NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F022902

Metagenome / Metatranscriptome Family F022902

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F022902
Family Type Metagenome / Metatranscriptome
Number of Sequences 212
Average Sequence Length 49 residues
Representative Sequence VRNTGWVSIGRTGFSHAPIVQVTVAQQAKPEVDLISIAATFERAGVNV
Number of Associated Samples 150
Number of Associated Scaffolds 212

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.96 %
% of genes near scaffold ends (potentially truncated) 94.81 %
% of genes from short scaffolds (< 2000 bps) 94.34 %
Associated GOLD sequencing projects 132
AlphaFold2 3D model prediction Yes
3D model pTM-score0.26

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (72.642 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(13.207 % of family members)
Environment Ontology (ENVO) Unclassified
(55.660 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(58.491 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 0.00%    Coil/Unstructured: 100.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.26
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 212 Family Scaffolds
PF13884Peptidase_S74 1.42
PF08840BAAT_C 0.47
PF02321OEP 0.47
PF12680SnoaL_2 0.47
PF02837Glyco_hydro_2_N 0.47
PF00263Secretin 0.47
PF13520AA_permease_2 0.47

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 212 Family Scaffolds
COG1538Outer membrane protein TolCCell wall/membrane/envelope biogenesis [M] 0.94
COG3250Beta-galactosidase/beta-glucuronidaseCarbohydrate transport and metabolism [G] 0.47


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms73.11 %
UnclassifiedrootN/A26.89 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2162886012|MBSR1b_contig_3035298All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium902Open in IMG/M
2170459002|F0B48LX02J3ZO0All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium527Open in IMG/M
2170459006|GBPF9FW01BGO2GAll Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium502Open in IMG/M
2170459010|GIO7OMY01C5AM1Not Available530Open in IMG/M
3300002244|JGI24742J22300_10029824Not Available950Open in IMG/M
3300002244|JGI24742J22300_10043294All Organisms → cellular organisms → Bacteria805Open in IMG/M
3300004114|Ga0062593_103403958All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300004463|Ga0063356_102041719All Organisms → cellular organisms → Bacteria → Proteobacteria868Open in IMG/M
3300005148|Ga0066819_1007603All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium724Open in IMG/M
3300005330|Ga0070690_100981640All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium665Open in IMG/M
3300005331|Ga0070670_100399172All Organisms → cellular organisms → Bacteria1214Open in IMG/M
3300005340|Ga0070689_102113928All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium515Open in IMG/M
3300005347|Ga0070668_100207803All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium1609Open in IMG/M
3300005353|Ga0070669_101284410All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium633Open in IMG/M
3300005354|Ga0070675_101403685Not Available644Open in IMG/M
3300005355|Ga0070671_101738864Not Available554Open in IMG/M
3300005356|Ga0070674_100724032All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales852Open in IMG/M
3300005356|Ga0070674_100901926All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium770Open in IMG/M
3300005364|Ga0070673_101137539All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria730Open in IMG/M
3300005365|Ga0070688_100320261All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → unclassified Methylobacterium → Methylobacterium sp. WL121126Open in IMG/M
3300005365|Ga0070688_101482823All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium551Open in IMG/M
3300005457|Ga0070662_100387960All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium1151Open in IMG/M
3300005459|Ga0068867_102345989Not Available507Open in IMG/M
3300005544|Ga0070686_100301642All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium1188Open in IMG/M
3300005578|Ga0068854_100507259All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium1017Open in IMG/M
3300005616|Ga0068852_101192465All Organisms → cellular organisms → Bacteria782Open in IMG/M
3300005618|Ga0068864_100816372Not Available917Open in IMG/M
3300005618|Ga0068864_100846055All Organisms → cellular organisms → Bacteria901Open in IMG/M
3300005618|Ga0068864_101609741All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium653Open in IMG/M
3300005618|Ga0068864_102020322All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium583Open in IMG/M
3300005719|Ga0068861_100283612All Organisms → cellular organisms → Bacteria1427Open in IMG/M
3300005719|Ga0068861_100765312All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium903Open in IMG/M
3300005842|Ga0068858_100675748All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae1004Open in IMG/M
3300005843|Ga0068860_101856180All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium624Open in IMG/M
3300005844|Ga0068862_102225227All Organisms → cellular organisms → Bacteria560Open in IMG/M
3300006031|Ga0066651_10012514All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3482Open in IMG/M
3300006048|Ga0075363_100573770All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium674Open in IMG/M
3300006237|Ga0097621_100569901All Organisms → cellular organisms → Bacteria1032Open in IMG/M
3300006237|Ga0097621_102064839All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300006237|Ga0097621_102258819All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium520Open in IMG/M
3300006358|Ga0068871_100957193All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium796Open in IMG/M
3300006358|Ga0068871_102027764All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300006358|Ga0068871_102114132All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium536Open in IMG/M
3300006604|Ga0074060_10942931All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales897Open in IMG/M
3300006606|Ga0074062_13019317All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium750Open in IMG/M
3300006871|Ga0075434_101825757Not Available614Open in IMG/M
3300006881|Ga0068865_100582932All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae943Open in IMG/M
3300009081|Ga0105098_10378872Not Available697Open in IMG/M
