Metagenome Family F022805

Basic Information
Family ID	F022805
Family Type	Metagenome
Number of Sequences	212
Average Sequence Length	39 residues
Representative Sequence	MLKCFGDLIGRTVEAYVNDIVVKSKWADHLVADLEQTFAKL
Number of Associated Samples	76
Number of Associated Scaffolds	212

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Eukaryota
% of genes with valid RBS motifs	2.83 %
% of genes near scaffold ends (potentially truncated)	34.43 %
% of genes from short scaffolds (< 2000 bps)	100.00 %
Associated GOLD sequencing projects	76
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.58

Most Common Taxonomy
Group	Eukaryota (57.547 % of family members)
NCBI Taxonomy ID	2759
Taxonomy	All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere (96.698 % of family members)
Environment Ontology (ENVO)	Unclassified (97.170 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant surface (97.170 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 56.52% β-sheet: 0.00% Coil/Unstructured: 43.48%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 212 Family Scaffolds
PF13456	RVT_3	0.47
PF00078	RVT_1	0.47
PF02992	Transposase_21	0.47

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	58.96 %
Unclassified	root	N/A	41.04 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	58.96 %
Unclassified	root	N/A	41.04 %

Name	Rank	Taxonomy	Distribution
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	57.55 %
Unclassified	root	N/A	41.04 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	1.42 %

Name	Rank	Taxonomy	Distribution
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	57.55 %
Unclassified	root	N/A	41.04 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1.42 %

Name	Rank	Taxonomy	Distribution
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	57.55 %
Unclassified	root	N/A	41.04 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	1.42 %

Name	Rank	Taxonomy	Distribution
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	57.55 %
Unclassified	root	N/A	41.04 %
Bacilli	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli	1.42 %

Name	Rank	Taxonomy	Distribution
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	57.55 %
Unclassified	root	N/A	41.04 %
Bacillales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales	1.42 %

Name	Rank	Taxonomy	Distribution
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	57.08 %
Unclassified	root	N/A	41.04 %
Bacillaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae	1.42 %

Name	Rank	Taxonomy	Distribution
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	57.08 %
Unclassified	root	N/A	41.04 %
Robertmurraya	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Robertmurraya	1.42 %

Name	Rank	Taxonomy	Distribution
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	57.08 %
Unclassified	root	N/A	41.04 %
Robertmurraya kyonggiensis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Robertmurraya → Robertmurraya kyonggiensis	1.42 %

Name	Rank	Taxonomy	Distribution
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	57.08 %
Unclassified	root	N/A	41.04 %
Robertmurraya kyonggiensis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Robertmurraya → Robertmurraya kyonggiensis	1.42 %

Name	Rank	Taxonomy	Distribution
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	57.08 %
Unclassified	root	N/A	41.04 %
Robertmurraya kyonggiensis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Robertmurraya → Robertmurraya kyonggiensis	1.42 %

Name	Rank	Taxonomy	Distribution
Liliopsida	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida	57.08 %
Unclassified	root	N/A	41.04 %
Robertmurraya kyonggiensis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Robertmurraya → Robertmurraya kyonggiensis	1.42 %

Name	Rank	Taxonomy	Distribution
Petrosaviidae	subclass	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae	57.08 %
Unclassified	root	N/A	41.04 %
Robertmurraya kyonggiensis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Robertmurraya → Robertmurraya kyonggiensis	1.42 %

Name	Rank	Taxonomy	Distribution
commelinids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids	57.08 %
Unclassified	root	N/A	41.04 %
Robertmurraya kyonggiensis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Robertmurraya → Robertmurraya kyonggiensis	1.42 %

Name	Rank	Taxonomy	Distribution
Poales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales	57.08 %
Unclassified	root	N/A	41.04 %
Robertmurraya kyonggiensis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Robertmurraya → Robertmurraya kyonggiensis	1.42 %

Name	Rank	Taxonomy	Distribution
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	57.08 %
Unclassified	root	N/A	41.04 %
Robertmurraya kyonggiensis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Robertmurraya → Robertmurraya kyonggiensis	1.42 %

Name	Rank	Taxonomy	Distribution
PACMAD clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade	56.13 %
Unclassified	root	N/A	41.04 %
Robertmurraya kyonggiensis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Robertmurraya → Robertmurraya kyonggiensis	1.42 %

