPQAGRDRPEWVVAINRNDWSQSIGIAGRNHPVRASAFLTISMSRVLALF
Ga0167630_107516313300015159Glacier Forefield SoilMPIRRSPNGARHVRPQPGRNRPERVVAINRNAWSQSVGTGG
Ga0167629_108929413300015209Glacier Forefield SoilMPIRRSPNGVRHVRPQPGRDRPEWVVAINRNAWSQSV
Ga0132258_1111400333300015371Arabidopsis RhizosphereMPIRGSPNGTHHLRPQGGRDRPEWVVAINRNGWSQSIVTAGRDHPVRA
Ga0132258_1238167933300015371Arabidopsis RhizosphereMPIRGSPNGARHPRPQAGRDRPEWVVAINRNAWSQSIGIAGRN
Ga0132256_10009647733300015372Arabidopsis RhizosphereMPIRGSPNGAGYLRPQAGRDRPESAVAINRNGWSQSIGMAGRDRPVRAVG
Ga0182036_1092193313300016270SoilMPIRGLPNGLHHTRPQAGRDRPEWVVAINRSRWSESIVARS
Ga0187809_1031497013300017937Freshwater SedimentMPIRRSPNGARHPRPQAGRDRPESVVAINRSGWTRSIGIAGRDRPVRARNFW
Ga0187816_1037591423300017995Freshwater SedimentMPIRGSPNGAGYLRPQAGRDRPESVVAINRNGWSQSIGMAGRDRPVRAGGLTSYREA
Ga0187891_108037613300017996PeatlandIRRSPNGVGYTRPQPGRDRPEWVVAINRNAWSQSIGIGGRNQPVRAPNRCATANAPLI
Ga0187872_1037650413300018017PeatlandPQPGRDRPEWVVAINRNAWSQSIGIGGRNQPVRAPDNDAYGA
Ga0187872_1049505513300018017PeatlandRPQPGRDRPEWVVAINRNAWSQSIGIGGRNQPVRAAGSISV
Ga0187883_1019963313300018037PeatlandPQPGRDRPEWVVAINRNAWSQSIGIGGRNQPVRANWRSLSQQRGFVRGFQ
Ga0187766_1012150823300018058Tropical PeatlandMPIRGSPNGAYHPHPQAGRDRPEWVVAINRNAWSQSIGTAGRNHPVRASENVGKSLFPTPPV
Ga0187771_1061848723300018088Tropical PeatlandMPIRRSPNGVRHTPPQPGRNQPESVVAINRNAWSQ
Ga0187768_100651213300020150Tropical PeatlandMPIRRSPNDARHTRPQGGRDHPEQVVAINRNDWSQSIGTPGRDHPVRANWV
Ga0194050_103882623300020155Anoxic Zone FreshwaterMPIRRSPNGARHVRPQPGRNRPERVVAVNRNAWSQSVGIGGRNHPVRAVVKATEVT
Ga0194050_118222113300020155Anoxic Zone FreshwaterMPIRRSPNGARHVRPQPGRNRPERVVAINRNAWSQSIGTGGRNHPVRAIYSDVKTG
Ga0194128_1055458323300020197Freshwater LakeMPIRRSPNDAHHPRPQPGRDRPEWVVAINRNDWSQSIGTGGRDHP
Ga0210407_1005187513300020579SoilMPIRGSPNGANHLRPQAGRDRLEQVVAINRNAWSQSIGTTGRNHPVRATRGL
Ga0210407_1005959533300020579SoilMPIRRSPNGAGHTRPQPGRDRPEWVVAINRNARSQSIGIGGRNQPVRAVSVSRMA
Ga0210407_1062279223300020579SoilMPIRGSPNGAGYLRPQAGRDRPESVVAINRNGWSQSIGMAGRDRPVRAPGARQS
Ga0210403_1005822813300020580SoilMPIRGSPNGANHLRPQAGRDRLEQVVAINRNAWSQSIGTAGRNHPVRADIDQI
Ga0210399_1007019233300020581SoilMPIRGSPNGANHLRPQAGRDRLEQVVAINRNAWSQSIGTTGRNHPVRATRGLRT
Ga0210399_1083085223300020581SoilMPIRGSPNGAYHPHPQAGRDRPEWVVAINRNAWSQSIGIVGRDHPVRALESAVLSDSFSK