3300009094|Ga0111539_10326730All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium1785Open in IMG/M
3300009094|Ga0111539_12572511All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium590Open in IMG/M
3300009098|Ga0105245_10387019All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → unclassified Methylobacterium → Methylobacterium sp. WL121394Open in IMG/M
3300009098|Ga0105245_10756644All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium1008Open in IMG/M
3300009098|Ga0105245_10797105All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium982Open in IMG/M
3300009098|Ga0105245_10813914Not Available973Open in IMG/M
3300009098|Ga0105245_11857018All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium655Open in IMG/M
3300009098|Ga0105245_12438368All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium576Open in IMG/M
3300009148|Ga0105243_12374682All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium568Open in IMG/M
3300009156|Ga0111538_11172687Not Available971Open in IMG/M
3300009156|Ga0111538_12670005Not Available626Open in IMG/M
3300009156|Ga0111538_13403551All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium553Open in IMG/M
3300009176|Ga0105242_10204148All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium1757Open in IMG/M
3300009176|Ga0105242_11166977All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium788Open in IMG/M
3300009176|Ga0105242_12272314All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium588Open in IMG/M
3300009176|Ga0105242_13174264Not Available510Open in IMG/M
3300009177|Ga0105248_11622338Not Available733Open in IMG/M
3300009177|Ga0105248_12475137All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium591Open in IMG/M
3300009177|Ga0105248_13317487All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium512Open in IMG/M
3300009551|Ga0105238_10002586All Organisms → cellular organisms → Bacteria18035Open in IMG/M
3300009551|Ga0105238_12313173All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium573Open in IMG/M
3300009610|Ga0105340_1258180All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium749Open in IMG/M
3300009678|Ga0105252_10571300All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium522Open in IMG/M
3300010362|Ga0126377_10728616All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium1046Open in IMG/M
3300011119|Ga0105246_11829086All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium581Open in IMG/M
3300011119|Ga0105246_12510952All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium507Open in IMG/M
3300011400|Ga0137312_1013452Not Available1071Open in IMG/M
3300011400|Ga0137312_1014292Not Available1050Open in IMG/M
3300011400|Ga0137312_1024219All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium885Open in IMG/M
3300011415|Ga0137325_1027807All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium1145Open in IMG/M
3300011422|Ga0137425_1098464All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium707Open in IMG/M
3300011430|Ga0137423_1191758All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium614Open in IMG/M
3300011439|Ga0137432_1187541All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium669Open in IMG/M
3300011442|Ga0137437_1174747All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium745Open in IMG/M
3300012159|Ga0137344_1044060All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium781Open in IMG/M
3300012891|Ga0157305_10034375Not Available1006Open in IMG/M
3300012896|Ga0157303_10069722All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium777Open in IMG/M
3300012898|Ga0157293_10125218All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium695Open in IMG/M
3300012899|Ga0157299_10289338All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium537Open in IMG/M
3300012901|Ga0157288_10124319Not Available736Open in IMG/M
3300012903|Ga0157289_10021072Not Available1424Open in IMG/M
3300012903|Ga0157289_10077141All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium906Open in IMG/M
3300012905|Ga0157296_10254579All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium591Open in IMG/M
3300012908|Ga0157286_10405692Not Available530Open in IMG/M
3300012909|Ga0157290_10391894All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium540Open in IMG/M
3300012913|Ga0157298_10368699All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium535Open in IMG/M
3300012913|Ga0157298_10379754All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium531Open in IMG/M
3300013297|Ga0157378_11425670All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia736Open in IMG/M
3300013306|Ga0163162_10685266Not Available1147Open in IMG/M
3300013308|Ga0157375_10320190All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium1715Open in IMG/M
3300013308|Ga0157375_11251459Not Available871Open in IMG/M
3300014325|Ga0163163_10757909All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium1034Open in IMG/M
3300014325|Ga0163163_12342044All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium593Open in IMG/M
3300014325|Ga0163163_12762573Not Available548Open in IMG/M
3300014326|Ga0157380_11916663All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium653Open in IMG/M
3300014326|Ga0157380_12424886All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium590Open in IMG/M
3300014326|Ga0157380_13343114All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria513Open in IMG/M
3300014968|Ga0157379_10633372Not Available1000Open in IMG/M
3300014969|Ga0157376_10038293All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3900Open in IMG/M
3300014969|Ga0157376_11649586Not Available676Open in IMG/M
3300015200|Ga0173480_10519070Not Available717Open in IMG/M
3300015201|Ga0173478_10024276All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium1763Open in IMG/M
3300015371|Ga0132258_12194883Not Available1386Open in IMG/M
3300015374|Ga0132255_101915268All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium902Open in IMG/M
3300016270|Ga0182036_11090438Not Available661Open in IMG/M
3300017792|Ga0163161_10220169All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium1470Open in IMG/M
3300017792|Ga0163161_11013054Not Available709Open in IMG/M
3300017792|Ga0163161_11739001Not Available553Open in IMG/M
3300018067|Ga0184611_1317596All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium539Open in IMG/M
3300018067|Ga0184611_1347776Not Available509Open in IMG/M