Name	Rank	Taxonomy	Distribution
Panicoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	56.13 %
Unclassified	root	N/A	41.04 %
Robertmurraya kyonggiensis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Robertmurraya → Robertmurraya kyonggiensis	1.42 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	41.04 %
Andropogonodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae	16.98 %
Panicodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae	2.83 %
Robertmurraya kyonggiensis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Robertmurraya → Robertmurraya kyonggiensis	1.42 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	41.04 %
Andropogoneae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	16.98 %
Paniceae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	2.83 %
Robertmurraya kyonggiensis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Robertmurraya → Robertmurraya kyonggiensis	1.42 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	41.04 %
Saccharinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae	16.98 %
Cenchrinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae	1.42 %
Robertmurraya kyonggiensis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Robertmurraya → Robertmurraya kyonggiensis	1.42 %
Panicinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae	0.94 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	41.04 %
Miscanthus	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus	16.98 %
Setaria	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria	1.42 %
Robertmurraya kyonggiensis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Robertmurraya → Robertmurraya kyonggiensis	1.42 %
Panicum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	0.94 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	41.04 %
Miscanthus lutarioriparius	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	16.98 %
Setaria italica	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria italica	1.42 %
Robertmurraya kyonggiensis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Robertmurraya → Robertmurraya kyonggiensis	1.42 %
Panicum sect. Hiantes	section	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes	0.94 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	41.04 %
Miscanthus lutarioriparius	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	16.98 %
Setaria italica	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria italica	1.42 %
Robertmurraya kyonggiensis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Robertmurraya → Robertmurraya kyonggiensis	1.42 %
Panicum virgatum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	0.94 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300005338\|Ga0068868_101843025	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	572	Open in IMG/M
3300009148\|Ga0105243_13127612	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	501	Open in IMG/M
3300011119\|Ga0105246_12395160	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	518	Open in IMG/M
3300013296\|Ga0157374_11634013	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	669	Open in IMG/M
3300013297\|Ga0157378_12641221	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	555	Open in IMG/M
3300014969\|Ga0157376_12236244	Not Available	586	Open in IMG/M
3300015267\|Ga0182122_1061822	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	526	Open in IMG/M
3300015267\|Ga0182122_1069444	Not Available	508	Open in IMG/M
3300015268\|Ga0182154_1056700	Not Available	543	Open in IMG/M
3300015269\|Ga0182113_1082169	Not Available	530	Open in IMG/M
3300015269\|Ga0182113_1094007	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	508	Open in IMG/M
3300015269\|Ga0182113_1096277	Not Available	504	Open in IMG/M
3300015274\|Ga0182188_1003522	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	1065	Open in IMG/M
3300015274\|Ga0182188_1030654	Not Available	606	Open in IMG/M
3300015275\|Ga0182172_1028994	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	664	Open in IMG/M
3300015275\|Ga0182172_1038250	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	616	Open in IMG/M
3300015275\|Ga0182172_1071561	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	513	Open in IMG/M
3300015276\|Ga0182170_1010455	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	875	Open in IMG/M
3300015276\|Ga0182170_1032980	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	643	Open in IMG/M
3300015277\|Ga0182128_1020430	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	736	Open in IMG/M
3300015277\|Ga0182128_1034477	Not Available	640	Open in IMG/M
3300015277\|Ga0182128_1040145	Not Available	613	Open in IMG/M
3300015277\|Ga0182128_1058841	Not Available	550	Open in IMG/M
3300015279\|Ga0182174_1040623	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	628	Open in IMG/M
3300015281\|Ga0182160_1019384	Not Available	758	Open in IMG/M
3300015281\|Ga0182160_1067259	Not Available	537	Open in IMG/M
3300015281\|Ga0182160_1078709	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	512	Open in IMG/M
3300015281\|Ga0182160_1079794	Not Available	510	Open in IMG/M
3300015282\|Ga0182124_1019385	Not Available	753	Open in IMG/M
3300015282\|Ga0182124_1043861	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	605	Open in IMG/M
3300015283\|Ga0182156_1026629	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	711	Open in IMG/M
3300015283\|Ga0182156_1035093	Not Available	658	Open in IMG/M
3300015283\|Ga0182156_1047893	Not Available	603	Open in IMG/M
3300015285\|Ga0182186_1060212	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	554	Open in IMG/M
3300015285\|Ga0182186_1061413	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	550	Open in IMG/M
3300015286\|Ga0182176_1019896	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	794	Open in IMG/M
3300015286\|Ga0182176_1060668	Not Available	561	Open in IMG/M
3300015286\|Ga0182176_1067579	Not Available	543	Open in IMG/M
3300015287\|Ga0182171_1043128	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	622	Open in IMG/M
3300015287\|Ga0182171_1066420	Not Available	549	Open in IMG/M
3300015287\|Ga0182171_1073641	Not Available	532	Open in IMG/M
3300015288\|Ga0182173_1022330	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	738	Open in IMG/M
3300015288\|Ga0182173_1032995	Not Available	663	Open in IMG/M
3300015288\|Ga0182173_1048130	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	597	Open in IMG/M
3300015289\|Ga0182138_1033023	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	671	Open in IMG/M
3300015289\|Ga0182138_1053927	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	584	Open in IMG/M
3300015289\|Ga0182138_1079901	Not Available	520	Open in IMG/M
3300015289\|Ga0182138_1083110	Not Available	514	Open in IMG/M
3300015291\|Ga0182125_1060579	Not Available	576	Open in IMG/M
3300015292\|Ga0182141_1020660	Not Available	776	Open in IMG/M
3300015292\|Ga0182141_1038205	Not Available	656	Open in IMG/M
3300015294\|Ga0182126_1013242	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	884	Open in IMG/M
3300015294\|Ga0182126_1056332	Not Available	591	Open in IMG/M
3300015294\|Ga0182126_1097604	Not Available	500	Open in IMG/M
3300015295\|Ga0182175_1013506	Not Available	889	Open in IMG/M
3300015295\|Ga0182175_1060309	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	584	Open in IMG/M
3300015295\|Ga0182175_1077126	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	543	Open in IMG/M
3300015296\|Ga0182157_1104358	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	500	Open in IMG/M
3300015298\|Ga0182106_1008500	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	1042	Open in IMG/M
3300015298\|Ga0182106_1017756	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	843	Open in IMG/M
3300015298\|Ga0182106_1026474	Not Available	751	Open in IMG/M
3300015298\|Ga0182106_1070455	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	565	Open in IMG/M
3300015298\|Ga0182106_1095790	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	514	Open in IMG/M
3300015299\|Ga0182107_1007369	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	1076	Open in IMG/M
3300015299\|Ga0182107_1018258	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	838	Open in IMG/M
3300015299\|Ga0182107_1097519	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	514	Open in IMG/M
3300015300\|Ga0182108_1077300	Not Available	556	Open in IMG/M
3300015300\|Ga0182108_1079585	Not Available	551	Open in IMG/M
3300015302\|Ga0182143_1042391	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Robertmurraya → Robertmurraya kyonggiensis	660	Open in IMG/M
3300015302\|Ga0182143_1050044	Not Available	629	Open in IMG/M
3300015302\|Ga0182143_1083976	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	538	Open in IMG/M
3300015303\|Ga0182123_1002955	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	1313	Open in IMG/M
3300015303\|Ga0182123_1056859	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	592	Open in IMG/M
3300015303\|Ga0182123_1061860	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	577	Open in IMG/M
3300015303\|Ga0182123_1066334	Not Available	566	Open in IMG/M
3300015303\|Ga0182123_1084265	Not Available	527	Open in IMG/M
3300015303\|Ga0182123_1098918	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	502	Open in IMG/M
3300015304\|Ga0182112_1036608	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Robertmurraya → Robertmurraya kyonggiensis	689	Open in IMG/M
3300015304\|Ga0182112_1044744	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	651	Open in IMG/M
3300015304\|Ga0182112_1050411	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	629	Open in IMG/M
3300015304\|Ga0182112_1052130	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	623	Open in IMG/M
3300015304\|Ga0182112_1100613	Not Available	510	Open in IMG/M
3300015305\|Ga0182158_1021175	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	799	Open in IMG/M
3300015305\|Ga0182158_1049475	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	630	Open in IMG/M
3300015305\|Ga0182158_1055492	Not Available	609	Open in IMG/M
3300015305\|Ga0182158_1062410	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	589	Open in IMG/M
3300015307\|Ga0182144_1087797	Not Available	537	Open in IMG/M
3300015308\|Ga0182142_1066166	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	598	Open in IMG/M
3300015314\|Ga0182140_1045107	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	671	Open in IMG/M
3300015314\|Ga0182140_1072029	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	584	Open in IMG/M