Ga0210395_1006164633300020582SoilMPIRRSPNGAGHTRPQPGRDRPEWVVAINRNARSQSIGIGGRNQPVRAVYWMGFH
Ga0210401_1008473743300020583SoilMPIRGSPNGAGYLRPQAGRDRPESVVAINRNGWSQSIGMAGRDRPVRAGN
Ga0210401_1152634823300020583SoilMLIRRSPNGAGHTRPQPGRDRSEQVVAINRNAWSQSIGIGGRNH
Ga0206227_106385613300021063Deep Subsurface SedimentMPIRRSPNGARHVRPQPGRNRPERVVAINRNAWPQSVGTGGRNHP
Ga0210406_1023344723300021168SoilMPIRGSPNGAGYLRPQAGRDRPESVVAINRNGWSQSIGMAG
Ga0210400_1068255723300021170SoilNGANHLRPQAGRDRLEQVVAINRNAWSQSIGTTGRNHPVRARGGKKALIVAT
Ga0210405_1122623313300021171SoilMPIRGSPNGAGYLRPQAGRDRPESVVAINRNGWSQSIGMAGRDRPVRAAES
Ga0210408_1001062633300021178SoilMPIRRSPNGAGHTRPQPGRDRPEWVVAINRNARSQSIGIGGRNQPVRAVYWMGFHELN
Ga0210396_1005018243300021180SoilMPIRGSPNGAGYLRPQAGRDRPESVVAINRNGWSQSIGMAGRDRPVRAPESPDGSLS
Ga0210396_1100748723300021180SoilMPIRGSPNGANHLRPQAGRDRLEQVVAINRNAWSQSIGTAGRNHPVRAGE
Ga0210387_1006533543300021405SoilMPIRGSPNGAGYLRPQAGRDRPESVVAINRNGWSQSIGMAGRDRPVRAGRA
Ga0210387_1007699833300021405SoilMPIRGSPNGANHLRPQAGRDRLEQVVAINRNAWSQSIGTTGRNHPVRARD
Ga0210386_1007597813300021406SoilMPIRGSPNGAGYLRPQAGRDRPESVVAINRNGWSQSIGMAGRDRPVRATS
Ga0210383_1095997713300021407SoilMPIRRSPNGAGHTRPQPGRDRPEWVVAINRNARSQSIGIGGRNQPVRAPNWPKW
Ga0210394_1007552443300021420SoilMPIRGSPNGANHLRPQAGRDRLEQVVAINRNAWSQSIGTTGRNHPVRAAERARLNK
Ga0210394_1121763613300021420SoilMPIRGSPNGAGYLRPQAGRDRPESVVAINRNGWSQSIGMAGRDRPVRAELR
Ga0210394_1170347523300021420SoilMPIRGLPNGLHHTRPQAGRDRPEWVVAINRSRWSQSIVAGGRNP
Ga0194051_101778243300021470Anoxic Zone FreshwaterMPIRRSPNGARHVRPQPGRDRPEWVVAINRNAWSQSVGTGGRNHPVRAVMD
Ga0210390_1004639413300021474SoilMPIRGSPNGAGYLRPQAGRDRPESVVAINRNGWSQSIGMAGRDRPVRARL
Ga0210392_1004402733300021475SoilMPIRGSPNGAGYLRPQAGRDRPESVVAINRNGWSQSIGMAGRDRPVRAELRR
Ga0210392_1020646013300021475SoilMPIRGSPNGANHLRPQAGRDRLEQVVAINRNAWSQSIGTAGRNHPVRAVQTVLT
Ga0187846_1006883913300021476BiofilmMPIRRSPNGARHTPPQPGRDRPEQVVAINRNAWSQSIGISGRNHPVRAAI
Ga0210398_1076122613300021477SoilMLIRRSPNGAGHTRPQPGRDRSEQVVAINRNAWSQSIGIGGRNHPVRARGA
Ga0210398_1088255413300021477SoilMPIRGSPNGAGYLRPQAGRDRPESVVAINRNGWSQ
Ga0210402_1008330233300021478SoilMPIRGSPNGANHLRPQAGRDRLEQVVAINRNAWSQSIGTAGRNHPVRAGEPAIREGAN