3300018067|Ga0184611_1353908All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium503Open in IMG/M
3300018072|Ga0184635_10332087All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium588Open in IMG/M
3300018073|Ga0184624_10351036All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium660Open in IMG/M
3300018073|Ga0184624_10523040All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium514Open in IMG/M
3300018081|Ga0184625_10284132All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium866Open in IMG/M
3300018083|Ga0184628_10169206All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium1140Open in IMG/M
3300018083|Ga0184628_10279164All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium878Open in IMG/M
3300018476|Ga0190274_11474011All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium771Open in IMG/M
3300018476|Ga0190274_11532870All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium758Open in IMG/M
3300018481|Ga0190271_11830490Not Available719Open in IMG/M
3300018481|Ga0190271_12382171All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium633Open in IMG/M
3300019361|Ga0173482_10081894All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1131Open in IMG/M
3300020009|Ga0193740_1012718Not Available1348Open in IMG/M
3300020016|Ga0193696_1071694All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium902Open in IMG/M
3300021363|Ga0193699_10331226All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium634Open in IMG/M
3300021475|Ga0210392_10973318Not Available635Open in IMG/M
3300022893|Ga0247787_1064062All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium555Open in IMG/M
3300022899|Ga0247795_1001236All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales4289Open in IMG/M
3300022911|Ga0247783_1200986All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium571Open in IMG/M
3300022915|Ga0247790_10080036All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium785Open in IMG/M
3300022915|Ga0247790_10191803Not Available540Open in IMG/M
3300022917|Ga0247777_1170475All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium710Open in IMG/M
3300023067|Ga0247743_1002584All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium2036Open in IMG/M
3300023079|Ga0247758_1147872Not Available649Open in IMG/M
3300024254|Ga0247661_1023443All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium1086Open in IMG/M
3300024254|Ga0247661_1094490All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium564Open in IMG/M
3300024283|Ga0247670_1097277All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium543Open in IMG/M
3300024286|Ga0247687_1060994All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium572Open in IMG/M
3300024310|Ga0247681_1004681All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium1707Open in IMG/M
3300024310|Ga0247681_1050973All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium635Open in IMG/M
3300025899|Ga0207642_10349930All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium871Open in IMG/M
3300025905|Ga0207685_10189127Not Available960Open in IMG/M
3300025914|Ga0207671_10119009Not Available2017Open in IMG/M
3300025925|Ga0207650_10526892All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium989Open in IMG/M
3300025926|Ga0207659_10453118All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → unclassified Methylobacterium → Methylobacterium sp. WL121081Open in IMG/M
3300025927|Ga0207687_11170803All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium661Open in IMG/M
3300025927|Ga0207687_11390315All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium603Open in IMG/M
3300025928|Ga0207700_11247319Not Available663Open in IMG/M
3300025930|Ga0207701_10160626All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium1989Open in IMG/M
3300025930|Ga0207701_10524801All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium1012Open in IMG/M
3300025931|Ga0207644_11327620All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium604Open in IMG/M
3300025934|Ga0207686_11575595All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium542Open in IMG/M
3300025937|Ga0207669_10162555All Organisms → Viruses → Predicted Viral1579Open in IMG/M
3300025937|Ga0207669_11086680All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium675Open in IMG/M
3300025938|Ga0207704_10841999All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium768Open in IMG/M
3300025938|Ga0207704_11893728All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium513Open in IMG/M
3300025940|Ga0207691_10109782Not Available2454Open in IMG/M
3300025941|Ga0207711_10711015All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium937Open in IMG/M
3300025960|Ga0207651_11015959All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium741Open in IMG/M
3300025960|Ga0207651_11046247All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium730Open in IMG/M
3300025960|Ga0207651_11491094All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium609Open in IMG/M
3300025960|Ga0207651_11962986All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium526Open in IMG/M
3300025961|Ga0207712_11028272All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium732Open in IMG/M
3300025972|Ga0207668_10116983Not Available2011Open in IMG/M
3300026023|Ga0207677_11420493All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium639Open in IMG/M
3300026078|Ga0207702_10736736All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium972Open in IMG/M
3300026088|Ga0207641_10722276All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium982Open in IMG/M
3300026089|Ga0207648_11950454Not Available549Open in IMG/M
3300026089|Ga0207648_12167969All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium516Open in IMG/M
3300026095|Ga0207676_11191506All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium755Open in IMG/M
3300026118|Ga0207675_100982150Not Available862Open in IMG/M
3300026118|Ga0207675_101151245All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria796Open in IMG/M
3300026118|Ga0207675_101784507All Organisms → cellular organisms → Bacteria → Acidobacteria634Open in IMG/M
3300026121|Ga0207683_10199321All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1819Open in IMG/M
3300026121|Ga0207683_10206082All Organisms → cellular organisms → Bacteria1788Open in IMG/M
3300026121|Ga0207683_10333925All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1389Open in IMG/M