3300015314\|Ga0182140_1075107	Not Available	576	Open in IMG/M
3300015314\|Ga0182140_1084618	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	556	Open in IMG/M
3300015314\|Ga0182140_1102074	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	523	Open in IMG/M
3300015321\|Ga0182127_1035762	Not Available	739	Open in IMG/M
3300015321\|Ga0182127_1057601	Not Available	641	Open in IMG/M
3300015321\|Ga0182127_1066902	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	613	Open in IMG/M
3300015321\|Ga0182127_1072793	Not Available	598	Open in IMG/M
3300015321\|Ga0182127_1106913	Not Available	528	Open in IMG/M
3300015322\|Ga0182110_1023638	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	829	Open in IMG/M
3300015322\|Ga0182110_1032489	Not Available	756	Open in IMG/M
3300015322\|Ga0182110_1058631	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	636	Open in IMG/M
3300015322\|Ga0182110_1093513	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	551	Open in IMG/M
3300015323\|Ga0182129_1060788	Not Available	612	Open in IMG/M
3300015323\|Ga0182129_1072478	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	581	Open in IMG/M
3300015323\|Ga0182129_1076015	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	573	Open in IMG/M
3300015329\|Ga0182135_1155545	Not Available	501	Open in IMG/M
3300015341\|Ga0182187_1079357	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	699	Open in IMG/M
3300015341\|Ga0182187_1100270	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	645	Open in IMG/M
3300015341\|Ga0182187_1114217	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	616	Open in IMG/M
3300015341\|Ga0182187_1128158	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	592	Open in IMG/M
3300015341\|Ga0182187_1184669	Not Available	518	Open in IMG/M
3300015343\|Ga0182155_1032109	Not Available	991	Open in IMG/M
3300015343\|Ga0182155_1061561	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	799	Open in IMG/M
3300015343\|Ga0182155_1108113	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	658	Open in IMG/M
3300015343\|Ga0182155_1130499	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	616	Open in IMG/M
3300015343\|Ga0182155_1142530	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Robertmurraya → Robertmurraya kyonggiensis	596	Open in IMG/M
3300015344\|Ga0182189_1036931	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	967	Open in IMG/M
3300015344\|Ga0182189_1100390	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	684	Open in IMG/M
3300015344\|Ga0182189_1117766	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	646	Open in IMG/M
3300015344\|Ga0182189_1132411	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria italica	619	Open in IMG/M
3300015344\|Ga0182189_1148735	Not Available	593	Open in IMG/M
3300015344\|Ga0182189_1190970	Not Available	539	Open in IMG/M
3300015344\|Ga0182189_1209212	Not Available	520	Open in IMG/M
3300015344\|Ga0182189_1209951	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	520	Open in IMG/M
3300015345\|Ga0182111_1040982	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	975	Open in IMG/M
3300015345\|Ga0182111_1117782	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	667	Open in IMG/M
3300015345\|Ga0182111_1205473	Not Available	538	Open in IMG/M
3300015345\|Ga0182111_1230494	Not Available	514	Open in IMG/M
3300015345\|Ga0182111_1244813	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria italica	502	Open in IMG/M
3300015346\|Ga0182139_1169094	Not Available	582	Open in IMG/M
3300015346\|Ga0182139_1240738	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	506	Open in IMG/M
3300015346\|Ga0182139_1244519	Not Available	502	Open in IMG/M
3300015347\|Ga0182177_1193901	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	554	Open in IMG/M
3300015347\|Ga0182177_1212261	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	535	Open in IMG/M
3300015347\|Ga0182177_1230323	Not Available	518	Open in IMG/M
3300015351\|Ga0182161_1078040	Not Available	814	Open in IMG/M
3300015351\|Ga0182161_1096137	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	752	Open in IMG/M
3300015351\|Ga0182161_1247344	Not Available	518	Open in IMG/M
3300015351\|Ga0182161_1254831	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	512	Open in IMG/M
3300015355\|Ga0182159_1118260	Not Available	801	Open in IMG/M
3300015355\|Ga0182159_1154780	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	717	Open in IMG/M
3300015355\|Ga0182159_1234562	Not Available	600	Open in IMG/M
3300015355\|Ga0182159_1241929	Not Available	592	Open in IMG/M
3300015355\|Ga0182159_1258041	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	575	Open in IMG/M
3300015355\|Ga0182159_1258095	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	575	Open in IMG/M
3300015355\|Ga0182159_1291202	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	546	Open in IMG/M
3300015355\|Ga0182159_1305324	Not Available	534	Open in IMG/M
3300015361\|Ga0182145_1180779	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	515	Open in IMG/M
3300015361\|Ga0182145_1182900	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	513	Open in IMG/M
3300017404\|Ga0182203_1086357	Not Available	620	Open in IMG/M
3300017404\|Ga0182203_1148622	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	519	Open in IMG/M
3300017407\|Ga0182220_1057582	Not Available	602	Open in IMG/M
3300017407\|Ga0182220_1082187	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	545	Open in IMG/M
3300017409\|Ga0182204_1038679	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	707	Open in IMG/M
3300017410\|Ga0182207_1076846	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	665	Open in IMG/M
3300017410\|Ga0182207_1113634	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	585	Open in IMG/M
3300017410\|Ga0182207_1117710	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	578	Open in IMG/M
3300017411\|Ga0182208_1089294	Not Available	566	Open in IMG/M
3300017411\|Ga0182208_1116565	Not Available	520	Open in IMG/M
3300017413\|Ga0182222_1054035	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	603	Open in IMG/M
3300017413\|Ga0182222_1093824	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	522	Open in IMG/M
3300017415\|Ga0182202_1085578	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	589	Open in IMG/M
3300017415\|Ga0182202_1103898	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	554	Open in IMG/M
3300017417\|Ga0182230_1052184	Not Available	719	Open in IMG/M
3300017420\|Ga0182228_1057438	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	677	Open in IMG/M
3300017420\|Ga0182228_1084221	Not Available	587	Open in IMG/M
3300017424\|Ga0182219_1039641	Not Available	744	Open in IMG/M
3300017424\|Ga0182219_1099637	Not Available	560	Open in IMG/M
3300017424\|Ga0182219_1122237	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	525	Open in IMG/M
3300017424\|Ga0182219_1123425	Not Available	523	Open in IMG/M
3300017424\|Ga0182219_1129137	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	516	Open in IMG/M
3300017424\|Ga0182219_1136294	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	507	Open in IMG/M
3300017425\|Ga0182224_1038470	Not Available	794	Open in IMG/M
3300017425\|Ga0182224_1045201	Not Available	757	Open in IMG/M
3300017425\|Ga0182224_1056398	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	707	Open in IMG/M
3300017425\|Ga0182224_1120266	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	559	Open in IMG/M
3300017427\|Ga0182190_1073707	Not Available	663	Open in IMG/M
3300017427\|Ga0182190_1147832	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	522	Open in IMG/M
3300017430\|Ga0182192_1041572	Not Available	819	Open in IMG/M
3300017433\|Ga0182206_1101085	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	582	Open in IMG/M
3300017436\|Ga0182209_1119211	Not Available	569	Open in IMG/M
3300017438\|Ga0182191_1073267	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	683	Open in IMG/M
3300017438\|Ga0182191_1086784	Not Available	646	Open in IMG/M
3300017442\|Ga0182221_1065887	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	675	Open in IMG/M
3300017442\|Ga0182221_1066119	Not Available	674	Open in IMG/M
3300017442\|Ga0182221_1142857	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	532	Open in IMG/M
3300017442\|Ga0182221_1151371	Not Available	522	Open in IMG/M
3300017443\|Ga0182193_1091654	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria italica	655	Open in IMG/M
3300017443\|Ga0182193_1175219	Not Available	524	Open in IMG/M
3300017443\|Ga0182193_1183364	Not Available	515	Open in IMG/M
3300017680\|Ga0182233_1104194	Not Available	527	Open in IMG/M
3300017681\|Ga0182226_1063692	Not Available	674	Open in IMG/M
3300017683\|Ga0182218_1092298	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	589	Open in IMG/M
3300017683\|Ga0182218_1101266	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	573	Open in IMG/M
3300017683\|Ga0182218_1120132	Not Available	543	Open in IMG/M
3300017683\|Ga0182218_1138468	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	519	Open in IMG/M
3300017683\|Ga0182218_1149352	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	507	Open in IMG/M
3300017684\|Ga0182225_1053299	Not Available	684	Open in IMG/M
3300017684\|Ga0182225_1089306	Not Available	584	Open in IMG/M
3300017684\|Ga0182225_1102073	Not Available	561	Open in IMG/M
3300017684\|Ga0182225_1110533	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	547	Open in IMG/M
3300017684\|Ga0182225_1139344	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	508	Open in IMG/M
3300017685\|Ga0182227_1064027	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	670	Open in IMG/M
3300017685\|Ga0182227_1108625	Not Available	547	Open in IMG/M
3300017686\|Ga0182205_1067536	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	687	Open in IMG/M
3300017686\|Ga0182205_1075981	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	661	Open in IMG/M
3300017686\|Ga0182205_1125915	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	559	Open in IMG/M
3300017689\|Ga0182231_1069085	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	669	Open in IMG/M
3300017690\|Ga0182223_1053280	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	636	Open in IMG/M
3300017690\|Ga0182223_1102966	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	530	Open in IMG/M
3300017690\|Ga0182223_1114076	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	515	Open in IMG/M
3300017690\|Ga0182223_1115797	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	513	Open in IMG/M