Ga0210402_1022665223300021478SoilMPIRGSPNGAGYLRPQAGRDRPESVVAINRNGWSQSIGMAGRDRPVRAPGAR
Ga0210410_1164221223300021479SoilMPIRGSPNGAGYLRPQAGRDRPESVVAINRNGWSQSI
Ga0194045_110877413300021516Anoxic Zone FreshwaterMPIRRSPNGARHVRPQPGRNRPERVVAVNRNAWSQSVGIGGRNHPVRARYRQDGE
Ga0126371_1315096613300021560Tropical Forest SoilSEAMPIRGSPNGARHSRPQGGRDRPEWVVAINRNGWSQSIVTAGRDHPVRAQHEEAM
Ga0242654_1014650613300022726SoilGSPNGANHLRPQAGRDRLEQVVAINRNAWSQSIGTTGRNHPVRARGLTQE
Ga0247746_110472013300022886SoilMPIRGSPNGARHPRPQAGRDRPEWVVAINRNAWSQSIGIAGRNHPVRASQCA
Ga0247752_108367523300023071SoilMPIRGSPNGARHPRPQAGRDRPEWVVAINRNAWSQSIGIAGRNHPVRAG
Ga0214919_1027766113300023184FreshwaterMPIRRSPNGARHVRPQPGRNRPERVVAVNRNAWSQSVGIGGRNHPVRAD
Ga0247789_112358013300023266SoilMPIRGSPNGARHPRPQAGRDRPEWVVAINRNAWSQSIGIAGRNHPVR
Ga0207697_1048588623300025315Corn, Switchgrass And Miscanthus RhizosphereMPIRGSPNGARHPRPQAGRDRPEWVVAINRNAWSQSIGIAGRNHPV
Ga0208080_102394333300025553Arctic Peat SoilMPIRRSPNGARHVRPQPGRNRPERVVAINRNAWSQS
Ga0208586_105104113300025588Arctic Peat SoilMPIRGSPNGAGYLRPQAGRDRPESVVAINRNARSQSVGTG
Ga0208220_109867323300025627Arctic Peat SoilMPIRGSPNGAGYLRPQAGRDRPESVVAINRNAWSQSIGMA
Ga0208480_100801443300025633Arctic Peat SoilMPIRGSPNGAGYLRPQAGRDRPESVVAINRNAWSQSIGMAGRNRPVRTPDHHARHE
Ga0209584_1043541713300025878Arctic Peat SoilMPVRRSPNGARHVRPQPGRNRPERVVAINRNAWSQSVGTGGRNHPVRAVKRGERPR
Ga0207699_1096543913300025906Corn, Switchgrass And Miscanthus RhizosphereMPIRGSPNGAYHPHPQAGRDRPEWVVAINRNAWSQSIGIVGRDHPVRAI
Ga0207693_1044485523300025915Corn, Switchgrass And Miscanthus RhizosphereMPIRGSPNGARHLRPQAGRNRPEWVVAINRNAWSQSIGIAGRDHPVRATGKRRCAMQASK
Ga0207657_1011609823300025919Corn RhizosphereMPIRGSPNGAYHPHPQAGRDRPEWVVAINRNAWSQSIGIAGRNHPVRAQI
Ga0207681_1017298923300025923Switchgrass RhizosphereMPIRGSPNGARHPRPQAGRDRPEWVVAINRNAWSQS
Ga0207659_1045697913300025926Miscanthus RhizosphereMPIRGSPNGADHPRPQGGRDHPEWVVAINRNGWSQSIGIAGRDHPVCAQFA
Ga0207659_1104675513300025926Miscanthus RhizosphereMPIRGSPNGARHPRPQAGRDRPEWVVAINRNAWSQSIGIAGRNHPVRAFD
Ga0207687_1137991113300025927Miscanthus RhizosphereMPIRGSPNGARHPRPQAGRDRPEWVVAINRNAWSQSIGIAGRNHPVRAAQMSS
Ga0207664_1123728913300025929Agricultural SoilMPIRGLPNGLHHTRPQAGRDRPEWVVAINRSGWSQSIVADGRNQS
Ga0207690_1115429613300025932Corn RhizosphereMPIRGSPNGAYHPHPQAGRDRPEWVVAINRNAWSQSIGIAGRNHPVRATQAHR