3300026929|Ga0207461_1013716All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium504Open in IMG/M
3300027523|Ga0208890_1051123All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium655Open in IMG/M
3300027533|Ga0208185_1075723Not Available797Open in IMG/M
3300027821|Ga0209811_10024974All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium1972Open in IMG/M
3300027874|Ga0209465_10253897All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium880Open in IMG/M
3300027907|Ga0207428_10713272Not Available717Open in IMG/M
3300028281|Ga0247689_1010470All Organisms → cellular organisms → Bacteria1173Open in IMG/M
3300028293|Ga0247662_1002824All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium2435Open in IMG/M
3300028380|Ga0268265_10854695All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium890Open in IMG/M
3300028704|Ga0307321_1121753Not Available541Open in IMG/M
3300028790|Ga0307283_10246079All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium524Open in IMG/M
3300028803|Ga0307281_10202660Not Available715Open in IMG/M
3300028812|Ga0247825_11250625Not Available542Open in IMG/M
3300028889|Ga0247827_11276984Not Available512Open in IMG/M
3300031226|Ga0307497_10128282All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium1026Open in IMG/M
3300031226|Ga0307497_10168654All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium924Open in IMG/M
3300031455|Ga0307505_10287501Not Available769Open in IMG/M
3300031547|Ga0310887_10541057All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium707Open in IMG/M
3300031740|Ga0307468_100652348All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium870Open in IMG/M
3300031793|Ga0318548_10332860Not Available745Open in IMG/M
3300031799|Ga0318565_10166595Not Available1070Open in IMG/M
3300032060|Ga0318505_10184061Not Available975Open in IMG/M
3300032067|Ga0318524_10763336Not Available511Open in IMG/M
3300032205|Ga0307472_102541083Not Available521Open in IMG/M
3300034149|Ga0364929_0089959All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium960Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil13.21%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere8.02%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere7.08%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil6.13%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil5.66%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere5.66%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment4.72%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere3.77%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere3.30%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere3.30%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere2.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.36%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere2.36%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere2.36%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.36%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.89%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.89%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.89%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil1.42%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.42%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.42%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter1.42%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.42%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere1.42%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere1.42%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.42%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.94%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.94%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.94%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.94%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.94%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.47%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.47%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.47%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.47%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.47%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.47%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.47%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere0.47%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.47%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere0.47%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.47%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2162886012Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1Host-AssociatedOpen in IMG/M
2170459002Grass soil microbial communities from Rothamsted Park, UK - March 2009 direct MP BIO 1O1 lysis 0-21 cmEnvironmentalOpen in IMG/M
2170459006Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect in plug lysis (for fosmid construction) 0-10cmEnvironmentalOpen in IMG/M
2170459010Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!)EnvironmentalOpen in IMG/M
3300002244Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1Host-AssociatedOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300005148Soil and rhizosphere microbial communities from Laval, Canada - mgLMAEnvironmentalOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005365Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaGEnvironmentalOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006048Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3Host-AssociatedOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006604Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006606Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300009081Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015EnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009610Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700EnvironmentalOpen in IMG/M
3300009678Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300011400Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT133_2EnvironmentalOpen in IMG/M
3300011415Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT469_2EnvironmentalOpen in IMG/M
3300011422Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT640_2EnvironmentalOpen in IMG/M
3300011430Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT600_2EnvironmentalOpen in IMG/M