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	100.00%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	100.00%

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	97.17%
Rhizosphere	Host-Associated → Plants → Rhizosphere	2.36%
Rhizoplane	Host-Associated → Plants → Rhizoplane	0.47%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	97.17%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	2.36%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	0.47%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	97.17%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	2.36%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	0.47%

Habitat	Taxonomy	Distribution
Miscanthus Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere	96.70%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.42%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.94%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	0.47%
Switchgrass Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere	0.47%

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0068868_1018430252	3300005338	Miscanthus Rhizosphere	RCMTKCFGDLIGRTVEAYMDDIIVKSKQTDQLVADLEQTFRKL*
Ga0105243_131276123	3300009148	Miscanthus Rhizosphere	MLKCFKDLIGKTVEAYKDDIVVKSKQADQLVVDLEQTFMKL*
Ga0105246_123951602	3300011119	Miscanthus Rhizosphere	MLKCFNDLIGQTIEAYVDDIVVKSKWADQVIDDLEQ
Ga0157374_116340133	3300013296	Miscanthus Rhizosphere	MLNCFGDLIGWTIEAYVDDIIVKSKWAGHLVADLEQTFAKL*
Ga0157378_126412211	3300013297	Miscanthus Rhizosphere	MLKCFGDLIEQTIEAYVYDIMVKSKWADHLIADLEQTFAKL*
Ga0157376_122362442	3300014969	Miscanthus Rhizosphere	MLNCFGDLIGWTVEAYVNNIVVKSKRADHLVVDL*
Ga0182122_10618222	3300015267	Miscanthus Phyllosphere	MLKCFGDRIGQTVEAYIDDIVVKSKWANQLIADIEQTFTKL*
Ga0182122_10694443	3300015267	Miscanthus Phyllosphere	CFGDLIRQTVEAYVDDIMVKFKRADQVITDLEQTFAKL*
Ga0182154_10567002	3300015268	Miscanthus Phyllosphere	MTKCFGDLIGQTIEAYVDNIVVKSKYTNQLVADLEQTFRKL
Ga0182113_10821691	3300015269	Miscanthus Phyllosphere	MLKCFGDLIGRTVEAYVDDIMVKSKLVDHLIADLE*
Ga0182113_10940071	3300015269	Miscanthus Phyllosphere	MLKCFKGLIGRTIEAYMDDIVVKSKWADRVIADLE*
Ga0182113_10962771	3300015269	Miscanthus Phyllosphere	MLKCFGNLIGWTIEAYVDDIIVKSEWADHFIADLEQTFAKL*
Ga0182188_10035221	3300015274	Miscanthus Phyllosphere	MLKCFEDLIGRTVEAYADDIVVKSKWADQVNANLEQTFAKL*
Ga0182188_10306541	3300015274	Miscanthus Phyllosphere	MLKCFRDLIRWTVEAYVDDIMVKSKWADHLIADLEQTFAKL*
Ga0182172_10289941	3300015275	Miscanthus Phyllosphere	MLNCFGDLIGRTVEAYIDDIVVKSKRADHLVADLEQTFAKL*
Ga0182172_10382503	3300015275	Miscanthus Phyllosphere	MTKCFGDLIGWTIEAYMDDIVVKSKQTDQLVVDLEQTFRKLQ*
Ga0182172_10715612	3300015275	Miscanthus Phyllosphere	MLRCFGDLIGQTIEAYVDDIVVKSKQVDHLVADLE*
Ga0182170_10104552	3300015276	Miscanthus Phyllosphere	MTKCFGDLIRWTIEAYVDDIVVKSKRTDQLMADLEQTFRKL*
Ga0182170_10329802	3300015276	Miscanthus Phyllosphere	MLKCFRDLIRRTVDAYVDDIVVKSKQANHLIADLEQTFAKL*
Ga0182128_10204302	3300015277	Miscanthus Phyllosphere	DLIGQTIEAYMDDTVVKSKCADQLVADLEQTFAKL*
Ga0182128_10344772	3300015277	Miscanthus Phyllosphere	MLKCFRDLIGQTVEGYVDDIMVKSKWADQVIANLE*
Ga0182128_10401452	3300015277	Miscanthus Phyllosphere	MLNYFGDLIGRTVEAYVDDIVVKSKRAEHLVANLEQTFVKL*
Ga0182128_10588411	3300015277	Miscanthus Phyllosphere	MLKCFGDLIKRTVVAYVDDIMVKSKWTDQLIDDLDRTFMK
Ga0182174_10406231	3300015279	Miscanthus Phyllosphere	LNYFGDLIGWNVEAYVDDIVVKSKWADHLVADLERTFAKL*
Ga0182160_10193842	3300015281	Miscanthus Phyllosphere	MTKCFGDLIRWTIEAYVDDIVVKSKQTDQLVANLE*
Ga0182160_10672591	3300015281	Miscanthus Phyllosphere	LIRWTVEAYVDDIMVKTKQANHLVADLEQTFAKL*
Ga0182160_10787092	3300015281	Miscanthus Phyllosphere	CFGDLIGRTIEAYIDDIVVKSKRADHLVADLEQTFAKL*
Ga0182160_10797942	3300015281	Miscanthus Phyllosphere	MLKSFRDLIRRIVEAYVDDIVVKSKWADHLIADLRQTFVKL*
Ga0182124_10193851	3300015282	Miscanthus Phyllosphere	MLKCFGDLIGQTIEVYVDDIMVKSKWTDQVIADLEQTFTKL*
Ga0182124_10438612	3300015282	Miscanthus Phyllosphere	MLKCFEDLIRWTIEAYIDDIVVKSKPTDQVIANLEQ
Ga0182156_10266292	3300015283	Miscanthus Phyllosphere	MLNCFRDLIGRTVEAYIDDIIVKSKRADHLVDVLEQTFAKL*
Ga0182156_10350932	3300015283	Miscanthus Phyllosphere	MLKCFRDLIGQTVEDYIDDIMVKSKRTDQLVADLEQTFTKLRANGIKL
Ga0182156_10478931	3300015283	Miscanthus Phyllosphere	MLKCFGDLIRQTVEAYINDIVVKSKWANQVVADLEQTFTKL*
Ga0182186_10602123	3300015285	Miscanthus Phyllosphere	CMLKCFGYLIGQTIEAYMDDIVVKFKQANKLIADLEQTFTKL*
Ga0182186_10614132	3300015285	Miscanthus Phyllosphere	VTQVFGEHIRRTIEAYMDDIMVKSKWADQVIADLGQTFTKH*
Ga0182176_10198961	3300015286	Miscanthus Phyllosphere	MLNCFGDLIGWTIEAYVDDIMVKTKWADHHVANLE*
Ga0182176_10606681	3300015286	Miscanthus Phyllosphere	MLKYFGDLIGQTVETYVDDIVVKSKRADQVIADLE*
Ga0182176_10675792	3300015286	Miscanthus Phyllosphere	MLKCFGDLIGWTIEAYMDDIVAKSKRADHLVADLEQTFTKL*
Ga0182171_10431281	3300015287	Miscanthus Phyllosphere	MLKFFGDLIGRTVEAYLDDIEVKSKWADQLVADLE
Ga0182171_10664201	3300015287	Miscanthus Phyllosphere	LLKCFRDLIGQTIEAYMDDIMIKSKQAYQVVADLEQTFTKV*
Ga0182171_10736412	3300015287	Miscanthus Phyllosphere	MLKCFGDLIGQTVEAYVDNIVVKSKWTDQVVADLEQTFTKL*
Ga0182173_10223301	3300015288	Miscanthus Phyllosphere	MLKCFGDLIGRTVEAYVDDIMVKSKWTDQVIGDLDRTFVKL*
Ga0182173_10329951	3300015288	Miscanthus Phyllosphere	MLKCFGDLIGQTVKAYFDDIVVKSKATDQVIADLEQTFTKL*
Ga0182173_10481301	3300015288	Miscanthus Phyllosphere	YQHCMLKCFGNLIRWTIEAYVDNNVVKSKQADHLVADLE*