Ga0207711_1031559513300025941Switchgrass RhizosphereMPIRGSPNGADHPRPQGGRDHPEWVVAINRNGWSQSIGIAGRDHPVCAP
Ga0208781_101453813300026049Natural And Restored WetlandsMPIRRSPNGAHHPRPQPGRDRPEWVVAINRNDWSQSIGTG
Ga0207676_1033127523300026095Switchgrass RhizosphereMPIRGSPNGARHPRPQAGRDRPEWVVAINRNAWSQSI
Ga0257154_102147613300026467SoilPNGAGYTRPQPGRDRPEWVVAINRNAWSQSIGNSGRNQPVRA
Ga0208859_100065413300027069Forest SoilMPIRGSPNGANHLRPQAGRDRLEQVVAINRNAWSQSIGTAGRNHPVRADF
Ga0208859_100083623300027069Forest SoilMPIRRSPNGAGHTRPQPGRDRPEWVVAINRNARSQSIGIGGRNQPVRAHGQTVVLDNSS
Ga0207944_102552923300027105Forest SoilMPIRRSPNGPGHTRPQPGRDRPEWVVAINRNARSQSIGIGGRNQ
Ga0208097_100082613300027173Forest SoilMPIRGSPNGANHLRPQAGRDRLEQVVAINRNAWSQSIGTTGR
Ga0208097_101873713300027173Forest SoilMPIRRSPNGAGHTRPQPGRDRPEWVVAINRNARSQSIGIGGRNQ
Ga0208241_100122413300027297Forest SoilMPIRGSPNGANHLRPQAGRDRLEQVVAINRNAWSQSIGTAGRNHPVRAQQ
Ga0209523_102043013300027548Forest SoilMPIRGSPNGAGYLRPQAGRDCPESVVAINRNGWSQSIGMAGRD
Ga0209219_100173263300027565Forest SoilMPIRRSPNGVRHTRPQPGRDRPEWVVAINRNDWSQSIVVGGRNPPVRPNEDS
Ga0209219_102297723300027565Forest SoilMPIRRSPNGAGYTRPQPGRDPPEWVVAINRNGWSQSIVIGGRNQPVR
Ga0209527_100764813300027583Forest SoilMPIRGSPNGANHLRPQAGRDRLEQVVAINRNAWSQSIGTAGRNHPVRAL
Ga0209733_100618313300027591Forest SoilMPIRRSPNGAHHTPPQPGRDRPEQVVAINRNAWSQSIGISGRNHPVRA
Ga0209514_1005301413300027819GroundwaterMPIRRSPNGVHHVRPQPGRNRPEWVVAINRNAWSQSVG
Ga0209390_1046791423300027848FreshwaterMPIRRSPNGARHVRPQPGRNRPERVVAINRNAWSQSVGIGGRNHPVRAASAQAGRRH
Ga0209023_1030361023300027870Freshwater And SedimentMPIRRSPNSVRHVRPQPGRDRPEWVVAINRNARSQSVGTGGRNHPVRSVS
Ga0209023_1050041513300027870Freshwater And SedimentMPIRRSPNGARHVRPQPGRNRPERVVAINRNAWSQSVGTGGRNHPVR
Ga0209275_1002265433300027884SoilMPIRGSPNGANHLRPQAGRDRLEQVVAINRNAWSQSIGTAGRNHPVRAVM
Ga0209859_100786013300027954Groundwater SandMPSRGSPNGARHTRPQPNRAGRDRPEQVVVIDWNGWSSS
Ga0209062_100312453300027965Surface SoilMPIRGLPNGARHTRPQAGRDRPEWVVAINRSRWSQSIVAGGRNQS
(restricted) Ga0247837_115724623300027970FreshwaterMPIRRSPNGARHVRPQPGRNRPERVVAVNRNAWSQSI
Ga0209168_1020420813300027986Surface SoilMPIRGSPNGAGYLRPQAGRDRPESVVAINRNARSRSIG
Ga0209526_1002412673300028047Forest SoilMPIRGSPNGANHLRPQAGRDRLEQVVAINRNAWSQSIGTAGRDHPVPAGESSKWQL