3300011439Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT820_2EnvironmentalOpen in IMG/M
3300011442Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT138_2EnvironmentalOpen in IMG/M
3300012159Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT500_2EnvironmentalOpen in IMG/M
3300012891Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S148-409B-2EnvironmentalOpen in IMG/M
3300012896Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2EnvironmentalOpen in IMG/M
3300012898Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1EnvironmentalOpen in IMG/M
3300012899Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2EnvironmentalOpen in IMG/M
3300012901Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1EnvironmentalOpen in IMG/M
3300012903Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1EnvironmentalOpen in IMG/M
3300012905Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2EnvironmentalOpen in IMG/M
3300012908Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1EnvironmentalOpen in IMG/M
3300012909Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S149-409B-1EnvironmentalOpen in IMG/M
3300012913Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2EnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015200Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2)EnvironmentalOpen in IMG/M
3300015201Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300018067Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coexEnvironmentalOpen in IMG/M
3300018072Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2EnvironmentalOpen in IMG/M
3300018073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1EnvironmentalOpen in IMG/M
3300018081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1EnvironmentalOpen in IMG/M
3300018083Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1EnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300020009Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2s1EnvironmentalOpen in IMG/M
3300020016Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m1EnvironmentalOpen in IMG/M
3300021363Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2EnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300022893Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S126-311R-4EnvironmentalOpen in IMG/M
3300022899Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S016-104C-6EnvironmentalOpen in IMG/M
3300022911Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L064-202C-5EnvironmentalOpen in IMG/M
3300022915Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S171-409R-4EnvironmentalOpen in IMG/M
3300022917Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L154-409C-5EnvironmentalOpen in IMG/M
3300023067Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S221-509R-5EnvironmentalOpen in IMG/M
3300023079Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L156-409C-4EnvironmentalOpen in IMG/M
3300024254Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK02EnvironmentalOpen in IMG/M
3300024283Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK11EnvironmentalOpen in IMG/M
3300024286Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK28EnvironmentalOpen in IMG/M
3300024310Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK22EnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026929Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G05.2A3w-12 (SPAdes)EnvironmentalOpen in IMG/M
3300027523Soil and rhizosphere microbial communities from Laval, Canada - mgHPA (SPAdes)EnvironmentalOpen in IMG/M
3300027533Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 (SPAdes)EnvironmentalOpen in IMG/M
3300027821Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027874Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300028281Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK30EnvironmentalOpen in IMG/M
3300028293Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK03EnvironmentalOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028704Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_379EnvironmentalOpen in IMG/M
3300028790Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_122EnvironmentalOpen in IMG/M
3300028803Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120EnvironmentalOpen in IMG/M
3300028812Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48EnvironmentalOpen in IMG/M
3300028889Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2EnvironmentalOpen in IMG/M
3300031226Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_SEnvironmentalOpen in IMG/M
3300031455Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 23_SEnvironmentalOpen in IMG/M
3300031547Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031793Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21EnvironmentalOpen in IMG/M
3300031799Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21EnvironmentalOpen in IMG/M
3300032060Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18EnvironmentalOpen in IMG/M
3300032067Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300034149Sediment microbial communities from East River floodplain, Colorado, United States - 20_j17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
MBSR1b_0074.000034202162886012Miscanthus RhizosphereNTMWVSIGLMGFSHAPIVQVTVAQQAKPDVELIAIAATFEQAGVTV
E1_007491802170459002Grass SoilPSTATVRNTMWVSIGYTGFSHAPICQVTIAQQALPIVELISIAATYDGAGVNV
L01_037759802170459006Grass SoilIRNTGWVSIGMTGFSHAPVVQVTVAQQAKPDVELISISAVYERLGVNV
F62_048485602170459010Grass SoilAQWDQTYPNRLVTTNTRWVSDWGPTGFSHAPIVQITVAQRAKPSVDLISISATFERAGVN
JGI24742J22300_1002982433300002244Corn, Switchgrass And Miscanthus RhizosphereSHAPVVQVTIAQTAKPDIELISIAATFERLGVNV*
JGI24742J22300_1004329433300002244Corn, Switchgrass And Miscanthus RhizospherePKNVIRNTGWVSIGMTGFSHAPIVQVTVAQQTKPEVDLINIAATFERDAIVV*
Ga0062593_10340395813300004114SoilNRNTLWVSIGMSGFAHAPIIQVTIAQTLRPEVELVAVTATFEVAGVNV*
Ga0063356_10204171923300004463Arabidopsis Thaliana RhizosphereTLWVSIGMTGFAHAPIVQVYVGQQARPDVELVALGATYEIAGVNV*
Ga0066819_100760323300005148SoilSIGMTGFSHAPIVQVTVAQQAKPDVELIAIAAVYEPAGVNV*
Ga0070690_10098164013300005330Switchgrass RhizosphereLGRPPHRNTLWVSIGMTGFAHAPIVQVYVGQQARPDVELVALGATYELAGVNV*
Ga0070670_10039917213300005331Switchgrass RhizosphereRNTLWVSIGMTGFAHAPIVQVYVGQQARPDVELVALGATYELAGVNV*
Ga0070689_10211392813300005340Switchgrass RhizosphereAPGLGRPPHRNTLWVSIGMTGFAHAPIVQVYVGQQARPNVELVALGATYEIAGVNV*