Ga0182138_10330232	3300015289	Miscanthus Phyllosphere	MLKCFGNLIGQTIEAYVGEIIVKSKHTDELVTDLELTFAKL*
Ga0182138_10539272	3300015289	Miscanthus Phyllosphere	MLKCFGDLIRWTVEAYIDDIVVKSEWADHLVAYLEQTFAKL*
Ga0182138_10799012	3300015289	Miscanthus Phyllosphere	MLKCFGDLIGRTVEAYVNDIVVKSKWADHLVADLEQTFAKL*
Ga0182138_10831101	3300015289	Miscanthus Phyllosphere	MLKCFGDLIRRTIEAYIDDIVVMSKWTDQIIAYLE*
Ga0182125_10605791	3300015291	Miscanthus Phyllosphere	MLKCFGDLIGRTIEAYVDDIMVQSKWADQVVADLGQTFAKL*
Ga0182141_10206602	3300015292	Miscanthus Phyllosphere	MLKCFRDLIGHTIEAYVDDIMVKSKAIDQVVANLEQTFMKL*
Ga0182141_10382051	3300015292	Miscanthus Phyllosphere	MLKCFGDLIRQTIEAYVDDIMVKSKWADQLIADLEQTFVKL*
Ga0182126_10132423	3300015294	Miscanthus Phyllosphere	MLKCFGNLIGRTVEAYVDNIVVKSKWADKLVANLE
Ga0182126_10563321	3300015294	Miscanthus Phyllosphere	KCFGDLIRRTAEAYIDDIVVKSRWADHVVADLEQTFAKL*
Ga0182126_10976041	3300015294	Miscanthus Phyllosphere	MLKCFGDLIERTIEAYVDDIMIKSKWADRLVADLEQTFAKL*
Ga0182175_10135061	3300015295	Miscanthus Phyllosphere	MFRGLIRRTIEAYMDDIVVKSKRADQVIADLEQTFVKF*
Ga0182175_10603092	3300015295	Miscanthus Phyllosphere	MLKCFGDLIGQTVEAYVDDIVVKSKRTDHLIADLE
Ga0182175_10771261	3300015295	Miscanthus Phyllosphere	LKCFGDLIWWTVEAYVDDIVVKSKWADQVITNLEQTFVKL*
Ga0182157_11043582	3300015296	Miscanthus Phyllosphere	FRDLIKRTVEAYVDDIVVKSKWADHLVADLEQTFAKL*
Ga0182106_10085003	3300015298	Miscanthus Phyllosphere	MLKCFRDLIGRTIEAYIDDIVVKSKWADHLMTNLEQTFTKL*
Ga0182106_10177562	3300015298	Miscanthus Phyllosphere	MLKCFRDLIGQTVVAYVDDIVVKSKRADLAVANLEQTFPKTL
Ga0182106_10264741	3300015298	Miscanthus Phyllosphere	FEDLIRRTVEAYIDDIVVKSKQADHLIADLEQTFTKL*
Ga0182106_10704552	3300015298	Miscanthus Phyllosphere	MLKCFGDLIGWIIEGYVDDIVVKSKWAHQVVADLEQTFMKL*
Ga0182106_10957901	3300015298	Miscanthus Phyllosphere	MPKCFEDLIGWIVEAYVDYIMVKSKWADQVVADLE*
Ga0182107_10073691	3300015299	Miscanthus Phyllosphere	CFGDLIRRAVEAYVDDIVVKSKRAGHLVADLEQTFVKL*
Ga0182107_10182583	3300015299	Miscanthus Phyllosphere	MLKCFGDLIRQTVEAYMDDIVVISKWANQVIADLE*
Ga0182107_10975191	3300015299	Miscanthus Phyllosphere	MLKCFRDLIGRTIDAYVDDIVVKSKRADHLIADLEQTFAKL*
Ga0182108_10773001	3300015300	Miscanthus Phyllosphere	MSKCFGDLIRRTIEAYMDDIMIKPKRVDQVIDDLEQTFTKLRANNIK
Ga0182108_10795851	3300015300	Miscanthus Phyllosphere	MLKCFGDLIGWTIEANVDNIVVKSKWADHLITNLEQTFTKL*
Ga0182143_10423911	3300015302	Miscanthus Phyllosphere	CFGDLIGRTVEAYIDDIMVKSKLANHLIADLEQTFMKL*
Ga0182143_10500441	3300015302	Miscanthus Phyllosphere	MLKCFGDLIGQTIKAYVDDIMVKSKWADQLIANLEQTFAKL*
Ga0182143_10839763	3300015302	Miscanthus Phyllosphere	RYMLKCFRGLIRRTIEAYIDDIVVKSKWVDQVIADLE*
Ga0182123_10029551	3300015303	Miscanthus Phyllosphere	MTKCFGDLIGWTIEAYVDDIVVKSKCTNELVTDLELTFMKL*
Ga0182123_10568591	3300015303	Miscanthus Phyllosphere	MTKCFGDLIRQTIEAYVDNIVVKSKQTDQLVADLEQTFR
Ga0182123_10618601	3300015303	Miscanthus Phyllosphere	LKCFGDLIGQTIEAYMDEIVVKSKRADQVIADLEQTVKKL*
Ga0182123_10663341	3300015303	Miscanthus Phyllosphere	MLKCFEDLIGQTIEAYVDDIMVKSKQTDQLIANLE*
Ga0182123_10842652	3300015303	Miscanthus Phyllosphere	MLKCFRDLIKRTVEAYIYHIMVKSKRMDQLIDDLE*
Ga0182123_10989181	3300015303	Miscanthus Phyllosphere	MLKCFRDLLRQTIEAYMYDIVVKSKWADQVVADLEQTFAKL*
Ga0182112_10366082	3300015304	Miscanthus Phyllosphere	MLKCFGNLIGRTIEAYIDDIMVKSEWADHFIADLEQTFAKL*
Ga0182112_10447441	3300015304	Miscanthus Phyllosphere	MLKCFGDLIGRTVGAYIDDIVVKSKRIDQLVDDLE*
Ga0182112_10504112	3300015304	Miscanthus Phyllosphere	GDLIGRTIEAYVDDIMVKSKRADHLVADLEQTFAKL*
Ga0182112_10521302	3300015304	Miscanthus Phyllosphere	MLKCFGDLIGRTVEAYVGDIVVKSKQADQVVADLEQTFTKLRA
Ga0182112_11006131	3300015304	Miscanthus Phyllosphere	MLKSFRDLIGRTVEAYVDDIMVKSKWADQVVADLEQTFAKL*
Ga0182158_10211751	3300015305	Miscanthus Phyllosphere	MLKCFGDLIGWTIEAYVDDIVVKSKWADQVIADLE*
Ga0182158_10494751	3300015305	Miscanthus Phyllosphere	MLNCFEDLIKWTIEAYVDNIMVKSKQANHLVADLEQTFAKL*
Ga0182158_10554921	3300015305	Miscanthus Phyllosphere	MTKCFGDLIRWTIEAYVDDIVVKSKQIDQLVADLE*
Ga0182158_10624102	3300015305	Miscanthus Phyllosphere	MLKCFGDLIEHTVEAYIDDIVVKSKRADHLVADLEQTFAKL*
Ga0182144_10877971	3300015307	Miscanthus Phyllosphere	MDLIGWTVEAYVDDIVVKSKWADQLIADLEQTFVKL*
Ga0182142_10661661	3300015308	Miscanthus Phyllosphere	MLKCFGDLIGRTVVAYVDDIVVKSKWDDQVIANLEQTFTKL*
Ga0182140_10451071	3300015314	Miscanthus Phyllosphere	MLKCFGDLIGRTIEAYIDDIVVKSKWVDQLIADLE*
Ga0182140_10720291	3300015314	Miscanthus Phyllosphere	MTKCFGDLLGRTIEAYMDDIIVKSKQTDQLMVDLEPTFMKL*
Ga0182140_10751072	3300015314	Miscanthus Phyllosphere	RCMLKCFRDLIERTIVAYVGNIGVKCRWADHLVADLEETYAKL*
Ga0182140_10846181	3300015314	Miscanthus Phyllosphere	CILKCLRDLIGRTVEAYVDDIVVKSKWADHLLANLVQTFAKI*
Ga0182140_11020741	3300015314	Miscanthus Phyllosphere	MLKCFGDLIEWTVEAYVDDIVVKSKWADQIVANLEQTFAKL*
Ga0182127_10357621	3300015321	Miscanthus Phyllosphere	MLKCFGDLIGRTIGAYVDDIVVKSKWTDQLVHDLEQTFSKL*
Ga0182127_10576011	3300015321	Miscanthus Phyllosphere	MLKCFRDLIGWTVEAYIDDIIVKSKWANHLVANLE*
Ga0182127_10669022	3300015321	Miscanthus Phyllosphere	MLKCFGDLIGRTVETYVDDILIKSKWADQVIADLEQTFMKL*
Ga0182127_10727932	3300015321	Miscanthus Phyllosphere	MLKCFRDLIGQTIEAYIDDIIVKSKWVDHLIADLE*
Ga0182127_11069131	3300015321	Miscanthus Phyllosphere	MLKCFRDLIGQTFEAYVDDIMVKSKWADHLLANLVQTFAKL*
Ga0182110_10236383	3300015322	Miscanthus Phyllosphere	MLKCFGDLIRWTVEAYVDDIVVKSKQAGHLVANLEQTFAKL*