Ga0307299_1029891413300028793SoilMPIRRSPNGARHPRPQASRDRPEWVVAINRNEWSQSIVIGGRNQPVRPCFQ
Ga0307310_1002493453300028824SoilMPIRRSPNGARHPRPQASRDRPEWVVAINRNAWSQSIGIPGRDHSVRAPLLLSG
Ga0308309_1005748213300028906SoilMPIRGSPNGANHLRPQAGRDRLEQVVAINRNAWSQSIGTAGRNHPVRAQQASQHP
Ga0307426_101666963300031359Salt MarshMPIRRSPNGARHPRPQAGRDRPERVVAINRNGWSQSIGIAGRDHSERAV
Ga0310888_1058293123300031538SoilMPIRGSPNGARHPRPQAGRDRPEWVVAINRNVWSQSIGTA
Ga0318534_1003526233300031544SoilMPIRRSPNGAHHPHPQAGRDRPEWVVAINRNAWSQSIGIAGRDHPVCA
Ga0318541_1002943433300031545SoilMPIRRSPNGAHHPHPQAGRDRPEWVVAINRNAWSQSIGIAGRDHPVCAV
Ga0318538_1002520413300031546SoilMPIRRSPNGAHHPHPQAGRDRPEWVVAINRNAWSQSIGIAGRDHPVCASGPP
Ga0318571_1000671413300031549SoilMPIRRSPNGAHHPHPQAGRDRPEWVVAINRNAWSQSIGIAGRDHPVCAVPG
Ga0307375_1059227523300031669SoilMPIRGSPNGARHPRPQLGRDPPEQVVAINRNGWSQSIGIAGRDHPVRAP
Ga0307469_1021084923300031720Hardwood Forest SoilMPIRGSPNGAYHPHPQAGRDRPEWVVAINRNAWSQSIGIVGRDHPVRAC
Ga0318493_1002373453300031723SoilMPIRRSPNGAHHPHPQAGRDRPEWVVAINRNAWSQSIGIAGRDHPVCAHQAPLL
Ga0318501_1002405813300031736SoilMPIRRSPNGAHHPHPQAGRDRPEWVVAINRNAWSQSIG
Ga0318526_1001231413300031769SoilMPIRRSPNGAHHPHPQAGRDRPEWVVAINRNAWSQSIGIAGRDHPVCALN
Ga0318566_1002353543300031779SoilMPIRGLPNGVRHTRPQAGRDHPQQVVAIDRNGWSRSIVA
Ga0318508_100468413300031780SoilMPIRRSPNGAHHPHPQAGRDRPEWVVAINRNAWSQSIGIAGRDHPVCAPR
Ga0318565_1002349833300031799SoilMPIRRSPNGAHHPHPQAGRDRPEWVVAINRNAWSQSIGIAGRDHPVCASGPPRLRIALCR
Ga0318497_1002960333300031805SoilMPIRRSPNGAHHPHPQAGRDRPEWVVAINRNAWSQSIGIAGRDHPVCAPKGVWHPPG
Ga0318568_1044637933300031819SoilMPIRGLPNGPCHNRPQAGRDRPEWVVAINRNPWSQSIGIAGRDRPVRAQGCTKARGPS
Ga0318499_1021665613300031832SoilMPGQRLPGAGYTRPQPGRDQSEQVVAINRNRWSQSIGISGRNQSVRAV
Ga0318495_1002373733300031860SoilMPIRRSPNGAHHPHPQAGRDRPEWVVAINRNAWSQSIGIAGRDHPVCAK
Ga0318544_1001205833300031880SoilMPIRRSPNGAHHPHPQAGRDRPEWVVAINRNAWSQSIGIAGRDHPVCATEEAMLAGSPQRYMDRHRIVR
Ga0318551_1002469843300031896SoilMPIRRSPNGAHHPHPQAGRDRPEWVVAINRNAWSQSIGIAGRDHPVCAMWSLLVV
Ga0318520_1039527323300031897SoilMPIRGLPNGPCHTRPQAGRDRPEWVVAINRNPWSQSI
Ga0306921_1143108613300031912SoilMPIRGLPNGPCHNRPQAGRDRPEWVVAINRNPWSQSIGIAGRDRPVRAPLEPEKIDTA
Ga0310916_1036304723300031942SoilMPIRGLPNGPCHNRPQAGRDRPEWVVAINRNPWSQSIGIAGRDRPVRAVAIYSPQIRDP