Ga0070668_10020780343300005347Switchgrass RhizosphereSIGETGFSHAPIVQVAVAQQGKPNVELISIAAMYEKLGANV*
Ga0070669_10128441023300005353Switchgrass RhizosphereHRNTLWVSIGMTGFAHAPIVQVYVGQQARPDVELVALGATYEIAGVNV*
Ga0070675_10140368513300005354Miscanthus RhizosphereVSIGQTGYSHAPIVQVTVAQNARPVVDLISIAAIFERAGINV*
Ga0070671_10173886423300005355Switchgrass RhizosphereVSIGLTGFSHAPVVQVTVAQNAKPIVDMISIAATFERAGVNV*
Ga0070674_10072403213300005356Miscanthus RhizosphereWGTAIWDAGTPPPLVVRNTGWVSIGLTGFSHAPIVQVTVAQQAKPEVDLISIAATYERAGVNV*
Ga0070674_10090192613300005356Miscanthus RhizosphereDAIWDAGTPPPLVVRNTGWVSIGLTGFSHAPVVQVTVAQNAKPEVDLISIAATFERMGINV*
Ga0070673_10113753913300005364Switchgrass RhizosphereVVRNTGWVSIGRTGFSHAPIVQVTVAQQAKPEVDLISIAATFERAGVNV*
Ga0070688_10032026113300005365Switchgrass RhizosphereVRNTGWVSIGRTGFSHAPIVQVTVAQQAKPEVDLISIAATFERAGVNV*
Ga0070688_10148282313300005365Switchgrass RhizosphereAPGLGRPPHRNTLWVSIGMTGFAHAPIVQVYVGQQARPDVELVALGATYEIAGVNV*
Ga0070662_10038796033300005457Corn RhizosphereGMTGYSHAPVVQVTIAQTAKPDIELISIAATFERLGVNV*
Ga0068867_10234598913300005459Miscanthus RhizospherePPSVTVRNTGWVSIGVTGYSHAPIIQVTVAQRARPQVDLISIAATFERCGITV*
Ga0070686_10030164223300005544Switchgrass RhizosphereNTMWVSIGLMGFSHAPIVQVTVAQQAKPDVELIAIAATFEQAGVTV*
Ga0068854_10050725933300005578Corn RhizosphereMTGYSHAPVVQVTIAQTAKPDIELISIAATFERLGVNV*
Ga0070702_10172001613300005615Corn, Switchgrass And Miscanthus RhizosphereTPSPPPSPADLDAYAQWDLGIPRPPSVRNTGWVSIGLTGFSHAPVVQVTVAQNAKPIVDMISIAATFERAGVNV*
Ga0068852_10119246513300005616Corn RhizospherePAPATPTVRNTMWVSIGFTGFSHAPICQVTIAQQSAPDIELISIAATYDGAGVNV*
Ga0068864_10081637213300005618Switchgrass RhizosphereFAHAPIVQVTVAQVARPRVELISIATTQERGGVNV*
Ga0068864_10084605533300005618Switchgrass RhizosphereVPPKPVVRNTGWVSIGLTGYSHAPVVQVTVAQAAKPEVDLISIAATFERAGVNV*
Ga0068864_10160974113300005618Switchgrass RhizosphereAPGLGRPPHRNTLWVSIGMTGFAHAPIVQVYVGQQARPDVELVALGATYELAGVNV*
Ga0068864_10202032213300005618Switchgrass RhizosphereRNTGWVSIGMTGYSHAPIVQVSVGQQAKPEVDLISIAATFERDGVNV*
Ga0068861_10028361243300005719Switchgrass RhizosphereALVTPVVRNTGWVSIGETGFSHAPIVQVAVAQQGKPNVELISIAAMYEKLGANV*
Ga0068861_10076531213300005719Switchgrass RhizosphereVKSTGWVSVGMTGYSHAPVVQVTIAQTAKPDIELISIAATFERLGVNV*
Ga0068858_10067574833300005842Switchgrass RhizosphereLVTPVVRNTGWVSIGETGFSHAPIVQVAVAQQGKPNVELISIAAMYEKLGANV*
Ga0068860_10185618023300005843Switchgrass RhizosphereSFRNTMWVSIGLMGFSHAPIVQVTVAQQAKPDVELIAIAATFEQAGVTV*
Ga0068862_10222522713300005844Switchgrass RhizospherePARNRPANRNTMWVSIGKTGFSHAPIVQVTVAQQAKPDVELVAIAAIFEVAGTNV*
Ga0066651_1001251443300006031SoilVRLSPVRNTLWVSIGMTGFAHAPIVQVTVAQQATPDVELLALSTTYERAGVNV*
Ga0075363_10057377023300006048Populus EndosphereVTRPAIRNTMWVSIGQTGFVHAPIVQVTIGQQAKPNVELIAIAATYEPAAINV*
Ga0097621_10056990133300006237Miscanthus RhizosphereWDAGTPPPLVVRNTGWVSIGLTGFSHAPVVQVTVAQQAKPEVDLISIAATYERAGVNV*
Ga0097621_10206483923300006237Miscanthus RhizospherePPGPPTQRTTLWQSIGMSGFAHAPIVQVTVAQTSRPRVELIAITTTQERGGVNV*
Ga0097621_10225881923300006237Miscanthus RhizosphereGDAIWDAGTPPPLVVRNTGWVSIGITGFSHAPIVQVTVAQNAKPEVDLISIAATFERAGINV*
Ga0068871_10095719333300006358Miscanthus RhizosphereLWDKGIPHPNVVRNTGWVSIGMTGFSHAPIVQVTVAQQAKPEVDLISIAATYERDAVVV*
Ga0068871_10202776413300006358Miscanthus RhizosphereVVRNTGWVSIGLTGFSHAPVIQVTVAQNAKPEVDLISIAATYERAGVNV*
Ga0068871_10211413223300006358Miscanthus RhizosphereLTGFSHAPIVQVTMAQQAKPEIELISVAGTFERLAITV*
Ga0074060_1094293133300006604SoilPTMRNTGWVSIGETGYSHAPVVQVTVAQQAKPTVELVSMTATYERLGVNV*
Ga0074062_1301931723300006606SoilSIGMTGFAHAPIVQVMVAQRAKPQVELLAIAATFDRAGVNV*
Ga0075434_10182575713300006871Populus RhizosphereAHAPIVQVYVGQQARPDVELVALGATYEIAGVNV*
Ga0068865_10058293213300006881Miscanthus RhizosphereLSLPSIRSTGWVSIGETGFSHAPIVQTTIAQQARPNVELISISAMYERVGVNV*
Ga0105098_1037887223300009081Freshwater SedimentKTGFSHAPIVQVTVAQQAKPDVELVAIAATFEVAGTNV*
Ga0111539_1032673023300009094Populus RhizosphereRASFRNTMWVSIGMTGFSHAPIVQVTVAQQAKPDVELIAIAATFEQEGVTV*
Ga0111539_1257251123300009094Populus RhizosphereTPGRASFRNTMWVSIGMTGFSHAPIVQVTVAQQAKPDVELIAIAASFEQEGVTV*
Ga0105245_1038701913300009098Miscanthus RhizospherePAPVVRDTGWVSVGLTGYSHAPIVQVTVAQQAKPEVDLISVAATYERAGINV*
Ga0105245_1075664413300009098Miscanthus RhizosphereKPVVRNTGWVSIGMTGFSHAPIVQVTVAQQAKPEVDLISIAATYERDAVVV*
Ga0105245_1079710513300009098Miscanthus RhizosphereMSGFAHAPIVQVTVAQVARPRVELIAIATTQERGGVNV*
Ga0105245_1081391423300009098Miscanthus RhizosphereGFSHAPIVQVTVAQQAKPEVDLISIAATFERAGVNV*
Ga0105245_1144708923300009098Miscanthus RhizosphereHWDYPTPPRASFRNTMWVSIGLMGFSHAPIVQVTVAQQAKPDVELIAIAATFEQAGVTV*
Ga0105245_1185701823300009098Miscanthus RhizosphereAGTPPPLVVRNTGWVSIGLTGFSHAPVVQVTVAQNAKPEVDLISIAATFERAGVNV*
Ga0105245_1243836823300009098Miscanthus RhizosphereVSVGMTGYSHAPVVQVMVAQTAKPSVELVSITAVYERCGVNV*
Ga0105243_1237468213300009148Miscanthus RhizosphereTTVRNTMWVSIGYTGFSHAPICQVTIAQAALPDVELISIAATYDAAGVNV*
Ga0111538_1117268713300009156Populus RhizosphereTPVVRNTGWVSIGETGFSHAPIVQVAVAQQGKPNVELISIAAMYEKLGANV*
Ga0111538_1267000513300009156Populus RhizosphereGFSHAPIVQVTVAQQAKPEVDLISIAATFERAGINV*
Ga0111538_1340355113300009156Populus RhizosphereIGMTGFSHAPIVQVTVAQQAKPDVELIAIAATFEQEGVTV*
Ga0105242_1020414853300009176Miscanthus RhizosphereWVSIGETGFSHAPIVQVAVAQQGKPNVELISIAAMYEKLGANV*
Ga0105242_1116697733300009176Miscanthus RhizosphereSIGMSGFAHAPIIQVTIAQTLRPEVELVAVTATFEVAGVNV*
Ga0105242_1227231413300009176Miscanthus RhizosphereSIGLTGFSHAPIVQVTVAQQAKPEVDLISIAATYERAGVNV*
Ga0105242_1317426423300009176Miscanthus RhizosphereFSHAPICQVTIAQAALPDVELISIAATYAAAGVNV*
Ga0105248_1162233823300009177Switchgrass RhizosphereSHAPICQVTVAQQAPPEVELISIAATFEPAGVNV*
Ga0105248_1247513723300009177Switchgrass RhizosphereDAGTPPPLVVRNTGWVSIGITGFSHAPIVQVTVAQNAKPEVDLISIAATFERAGINV*
Ga0105248_1331748723300009177Switchgrass RhizosphereMWVSIGETGFSHAPIVQVTIGQQFKPSVELISISATYIRMAANV*
Ga0105238_1000258613300009551Corn RhizosphereNTLWVSIGMTGFAHAPIVQVYVGQQARPDVELVALGATYELAGVNV*
Ga0105238_1231317323300009551Corn RhizosphereMWVSIGYTGFSHAPICQVTIAQASPPDVELISIAATYDAAGVNV*
Ga0105340_125818023300009610SoilANRNTMWVSIGKTGFSHAPIVQVTVAQQAKPDVELVAIAATFEVAGTNV*
Ga0105252_1057130023300009678SoilDALWDEGVPHPNVVRNTGWVSIGMTGFSHAPIVQVTVAQQARPVVDLINIAATFERAGVNV*
Ga0126377_1072861623300010362Tropical Forest SoilMWVSIGMTGFSHAPVVQATIAQQAKPNVELIAISAVFERCGINV*
Ga0105246_1182908613300011119Miscanthus RhizosphereWVSIGYTGFSHAPICQVTVAQQARPEVELISIAATFEPAGVNV*
Ga0105246_1251095213300011119Miscanthus RhizosphereQSIGMSGFAHAPIVQVTVAQVARPTVELIAIATTQERGGVNV*