Ga0182110_10324891	3300015322	Miscanthus Phyllosphere	MIKCFGNLIGRTIEAYMDDIVVRSMQAENLIADLELT
Ga0182110_10586311	3300015322	Miscanthus Phyllosphere	KCFKDLIGWTIEAYVDDIMVKSKWADHLVADLEQTFTKL*
Ga0182110_10935132	3300015322	Miscanthus Phyllosphere	MLKCFGDLIGQTIDAYIDDIMVMSKWADQLVADLEQTFMKL*
Ga0182129_10607881	3300015323	Miscanthus Phyllosphere	MLKCFGDLIERTIEVYVDDIVVKSKWADEVMVDIE*
Ga0182129_10724782	3300015323	Miscanthus Phyllosphere	MLKCFRDLIGRTVEAYVNDIVVKSKRADQVIADLEQTFAKL*
Ga0182129_10760152	3300015323	Miscanthus Phyllosphere	MLRCFGDLIGRTVEAYVDDIVVKSKRADHLVADLKQ
Ga0182135_11555451	3300015329	Switchgrass Phyllosphere	MIKCFGDLIRRTVEAYVNDIVAKTKQAGRLVAGLELTF
Ga0182187_10793573	3300015341	Miscanthus Phyllosphere	MIKCFRDLMGWTVEAYVDNIVVKSKQTDQLMADLEQTFKKL*
Ga0182187_11002703	3300015341	Miscanthus Phyllosphere	CCMPKCFEDLIGWIVEAYVDYIMVKSKWADQVVADLE*
Ga0182187_11142171	3300015341	Miscanthus Phyllosphere	MLKCFGDLIWRTVEANVDDIVVKSKQADHLVADLEQTFAKL*
Ga0182187_11281583	3300015341	Miscanthus Phyllosphere	MLKCFGDLIGRTVAAYVDNIVVKSKWADHLIADLEQTFAKL*
Ga0182187_11846692	3300015341	Miscanthus Phyllosphere	MTKCFGDLIERTVEAYVDNIVVKSKQTNQLMADLE*
Ga0182155_10321092	3300015343	Miscanthus Phyllosphere	MLKCFGDLIGRTVEAYVDDIGVKSKWTDQLVDDLE*
Ga0182155_10615612	3300015343	Miscanthus Phyllosphere	MTKCFGDLLGRTVEAYMDDIIVKSKQTDQLMVDLEPTFMKL*
Ga0182155_11081132	3300015343	Miscanthus Phyllosphere	MLKYFRDLIGQTVEAYMDDIVVKSKWANQIIANLEQTFAKL*
Ga0182155_11304991	3300015343	Miscanthus Phyllosphere	MLKCFKDLIRRTIEAYVDDIVVKSKWADQVMVNLEQTFMKL*
Ga0182155_11425301	3300015343	Miscanthus Phyllosphere	MLKCFGDLIGRTIEAYIDDIVVKSKRADHLIADLE*
Ga0182189_10369312	3300015344	Miscanthus Phyllosphere	MLKCFGDLIGQTIEAYVDNIMIKSKRADQLIADLKQTFVIL*
Ga0182189_11003902	3300015344	Miscanthus Phyllosphere	MLKCFGDLIGRTIEAYVDNIMVKSKRADQLVADLEQTFAKL*
Ga0182189_11177662	3300015344	Miscanthus Phyllosphere	MPKCFGDLIGETIKAYVDDIVVKTKRANQLMADLKRTFEKL*
Ga0182189_11324111	3300015344	Miscanthus Phyllosphere	MLKCFGNLIGQTIEAYVGEIIVKSKHTDELVTDLELTFVKL*
Ga0182189_11487352	3300015344	Miscanthus Phyllosphere	MLKCFGNLIGRTIEAYMDDIVVRSMQAENLIADLELTFERLKKYCIKLN
Ga0182189_11909701	3300015344	Miscanthus Phyllosphere	MTKCFGDLIRQTVEAYVDDIVVKTKQTIQLMANLEQTFKKL*
Ga0182189_12092121	3300015344	Miscanthus Phyllosphere	MLRCFGDLIGWTIEAYIDDIVVKSKRVDHLVADLEQTFTKL*
Ga0182189_12099511	3300015344	Miscanthus Phyllosphere	LRCFGDLIGWTVEAYVDNIIVMSKRADHLVANLEQTFAKL*
Ga0182111_10409823	3300015345	Miscanthus Phyllosphere	MLKCFRDLIRRTVEAYVDNIMVKSKWANRLVANLE
Ga0182111_11177821	3300015345	Miscanthus Phyllosphere	MLKCFGDLIGRTIEAYVDDIVVKSKWVDQVVADLE*
Ga0182111_12054732	3300015345	Miscanthus Phyllosphere	FEDLIKWTIEAYVDNIMVKSKQANHLVADLEQTFAKL*
Ga0182111_12304941	3300015345	Miscanthus Phyllosphere	MLRCFGDLIGRTVGAYVDDIVVKSKWDDHLVADLEQTF
Ga0182111_12448131	3300015345	Miscanthus Phyllosphere	MLKCFGELIGQTVEAYVDDIMVKSKLTDQVIADLE*
Ga0182139_11690942	3300015346	Miscanthus Phyllosphere	MLKCFRDLIGQTVEAYVDDIVVKSKQADQVVANLE*
Ga0182139_12407381	3300015346	Miscanthus Phyllosphere	MLKCFDDLIRPTIEAYIDDIVVKSKQANHLITDLEQTFTKL*
Ga0182139_12445192	3300015346	Miscanthus Phyllosphere	MLRCFGDLIGETVEAYVDDIVVKSKRADQLVADLE
Ga0182177_11939011	3300015347	Miscanthus Phyllosphere	MLKCFGNLIGRTIEAYVDDIVVRSMQAKNLIADLELTF
Ga0182177_12122612	3300015347	Miscanthus Phyllosphere	MPNYFGGLIGRIIEVYVDDIIVKSKRADHLIADLKQTFTKL
Ga0182177_12303232	3300015347	Miscanthus Phyllosphere	MLKCFRDLIRQTIEAYVDDIMVKSKWTDQVIAGLEQTFVKL*
Ga0182161_10780402	3300015351	Miscanthus Phyllosphere	MLKCFGDLIGQTVEAYIDDIMVKSKQADHLVTDLKQTFTKL*
Ga0182161_10961371	3300015351	Miscanthus Phyllosphere	MLKCFGGLIGRTIKAYMDDIVVKSKRVDQVIADLEQTFTKL*
Ga0182161_12473441	3300015351	Miscanthus Phyllosphere	MLKCFRDLIEWTVEAYVDDIVVKSNWADHLIANLEQTFTKL*
Ga0182161_12548311	3300015351	Miscanthus Phyllosphere	YQHCMLKCFGDLIRWTIEAYVDDIMVKSKWADQLIANLEQTFTKL*
Ga0182159_11182601	3300015355	Miscanthus Phyllosphere	MLKCFGNLIDQIVEAYVDDIVVKSKCTDELVTDLELTFAKL*
Ga0182159_11547802	3300015355	Miscanthus Phyllosphere	CMLKCFGDLIGRTIEAYVDDIMVKSKPIDQVIADLE*
Ga0182159_12345622	3300015355	Miscanthus Phyllosphere	MLKCFGDLIRRTVEAYVDDIVVKSKLVDHLIADLE*
Ga0182159_12419291	3300015355	Miscanthus Phyllosphere	MVKCFRDLIGRIVEAYVDDIMVKFKWANQVVANLEQTLVKL*
Ga0182159_12580411	3300015355	Miscanthus Phyllosphere	MLKCFEDLIGWTIEAYVDDIVVKSKWADHLVANSEQTFAKL*
Ga0182159_12580952	3300015355	Miscanthus Phyllosphere	MLKCFRDLIGQTVEAYVDDIMVKSKWANQVTADLEQTFAKL*
Ga0182159_12912022	3300015355	Miscanthus Phyllosphere	MLKCFRDLIVWTVEAYIDDIMVKSKWADQVMADLEQTFVKL*
Ga0182159_13053242	3300015355	Miscanthus Phyllosphere	MLNCFGDLIGQTVEAYVNNIVVKSKQADHLVADLE*
Ga0182145_11807793	3300015361	Miscanthus Phyllosphere	LKCFGDLIGRTVEAYIDDIMVKSKWVDHLVVDLEQTFAKL*
Ga0182145_11829001	3300015361	Miscanthus Phyllosphere	MLKCFGDVIGWTIEAYIDNIVVKSKWADQLIADLE*
Ga0182203_10863572	3300017404	Miscanthus Phyllosphere	DLIWRTVEAYLDDIMVKSKQANHLIADLELTFAKL
Ga0182203_11486221	3300017404	Miscanthus Phyllosphere	QHCMLNCFGDLIRRTIEVYVDDIIVKSKQTDHLVADLEQTFAKL
Ga0182220_10575821	3300017407	Miscanthus Phyllosphere	MLKCFGDLIRQTVEAYVDDIVVKTKWADQLVADLEQTSMKL
Ga0182220_10821871	3300017407	Miscanthus Phyllosphere	KCFRDLIGWTVEAYVDHIVVKSKWADHLVADLEQTFVKL