Ga0306926_1095306523300031954SoilMPIRGLPNGPCHNRPQAGRDRPEWVVAINRNPWSQSIGIAGRDRPVRAD
Ga0318530_1001250013300031959SoilMPIRRSPNGAHHPHPQAGRDRPEWVVAINRNAWSQSIGIAGRDHPV
Ga0310903_1001079243300032000SoilMPIRGSPNGARHPRPQAGRDRPEWVVAINRNAWSQSIGTA
Ga0318507_1001194213300032025SoilMPIRRSPNGAHHPHPQAGRDRPEWVVAINRNAWSQSIGIAGRDHPVCARSATLGDGVHNVEE
Ga0318556_1002474333300032043SoilMPIRRSPNGAHHPHPQAGRDRPEWVVAINRNAWSQSIGIAGRDHPVCAG
Ga0318558_1001958313300032044SoilMPIRRSPNGAHHPHPQAGRDRPEWVVAINRNAWSQSIGIAGRDHPVCAGPFAQRG
Ga0318570_1001380843300032054SoilMPIRRSPNGAHHPHPQAGRDRPEWVVAINRNAWSQSIGIAGRDHPVCAVLHGFGVAEPR
Ga0306924_1014586813300032076SoilMPIRRSPNGAHHPHPQAGRDRPEWVVAINRNAWSQSIGIAGRDHPVCAPPL
Ga0306924_1152863513300032076SoilPNGAHHPHPQAGRDRPEWVVAINRNAWSQSIGIAGRDHPVCAGTCM
Ga0318577_1002045013300032091SoilMPIRRSPNGAHHPHPQAGRDRPEWVVAINRNAWSQSIGIAGRDHPVCACKSRSRI
Ga0318540_1045720523300032094SoilMLIRRSPNGPGHTRPQPGRDRSEQVVAINRNRWSQSIGT
Ga0315283_1205194813300032164SedimentMPIRRSPNGAHHPRPQPGRDRPEWVVAINRNDWSQSIGTGGR
Ga0307472_10004160913300032205Hardwood Forest SoilMPIRGSPNGAYHPHPQAGRDRPEWVVAINRNAWSQSIGIVG
Ga0335082_1131746223300032782SoilMPIRGLPNGARHTRPQPGRDRPEQVVAINRRGWSQSIVARNRC
Ga0335078_1022200953300032805SoilMPIRGSPNGAGYVRPQAGRDRPESVVAINRNGWSQSIGMAGRNCP
Ga0335080_1066365423300032828SoilMPIRGSPNGARHPRPQAGRDRPEWVVAINRNAWSQSIGMSGRDQSESLVAII
Ga0335081_1026519313300032892SoilMPIRRSPNGAGHTRPQAGRDRPEWVVAINRNAWSQSIGISG
Ga0335076_1067376313300032955SoilMPIRGSPNGARHPRPQAGRDCPEWVVAINRNGWSQS
Ga0346503_102598943300033002SoilMPIRGSPNGAGHLRPQAGRDRPESVVAINRNGWSQSIGIAGRDHPERASKRHQTAFAE
Ga0335084_1012630243300033004SoilMPIRGLPNGLHHARPQAGRDRPEWVVAINRSGWSQSIVAGG
Ga0335073_1184247013300033134SoilMPIRGSPNGAGYLRPQAGRDCPESVVAINRNGWSQSIG
Ga0310810_1015243733300033412SoilMPIRGSPNGARHSRPQGGRDPPEWVDAINRNGRSQTIV
Ga0310811_1016678613300033475SoilMPIRGSPNGARHSRPQGGRDPPEWVDAINRNGRSQTIVTAGRDHPVRAVRLCQYWVTFF
Ga0326731_111117613300033502Peat SoilMPIRRSPNDARHPGPQAGRNPPEQVVAINRNAWSRSPGARTMNP
Ga0334840_013683_2695_28323300033824SoilMPIRRSPNGVRHIRPQPGRNRPEWVVAINRNARSQSVGTGGRNHPV
Ga0370498_028388_1_1113300034155Untreated Peat SoilMPIRRSPNGAHHPRPQPGRDRPEWVVAINRNDWSQSI


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.