Ga0137312_101345233300011400SoilDQPTAVAAPAVRSTGWVSIGKSGFVHAPIVQVTVAQQVKPSVELIAIAATFEPGGINV*
Ga0137312_101429223300011400SoilSIGTTGYSHAPIVQITVAQTAKPEVDLISIAATFERAGVNV*
Ga0137312_102421923300011400SoilAMSGFAHAPIVQVTVAQQARPRVELIAISTTQESGGVNV*
Ga0137325_102780723300011415SoilLRNTMWVSIGKTGFSHAPIVQVTIAQQAKPTVELVSIAATFERAGVTV*
Ga0137425_109846423300011422SoilDDAMWDKGIPHPNVVRNTGWVSIGMTGFSHAPIVQVTVAQQARPVVDLINIAATFERAGVNV*
Ga0137423_119175833300011430SoilLWDANPPPKPTVRNTGWVSIGQTGFSHAPIVQITMAQQAKPQVELISIGVTYERAGANV*
Ga0137432_118754123300011439SoilTYAQWDTGVTPLPVVRNTGWVSIGLTGYTHAPIVQVTVAQQARPEVDLISIACTYERDGINV*
Ga0137437_117474713300011442SoilRNTLWVSIGKTGFSHAPIVQVTVAQAARPDVELVAIGATFEVAGVNV*
Ga0137344_104406023300012159SoilWVSIGKTGFSHAPIVQVTVAQQAKPDVELVAIAATFEVAGTNV*
Ga0157305_1003437513300012891SoilNTGWVSIGETGFSHAPIVQVAVAQQGKPNVELISIAAMYEKLGANV*
Ga0157303_1006972223300012896SoilRNTGWVSIGMTGFSHAPIVQVTVAQQARPVVDLINIAATFERAGVNV*
Ga0157293_1012521813300012898SoilRPQNRNTLWVSVGMSGFAHAPIIQVTIAQTLRPEVELVAVTATFEVAGVNV*
Ga0157299_1028933823300012899SoilLWDQPGLGRPPHRNTLWVSIGMTGFAHAPIVQVYVGQQARPDVELVALGATYEIAGVNV*
Ga0157288_1012431923300012901SoilIGPDPGPLDLWGQGLWDTALWDADPPPAPVVRNTGWVSVGVTGFTHAPILQIMVSQQAKPEVDFISVSATYGRAGINV*
Ga0157289_1002107223300012903SoilFAHAPIVQVYVGQQARPDVELVALGATYEIAGVNV*
Ga0157289_1007714113300012903SoilQPARNRPANRNTMWVSIGKTGFSHAPIVQVTVAQQAKPDVELVAIAAIFEVAGTNV*
Ga0157296_1025457923300012905SoilPQNRNTLWVSIGMSGFAHAPIIQVTIAQTLRPEVELVAVTATFEVAGVNV*
Ga0157286_1040569223300012908SoilWDQGKWGQAMWDAETPAKPTARNTGWVSIGMTGFSHAPVVQATVAQQTRPEVEMISIAGTFERLGITI*
Ga0157290_1039189423300012909SoilSIWDAGTPPPPVVRNTGWVSIGMTGYSHAPIVQVTVAQQAKPEVEIISIAATYERVGVNV
Ga0157298_1036869923300012913SoilPPQVVRNTGWVSIGQTGFSHAPIVQVTVAQQARPVVDLINIAATFERAGVNV*
Ga0157298_1037975413300012913SoilPSPARPANRNTMWVSIGKTGFSHAPIVQVTVAQQAKPDVELVCLQATFEQAGINV*
Ga0157378_1142567013300013297Miscanthus RhizosphereGYSHAPLVQVTIAQTAKPDIELISIAATFERLGVNV*
Ga0163162_1068526623300013306Switchgrass RhizosphereNTGWVSIGRTGFSHASIVQVTVAQQAKPEVDLISIAATFERAGVNV*
Ga0157375_1032019043300013308Miscanthus RhizosphereSIGMTGFSHAPIVQVTVAQLTKPEVDLINIAATFERDAIVV*
Ga0157375_1125145923300013308Miscanthus RhizosphereFSHAPVVQVTVAQQAKPEVDLISIAATYERAGVNV*
Ga0163163_1075790913300014325Switchgrass RhizosphereSVVRNTGWVSIGMTGFSHAPIVQVTVAQQLKPEVDLISIAATYERDAVVV*
Ga0163163_1234204413300014325Switchgrass RhizosphereDAGVPPKPVVRNTGWVSIGMTGYSHAPIVQVTVAQNARPVVDLISIAAIFERAGINV*
Ga0163163_1276257313300014325Switchgrass RhizosphereFAHAPIVQVYVGQQARPDVELVALGATYELAGVNV*
Ga0157380_1191666313300014326Switchgrass RhizosphereNTGWVSIGMTGFSHAPIVQVQVAQQAKPIVDLINIAATFERAGVNV*
Ga0157380_1242488613300014326Switchgrass RhizospherePLVVRNTGWVSIGLTGFSHAPVVQVTVAQQAKPEVDLISIAATYERAGVNV*
Ga0157380_1334311413300014326Switchgrass RhizosphereLWDDALWDEGVPHPNVVRNTGWVSIGMTGFSHAPIVQVTVAQQARPVVDLINIAATFERAGVNV*
Ga0157379_1063337213300014968Switchgrass RhizosphereTGFSHAPICQVTIAQQSAPDIELISIAATYDGAGVNV*
Ga0157376_1003829313300014969Miscanthus RhizosphereNTGWVSIGMTGFSHAPIVQVTVAQQTKPEVDLINIAATFERDAIVV*
Ga0157376_1164958623300014969Miscanthus RhizosphereLTGFSHAPVVQVTVAQQAKPEVDLISIAATFERAGVNV*
Ga0173480_1051907013300015200SoilNTMWVSIGKSGFCHAPIVQITVAQQVKPDVELVAITATFEQGGVNV*
Ga0173478_1002427623300015201SoilMWVSIGKTGFSHAPIVQVTVAQQAKPDVELVAIAATFEVAGTNV*
Ga0132258_1219488313300015371Arabidopsis RhizosphereGWVSIGVTGHSHAPIVQLTIAQNSRPVFDLIAIGATFKRMGINV*
Ga0132255_10191526823300015374Arabidopsis RhizosphereDAGTPSAPVVRNTGWVSIGRTGFSHAPIVQVTVAQQAKPEVDLISIAATFERAGINV*
Ga0182036_1109043823300016270SoilGFSHAPVVQVTVSQKVKPNVELICISALFERAGINV
Ga0163161_1022016913300017792Switchgrass RhizosphereAAYAQWDQPGLGRPPHRNTLWVSIGMTSFAHAPIVQVYVGQQARPDVELVALGATYELAGVNV
Ga0163161_1101305413300017792Switchgrass RhizosphereMTGYSHAPVVQVTVAQQAKPDVELISIAATFERLGVNV
Ga0163161_1173900123300017792Switchgrass RhizosphereAYAQWDTGVPPKPVVRNTGWVSIGQTGYSHAPVVQVTVAQAAKPEVDLISIAATFERAGVNV
Ga0184611_131759613300018067Groundwater SedimentFTHAPIVQVTVGQQVKPTVEMIAIAATYERAGFTV
Ga0184611_134777613300018067Groundwater SedimentNTGWVSIGSTGYSHALTVQVTVAQQAKPDVELIAIDALFWPVGTDV
Ga0184611_135390813300018067Groundwater SedimentASLGALTQRNTLWQSIGMSGFAHAPIVQVTVAQSSRPRVELIAITTTQERGGVNV
Ga0184635_1033208713300018072Groundwater SedimentSIGKTGFSHAPIVQVTVAQQAKPDVELVAIAATFEVAGVNV
Ga0184624_1035103623300018073Groundwater SedimentGRAPIRNTLWVSIGKTGFSHAPIVQVTIGQQSKPDVELIAVGATFEVAGVNV
Ga0184624_1052304013300018073Groundwater SedimentPATGRPPVRNTMWQSIGMSGFAHAPIVQVQIGQVARPTVELIAIGTTQERGGVNV
Ga0184625_1010286633300018081Groundwater SedimentKTGFSHAPILQVSVAQKIKPAVELVAIHAIFEQGGVNV
Ga0184625_1028413223300018081Groundwater SedimentWVSIGMTGFSHAPIVQVTVAQQARPVVDLINIAATFERAGVNV
Ga0184628_1016920613300018083Groundwater SedimentQWDAGVARNAVIRNTGWVSIGVTGYTHAPIVQVMVAQHARPVVEIISVDATFERLGVNV
Ga0184628_1027916413300018083Groundwater SedimentWDDALWDEGVPHPNVVRNTGWVSIGMTGFSHAPIVQVTVAQQARPVVDLINIAATFERAGVNV
Ga0190274_1147401123300018476SoilRNTGWVSIGLTGYTHAPIVQVTVAQKSRPDVELIAIDATFERMGVNV
Ga0190274_1153287023300018476SoilMWVSIGKTGFSHAPIVQVTVAQQAKPDVELVAIAATFEVAGVNV
Ga0190271_1183049023300018481SoilWDVAVWDGAPAPAHVVRNTGWVSIGVTGYSHAPIVQVRVAQASKPQVDLISIAATFERAGMNV
Ga0190271_1238217113300018481SoilTMWVSVGMTGFSHAPIVQVTVAQQAKPDVELIAIAATFEQEGVTV
Ga0173482_1008189423300019361SoilGMTGFAHAPIVQVYVGQQARPDVELVALGATYEIAGVNV
Ga0193740_101271823300020009SoilPTNVVRNTGWVSIGQTGFTHAPIIQVYVAQQAKPEVDLIAIAATFERAGITV
Ga0193696_107169433300020016SoilWVSIGMTGFSHAPIVQVTVAQQAKPEVDLISIAATYERDAVVV
Ga0193699_1033122613300021363SoilASAPVSRAQNTGWVSIGMTGYSHAPIVQVTVSQQAKPIVDLISIAATFERDAVVV
Ga0210392_1097331813300021475SoilSIGATGFSHAPVLQVTVAQQAKPNVELISIAATFERLGVNV
Ga0247787_106406223300022893SoilTPVVRNTGWVSIGETGFSHAPIVQVAVAQQGKPNVELISIAAMYEKLGANV
Ga0247795_100123613300022899SoilLWDQESALVTPVVRNTGWVSIGETGFSHAPIVQVAVAQQGKPNVELISIAAMYEKLGANV
Ga0247783_120098623300022911Plant LitterNVVRNTGWVSIGMTGFSHAPIVQVTVAQQARPVVDLINIAATFERAGVNV
Ga0247790_1008003613300022915SoilPARPANRNTMWVSIGKTGFSHAPIVQVTVAQQAKPDVELVCLQATFEQAGINV
Ga0247790_1019180313300022915SoilFSHAPIVQVTMAQNAKPEVELISIAGTFERLAITV
Ga0247777_117047523300022917Plant LitterDEGVPHPNVVRNTGWVSIGMTGFSHAPIVQVTVAQQAKPVVDLINIAATFERAGVNV
Ga0247743_100258413300023067SoilVRNTGWVSIGETGFSHAPIVQVAVAQQGKPNVELISIAAMYEKLGANV
Ga0247758_114787223300023079Plant LitterPAIRSTRWVSIGTTGYTHAPVVQVTVAQTARPTVEMVAIDAVFERQGVNV
Ga0247661_102344313300024254SoilGRPPHRNTLWVSIGMTGFAHAPIVQVYVGQQARPDVELVALGATYELAGVNV
Ga0247661_109449013300024254SoilATVRNTMWVSIGFTGFSHAPICQVTIAQAALPDVELISIAATYDAAGVNV
Ga0247670_109727723300024283SoilTPVMKNTMWVSVGETGFSHAPIVQVTVAQQATPNVELISIGATYERLGVNV
Ga0247687_106099423300024286SoilMWVSVGETGFSHAPIVQVTVAQQATPNVELISIGATYERLGVNV
Ga0247681_100468123300024310SoilDAPGLGRPPHRNTLWVSIGMTGFAHAPIVQVYVGQQARPDVELVALGATYELAGVNV
Ga0247681_105097323300024310SoilVSIGMTGFAHAPIVQVYVGQQARPDVELVALGATYEIAGVNV
Ga0207642_1034993013300025899Miscanthus RhizosphereGLWDDAVWDASTPPKPVVRNTGWVSIGMTGFSHAPVVQVTVAQQAKPEVDLISIAATYERDAVVV
Ga0207685_1018912723300025905Corn, Switchgrass And Miscanthus RhizosphereVSIGFTGFSHAPICQVTIAQQSAPDIELISIAATYDGAGVNV
Ga0207671_1011900943300025914Corn RhizosphereGWVSIGLTGYSHAPVVQVTVAQQAKPDVELISISAVYERLGVNV
Ga0207650_1052689223300025925Switchgrass RhizosphereALWDQPGLGRPPHRNTLWVSIGMTGFAHAPIVQVYVGQQARPDVELVALGATYEIAGVNV
Ga0207659_1045311823300025926Miscanthus RhizosphereTPVVRNTGWVSIGRTGFSHAPIVQVTVAQQAKPEVDLISIAATFERAGVNV
Ga0207687_1117080323300025927Miscanthus RhizospherePPPLVVRNTGWVSIGLTGFSHAPVVQVTVAQNAKPEVDLISIAATFERGGINV
Ga0207687_1139031523300025927Miscanthus RhizosphereSVRSTGWVSVGMTGYSHAPVVQVMVAQTAKPSVELVSITAVYERCGVNV
Ga0207700_1124731913300025928Corn, Switchgrass And Miscanthus RhizosphereTGFSHAPVVQVTVAQAARPNVELISIAATFERLGVNV
Ga0207701_1016062623300025930Corn, Switchgrass And Miscanthus RhizosphereRNTLWVSIGKTGFSHAPIVQVTVGQQAKPDVELVAIAAIFEVAGTNV
Ga0207701_1052480123300025930Corn, Switchgrass And Miscanthus RhizosphereRNTGWVSIGMTGYSHAPIVQVSVGQQAKPEVDLISIAATFERDGVNV
Ga0207644_1132762023300025931Switchgrass RhizosphereRNTGWVSIGLTGFSHAPVVQVTVAQNAKPIVDMISIAATFERAGVNV
Ga0207686_1157559513300025934Miscanthus RhizosphereVRNTMWVSIGMTGYSHAPIVQVTVAQNARPIVDLISIAATFERAGVNV
Ga0207669_1016255513300025937Miscanthus RhizosphereTTGWVSIGITGFSHAPIVQVTVGQNARPNVELISIDALYTRGGVNV
Ga0207669_1108668013300025937Miscanthus RhizosphereNTMWVSIGKTGFSHAPIVQVTVGQQAKPDVELVAIAATFEVAGTNV
Ga0207704_1084199923300025938Miscanthus RhizosphereGASASLNLSDEALSDDAIWDAGVTPIAVVRNTGWVSIGMTGYSHAPVVQVTVAQQARPQVDLISIAATFERCGITV
Ga0207704_1189372823300025938Miscanthus RhizosphereVRNTGWVSIGRTGFSHAPIVQVTVAQQAKPEVDLISIAATFERAGVNV
Ga0207691_1010978223300025940Miscanthus RhizosphereVSIGVTGYSHAPIIQVTVAQRARPQVDLISIAATFERCGITV
Ga0207711_1071101523300025941Switchgrass RhizosphereGLGRPPHRNTLWVSIGMTGFAHAPIVQVYVGQQARPDVELVALGATYELAGVNV
Ga0207651_1101595913300025960Switchgrass RhizospherePHRNTLWVSIGMTGFAHAPIVQVYVGQQARPDVELVALGATYEIAGVNV
Ga0207651_1104624723300025960Switchgrass RhizosphereVVRNTGWVSIGRTGFSHAPIVQVTVAQQAKPEVDLISIAATFERAGVNV
Ga0207651_1149109413300025960Switchgrass RhizosphereWVSIGLTGFSHAPVVQVTVAQQAKPEVDLISIAATYERAGVNV
Ga0207651_1196298613300025960Switchgrass RhizosphereSIGKTGFSHAPIVQVTIGQQAKPDVELIAVGATFEVAGVNV
Ga0207712_1102827213300025961Switchgrass RhizosphereTPPPLVVRNTGWVSIGLTGFSHAPVVQVTVAQQAKPEVDLISIAATYERAGVNV
Ga0207668_1011698333300025972Switchgrass RhizosphereVSVGMTGYSHAPVVQVTIAQTAKPDIELISIAATFERLGVNV
Ga0207677_1142049313300026023Miscanthus RhizosphereVPTVRNTMWVSIGMTGFSHAPICQVTIAQQSAPDIELISIAATYDGAGVNV
Ga0207702_1073673613300026078Corn RhizosphereFSHAPIVQTTIAQQARPNVELISISAMYERVGVNV
Ga0207641_1072227633300026088Switchgrass RhizosphereMTGYSHAPICQVTVAQTAKPNVELLAIAAVYDPAGVNV
Ga0207648_1195045423300026089Miscanthus RhizosphereAPPSVTVRNTGWVSIGVTGYSHAPIIQVTVAQRARPQVDLISIAATFERCGITV
Ga0207648_1216796913300026089Miscanthus RhizosphereIWDAGTPPPLVVRNTGWVSIGLTGFSHAPVIQVTVAQNAKPEVDLISIAATFERAGVNV
Ga0207676_1119150623300026095Switchgrass RhizosphereMWVSIGKTGFSHAPIVQVTVAQQAKPDVELVCLQATFEQAGINV
Ga0207675_10098215033300026118Switchgrass RhizosphereVKSTGWVSVGMTGYSHAPVVQVTIAQTAKPDIELISIAATFERLGVNV
Ga0207675_10115124513300026118Switchgrass RhizosphereVTGYTHAPIVQITVGQIAKPSVELVAIDVTYQRAGVNV
Ga0207675_10178450713300026118Switchgrass RhizosphereSGFAHAPVVQVTIAQIARPAVELVALHTTQERGGVNV
Ga0207683_1019932133300026121Miscanthus RhizospherePSTPAVRNTGWVSIGRTGFSHAPIVQVTVAQQAKPEVDLISIAATFERAGVNV
Ga0207683_1020608233300026121Miscanthus RhizosphereVPPAKTVTNTGWVSIGMTGFSHAPIVQVTVAQAVRPEVDLINIAATYERDAIVV
Ga0207683_1033392513300026121Miscanthus RhizosphereVGLTGYSHAPIVQVTVAQQAKPEVDLISVAATYERAGINV
Ga0207461_101371623300026929SoilNTLWVSIGMTGFAHAPIVQVYVGQQARPDVELVALGATYEIAGVNV
Ga0208890_105112323300027523SoilETGYSHAPVVQVTVAQQAKPTVELVSMTATYERLGVNV
Ga0208185_107572313300027533SoilTGWVSIGTTGYSHAPIVQITVAQTAKPEVDLISIAATFERAGVNV
Ga0209811_1002497413300027821Surface SoilLWVSIGKTGFAHAPIIQVTVAQQRTPDVELIALTATYEPAGVNV
Ga0209465_1025389723300027874Tropical Forest SoilWVSIGMTGFAHAPIVQVTVAQQAKPNVELIALAATFERAGVNV
Ga0207428_1071327213300027907Populus RhizospherePGQAPAKNTMWVSVGETGFSHAPICQVTVGQQAKPDVELISISATFVRMGANV
Ga0247689_101047013300028281SoilGRPPHRNTLWVSIGMTGFAHAPIVQVYVGQQARPDVELVALGATYEIAGVNV
Ga0247662_100282413300028293SoilLWDQPGLGRPPHRNTLWVSIGMTGFAHAPIVQVYVGQQARPDVELVALGATYEIAGVNV
Ga0268265_1085469523300028380Switchgrass RhizosphereDQPGLGRPPHRNTLWVSIGMTGFAHAPIVQVYVGQQARPDVELVALGATYEIAGVNV
Ga0307321_112175323300028704SoilYSHAPIVQVTVSQQAKPIVDLISIAATFERDAVVV
Ga0307283_1024607913300028790SoilEAYAQWDTGVTPLPVIRNTGWVSIGLTGFSHAPIVQITVAQKLKPEVDLINIAATFERDGVNV
Ga0307281_1020266013300028803SoilVSIGMTGYSHAPIVQVSVGQQAKPEVDLISIAATFERDGVNV
Ga0247825_1125062523300028812SoilQPAPTTVPIRNTRWVSIGRTGYTHAPVVQVYVGQQARPEVELIAIDVTFNRMGVTV
Ga0247827_1127698413300028889SoilVSIGKSGFAHAPIVQVQVAQQAKPNVELIALHTTQETGGVNV
Ga0307497_1012828213300031226SoilWDAGEPLSPIVGNTGWVSIGLTGFSHAPIIQVTMAQQAKPEVELISIAGVFERLAITV
Ga0307497_1016865433300031226SoilKNTGWVSIGEVGFSHAPICQVTVAQQGNPNVELVSIAATFERLGVNV
Ga0307505_1028750113300031455SoilGYSHAPVVQVTMHQRAKPDVELISISATYERCGVNV
Ga0310887_1054105713300031547SoilSIGETGFSHAPIVQVTIAQQAKPNVELISIAAMYEKLGANV
Ga0307468_10065234823300031740Hardwood Forest SoilNVNRNTMWVSVGMSGFSHAPIVQITVAQQATPDVELVAIAATYERAGINV
Ga0318548_1033286023300031793SoilGFTHAPVVQATISQQAKPNIELISISAAFERAGINV
Ga0318565_1016659523300031799SoilVRNTMWVSIGRTGFSLAPVVQVTVAQRAPPEVELITVNAVFDRAGIDV
Ga0318505_1018406123300032060SoilVRNTMWVSIGVTGFTHAPVVQATVSQQAKPNIELISISAAFERAGINV
Ga0318524_1076333613300032067SoilTMWVSIGVTGFTHAPVVQATISQQAKPNIELISISAAFERAGINV
Ga0307472_10254108323300032205Hardwood Forest SoilTAIWDAGVAPPKVVRNTGWVSIGVTGFSHAPVVQVTVAQQARPEVDLISIAATFERMGIN
Ga0364929_0089959_790_9603300034149SedimentAAAAPKPVVRNTGWVSIGMTGFSHAPIVQVTVAQQAKPEVDLISIAATYERDAVVV


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.