Ga0182204_10386792	3300017409	Miscanthus Phyllosphere	CMLKCFGDLIGRTVEAYVDDIMVKSKHADQVIADLGQTFMKL
Ga0182207_10768462	3300017410	Miscanthus Phyllosphere	MLKCFGDLIRQTVEAYINDIVVKSKWANQVVADLEQTFTKL
Ga0182207_11136341	3300017410	Miscanthus Phyllosphere	MLKCFGDLIGRTVEAYVDDIMVKSKLVDHLIADLE
Ga0182207_11177101	3300017410	Miscanthus Phyllosphere	TYQCCMLKCFGDLIGQTIDAYMDDIMVKSKWVDQLIADLEQTFAKL
Ga0182208_10892942	3300017411	Miscanthus Phyllosphere	MLKCFGDLIGQTVEAYVDNIVVRSKWADQLIANLEQTFTKL
Ga0182208_11165652	3300017411	Miscanthus Phyllosphere	MLKCFKDLIGRTVEAYIDDIVVKSKWVDHVVTDLEQTFAKL
Ga0182222_10540351	3300017413	Miscanthus Phyllosphere	MLKCFRDLIGRTVEAYMDDIVVKSKRDDQVIADLEQTFVKL
Ga0182222_10938241	3300017413	Miscanthus Phyllosphere	MLKCFEDLIGQTIEAYVDDIVVKSKWANQVIADLEQTFSKL
Ga0182202_10855781	3300017415	Miscanthus Phyllosphere	RCMLNCFRDLIGRTIEDYVDDIIVKSKWADHLVVDLEQTFAKL
Ga0182202_11038983	3300017415	Miscanthus Phyllosphere	YQCCMLKCFGDLIGETVETNVDDIVVKSKRADQVISDLEQTIVKL
Ga0182230_10521841	3300017417	Miscanthus Phyllosphere	MLKCFRDLIGRTIEAYVDNIVVKSKQADHLVADLEQTFSKL
Ga0182228_10574383	3300017420	Miscanthus Phyllosphere	FGDLIGRTVESYVDDIVVKSKQVDQLVADLEQTFTKL
Ga0182228_10842212	3300017420	Miscanthus Phyllosphere	MLKCFGDLIGRTVEAYVGDIVVKSKQADQVVADLEQTFAKL
Ga0182219_10396411	3300017424	Miscanthus Phyllosphere	MLKCFRDLIGQTIEAYVDDIVVKSKWADQVIADLE
Ga0182219_10996371	3300017424	Miscanthus Phyllosphere	DLIGRTVEAYVDNIVVKSKQTDQLMADLEQTFKKL
Ga0182219_11222373	3300017424	Miscanthus Phyllosphere	CCMLKCFGDLIGQIVDACMDDIVVKSKWVDQLIADLEQTFAKL
Ga0182219_11234252	3300017424	Miscanthus Phyllosphere	LKCLEDLIEQTIEAYIDDIVVKSKWADQVVANLDQTFVKL
Ga0182219_11291372	3300017424	Miscanthus Phyllosphere	MLKCFGNLIGRTVEAYVDDIVVKSKLADHLIANLE
Ga0182219_11362941	3300017424	Miscanthus Phyllosphere	DLIGRTVDAYVDDIMVKSKQVEHLVANLEQTFAKL
Ga0182224_10384702	3300017425	Miscanthus Phyllosphere	MLKYFGYLIRRTIEAYVDDIVVMYKWADQVVADLEQTFTKL
Ga0182224_10452012	3300017425	Miscanthus Phyllosphere	MLKCFKDLIGQTVEAYKDDIVVKSKQADQLVVDLEQTFVKL
Ga0182224_10563982	3300017425	Miscanthus Phyllosphere	MLKCFGNLIGQTVEAYVDDIVVKSKHTDKLVTDHELTFTKL
Ga0182224_11202661	3300017425	Miscanthus Phyllosphere	YMLKCFGDLIGQTVEAYMDDIMVKSKWVDQVIVDLNRPS
Ga0182190_10737072	3300017427	Miscanthus Phyllosphere	LGGPETNLCGDLIERTIEAYVDDIVVKSKQTNQLVADLEQTFRKL
Ga0182190_11478322	3300017427	Miscanthus Phyllosphere	MTKCFGDLIGRTVEAYVDDIVVKSKQIDQLMADLE
Ga0182192_10415722	3300017430	Miscanthus Phyllosphere	MLKCFGDLIGRTVGAYIDDIVVKSKWTDQLVVDLE
Ga0182206_11010852	3300017433	Miscanthus Phyllosphere	MLKCFGDLIGWTVEAYVDDIVVKSNWADQVVADLE
Ga0182209_11192112	3300017436	Miscanthus Phyllosphere	CFGNLVGQTIEAYVDEIIVKSKHTNELVTDLELTFVKL
Ga0182191_10732671	3300017438	Miscanthus Phyllosphere	MLKCFRDLIGRTIETYVDDIVVKSKWADQVIADLE
Ga0182191_10867841	3300017438	Miscanthus Phyllosphere	MLKCFEDLIGRTIEAYIDDIVVKSKCANQVIADLEQTFTKL
Ga0182221_10658872	3300017442	Miscanthus Phyllosphere	MFRGLIGRTIEAYVDDIMVKSKRADQVIADLEQTFAKL
Ga0182221_10661191	3300017442	Miscanthus Phyllosphere	LKCFGDLIGQTIEAYMDDIVVKSKWADQVVADLEQTFAKL
Ga0182221_11428572	3300017442	Miscanthus Phyllosphere	LKCFRDLIGRTIKAYVDDIVVKSKRANHLIADLEQTFTKL
Ga0182221_11513711	3300017442	Miscanthus Phyllosphere	KCFRDLIRRTIKAYVDDIVVKSKQINQLMTDLEQTFNKL
Ga0182193_10916541	3300017443	Miscanthus Phyllosphere	MLKYFGNLIGQTIEAYVDDIVVKSKRTDQLMADLEQTFRKL
Ga0182193_11752191	3300017443	Miscanthus Phyllosphere	MLKCFGDLIGQTIYAYVDDIMVNSKWVDQVIADLEQTFTKL
Ga0182193_11833641	3300017443	Miscanthus Phyllosphere	QRYMLKCFGDLIRQTIEAYVGDIVVKSKQADQVIADLEQTFAKL
Ga0182233_11041941	3300017680	Miscanthus Phyllosphere	MLRCFGDLIGWTIEAYIDDIIVKSKWADHLIADLE
Ga0182226_10636922	3300017681	Miscanthus Phyllosphere	MLKCFGDLIGWTVEAYIDDIVVKSKWANHLVANLKQTFAKL
Ga0182218_10922982	3300017683	Miscanthus Phyllosphere	MLKCFGDLIGRTIKAYVDDIMVKSKRVDQVVADLEQTFAKL
Ga0182218_11012662	3300017683	Miscanthus Phyllosphere	LGGPETNLCGDLIERTIEAYVDDIIVKSKQTDQLVADLEQTFRKL
Ga0182218_11201321	3300017683	Miscanthus Phyllosphere	MLKCFGDLIRQIIEAYVDDIMVKSKWADQLIADLEQTFAKL
Ga0182218_11384682	3300017683	Miscanthus Phyllosphere	MLKCFEDLIGRTVEANVDDIVVKSKRANQLIADLE
Ga0182218_11493523	3300017683	Miscanthus Phyllosphere	MLKCFRDHIGRTVEAYVDDIMVKSKWVGHLVADLEQTFTKL
Ga0182225_10532991	3300017684	Miscanthus Phyllosphere	MTKCFGDLLGRTIEAYMDDIIVKSKQTDQLMVDLEPTFMKL
Ga0182225_10893062	3300017684	Miscanthus Phyllosphere	YQCCMLKCFRDLIRQTIEAYIDDIVVKSKWADQVIADLEQTFMKL
Ga0182225_11020731	3300017684	Miscanthus Phyllosphere	MLKCFGDIIGWTIEAYIDDIVVKSKPADQVMADLE
Ga0182225_11105331	3300017684	Miscanthus Phyllosphere	QRSMLKCFGDVIGWIVEDYMDDIVVKSKWADQLVADLEQTFAKL
Ga0182225_11393442	3300017684	Miscanthus Phyllosphere	FRNLIEQTVEANVDNIVVKSKWANHLIADLGQTFVKL
Ga0182227_10640271	3300017685	Miscanthus Phyllosphere	MLKCFGDLIGRTVDAYVDDIVVKSKRADQVIADLK
Ga0182227_11086251	3300017685	Miscanthus Phyllosphere	MLKCFGDLIERTVEANINDIMVKSKQADHLIADLEQTFAKL
Ga0182205_10675361	3300017686	Miscanthus Phyllosphere	MLRCFRDLIGRTVEAYIDDIVVKSKWADLLIADLEQTFAKL
Ga0182205_10759812	3300017686	Miscanthus Phyllosphere	MTKCFGDLIRRTVEAYVDDIVAKSKRTDQLMADLEQTFRKL
Ga0182205_11259152	3300017686	Miscanthus Phyllosphere	MLKCFEDLIRRTVEAYVDDIMVKSKWADLVIADLEQTFAKL
Ga0182231_10690852	3300017689	Miscanthus Phyllosphere	MLKCFRDLIGWTVDAYVDDIVVKSKRADHLVADLEQTFAKL
Ga0182223_10532802	3300017690	Miscanthus Phyllosphere	MLKCFGDLIERTIEAYVDDIMVKSKWVDHLVADLE
Ga0182223_11029661	3300017690	Miscanthus Phyllosphere	MLKCFGDLIGWTIEAYIDNIVVKSKWADQLIANLE
Ga0182223_11140762	3300017690	Miscanthus Phyllosphere	MLNYFGDLIRRTIEAYIDDIVVKSKQADHLVADLEKTFAKL
Ga0182223_11157971	3300017690	Miscanthus Phyllosphere	FKDLIGWTIEAYVDDIVVKSKRANHLVADLEQTFEKL

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.58
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.58
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F022805

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Host-Associated	Open in IMG/M
3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Host-Associated	Open in IMG/M
3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Host-Associated	Open in IMG/M
3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Host-Associated	Open in IMG/M
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated	Open in IMG/M
3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Host-Associated	Open in IMG/M
3300015267	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015268	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015269	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015274	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015275	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015276	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015277	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015279	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015281	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015282	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015283	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015285	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015286	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015287	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015288	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015289	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015291	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015292	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015294	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015295	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015296	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015298	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015299	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015300	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015302	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015303	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015304	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015305	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015307	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015308	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015314	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015321	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015322	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015323	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015329	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015341	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015343	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015344	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015345	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015346	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015347	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015351	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015355	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015361	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300017404	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017407	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017409	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017410	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017411	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017413	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017415	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017417	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017420	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017424	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017425	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017427	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017430	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017433	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017436	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017438	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017442	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017443	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017680	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017681	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017683	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017684	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017685	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017686	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017689	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017690	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign