Metagenome / Metatranscriptome Family F022968

Basic Information
Family ID	F022968
Family Type	Metagenome / Metatranscriptome
Number of Sequences	212
Average Sequence Length	39 residues
Representative Sequence	MLAYVVSEGRLFALKPSEWSMLLVGVALCGFVTLLF
Number of Associated Samples	169
Number of Associated Scaffolds	212

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	53.30 %
% of genes near scaffold ends (potentially truncated)	37.74 %
% of genes from short scaffolds (< 2000 bps)	79.25 %
Associated GOLD sequencing projects	161
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.37

Most Common Taxonomy
Group	Unclassified (56.132 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (10.849 % of family members)
Environment Ontology (ENVO)	Unclassified (21.698 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (46.698 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Transmembrane (alpha-helical)	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 45.31% β-sheet: 0.00% Coil/Unstructured: 54.69%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 212 Family Scaffolds
PF03401	TctC	3.77
PF02735	Ku	2.36
PF06411	HdeA	1.89
PF13847	Methyltransf_31	1.42
PF01494	FAD_binding_3	1.42
PF04392	ABC_sub_bind	0.94
PF04952	AstE_AspA	0.94
PF02518	HATPase_c	0.94
PF13417	GST_N_3	0.94
PF00072	Response_reg	0.47
PF00106	adh_short	0.47
PF12229	PG_binding_4	0.47
PF13458	Peripla_BP_6	0.47
PF12071	DUF3551	0.47
PF00534	Glycos_transf_1	0.47
PF02737	3HCDH_N	0.47
PF10101	DUF2339	0.47
PF00156	Pribosyltran	0.47
PF00909	Ammonium_transp	0.47
PF01522	Polysacc_deac_1	0.47
PF02771	Acyl-CoA_dh_N	0.47
PF00027	cNMP_binding	0.47
PF16868	NMT1_3	0.47
PF07045	DUF1330	0.47
PF03886	ABC_trans_aux	0.47
PF02586	SRAP	0.47
PF07750	GcrA	0.47
PF12637	TSCPD	0.47
PF04290	DctQ	0.47
PF00263	Secretin	0.47
PF00589	Phage_integrase	0.47
PF00005	ABC_tran	0.47
PF00725	3HCDH	0.47
PF02798	GST_N	0.47
PF14397	ATPgrasp_ST	0.47
PF04964	Flp_Fap	0.47
PF01970	TctA	0.47
PF01381	HTH_3	0.47
PF13436	Gly-zipper_OmpA	0.47
PF02656	DUF202	0.47
PF14023	DUF4239	0.47
PF13181	TPR_8	0.47
PF13533	Biotin_lipoyl_2	0.47
PF00166	Cpn10	0.47
PF13450	NAD_binding_8	0.47
PF04588	HIG_1_N	0.47
PF02687	FtsX	0.47
PF07883	Cupin_2	0.47
PF03330	DPBB_1	0.47
PF02353	CMAS	0.47
PF04073	tRNA_edit	0.47
PF03733	YccF	0.47
PF01068	DNA_ligase_A_M	0.47
PF01370	Epimerase	0.47
PF01380	SIS	0.47
PF02653	BPD_transp_2	0.47

COG ID	Name	Functional Category	% Frequency in 212 Family Scaffolds
COG3181	Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC	Energy production and conversion [C]	3.77
COG0654	2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases	Energy production and conversion [C]	2.83
COG1273	Non-homologous end joining protein Ku, dsDNA break repair	Replication, recombination and repair [L]	2.36
COG0578	Glycerol-3-phosphate dehydrogenase	Energy production and conversion [C]	1.42
COG0644	Dehydrogenase (flavoprotein)	Energy production and conversion [C]	1.42
COG0665	Glycine/D-amino acid oxidase (deaminating)	Amino acid transport and metabolism [E]	1.42
COG1250	3-hydroxyacyl-CoA dehydrogenase	Lipid transport and metabolism [I]	0.94
COG2984	ABC-type uncharacterized transport system, periplasmic component	General function prediction only [R]	0.94
COG0004	Ammonia channel protein AmtB	Inorganic ion transport and metabolism [P]	0.47
COG0234	Co-chaperonin GroES (HSP10)	Posttranslational modification, protein turnover, chaperones [O]	0.47
COG0240	Glycerol-3-phosphate dehydrogenase	Energy production and conversion [C]	0.47
COG0287	Prephenate dehydrogenase	Amino acid transport and metabolism [E]	0.47
COG0677	UDP-N-acetyl-D-mannosaminuronate dehydrogenase	Cell wall/membrane/envelope biogenesis [M]	0.47
COG0726	Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 family	Cell wall/membrane/envelope biogenesis [M]	0.47
COG1004	UDP-glucose 6-dehydrogenase	Cell wall/membrane/envelope biogenesis [M]	0.47
COG1423	ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family	Replication, recombination and repair [L]	0.47
COG1748	Saccharopine dehydrogenase, NADP-dependent	Amino acid transport and metabolism [E]	0.47
COG1784	TctA family transporter	General function prediction only [R]	0.47
COG1793	ATP-dependent DNA ligase	Replication, recombination and repair [L]	0.47
COG1960	Acyl-CoA dehydrogenase related to the alkylation response protein AidB	Lipid transport and metabolism [I]	0.47
COG2084	3-hydroxyisobutyrate dehydrogenase or related beta-hydroxyacid dehydrogenase	Lipid transport and metabolism [I]	0.47
COG2135	ssDNA abasic site-binding protein YedK/HMCES, SRAP family	Replication, recombination and repair [L]	0.47
COG2149	Uncharacterized membrane protein YidH, DUF202 family	Function unknown [S]	0.47
COG2226	Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG	Coenzyme transport and metabolism [H]	0.47
COG2227	2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase	Coenzyme transport and metabolism [H]	0.47
COG2230	Cyclopropane fatty-acyl-phospholipid synthase and related methyltransferases	Lipid transport and metabolism [I]	0.47
COG3304	Uncharacterized membrane protein YccF, DUF307 family	Function unknown [S]	0.47
COG3333	TctA family transporter	General function prediction only [R]	0.47
COG3847	Flp pilus assembly protein, pilin Flp	Extracellular structures [W]	0.47
COG5352	Uncharacterized conserved protein	Function unknown [S]	0.47
COG5470	Uncharacterized conserved protein, DUF1330 family	Function unknown [S]	0.47

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.13 %
All Organisms	root	All Organisms	43.87 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.13 %
cellular organisms	root	All Organisms → cellular organisms	43.87 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.13 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	43.87 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.13 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	29.72 %
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	0.47 %
PVC group	clade	All Organisms → cellular organisms → Bacteria → PVC group	0.47 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	0.47 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.13 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	25.00 %
Verrucomicrobia	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia	0.47 %
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	0.47 %
Bacteroidetes/Chlorobi group	clade	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group	0.47 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.13 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	18.40 %
unclassified Alphaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria	1.89 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.47 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.47 %
Sphingomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales	0.47 %
Spartobacteria	class	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria	0.47 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.13 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	5.19 %
Xanthobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae	4.72 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1.89 %
unclassified Hyphomicrobiales	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales	1.42 %
Sphingomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae	0.47 %
unclassified Spartobacteria	no rank	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → unclassified Spartobacteria	0.47 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.47 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.47 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.13 %
Pseudolabrys	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys	4.72 %
unclassified Bradyrhizobiaceae	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → unclassified Bradyrhizobiaceae	1.89 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1.89 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1.89 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	0.94 %
Spartobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → unclassified Spartobacteria → Spartobacteria bacterium	0.47 %
Afipia	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia	0.47 %
Rhizobiales bacterium GAS113	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Rhizobiales bacterium GAS113	0.47 %
Sphingomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae	0.47 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.47 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.47 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.13 %
Pseudolabrys taiwanensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis	3.30 %
Bradyrhizobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → unclassified Bradyrhizobiaceae → Bradyrhizobiaceae bacterium	1.89 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1.89 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1.89 %
unclassified Pseudolabrys	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys	1.42 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	0.94 %
Afipia carboxidovorans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → Afipia carboxidovorans	0.47 %
Spartobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → unclassified Spartobacteria → Spartobacteria bacterium	0.47 %
Rhizobiales bacterium GAS113	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Rhizobiales bacterium GAS113	0.47 %
Sphingomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae	0.47 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.47 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.47 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.13 %
Pseudolabrys taiwanensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis	3.30 %
Bradyrhizobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → unclassified Bradyrhizobiaceae → Bradyrhizobiaceae bacterium	1.89 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1.89 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1.89 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	1.42 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	0.94 %
Afipia carboxidovorans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → Afipia carboxidovorans	0.47 %
Spartobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → unclassified Spartobacteria → Spartobacteria bacterium	0.47 %
Rhizobiales bacterium GAS113	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Rhizobiales bacterium GAS113	0.47 %
Sphingomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae	0.47 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.47 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.47 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2088090004\|P1_DRAFT_NODE_124933_len_1150_cov_21_121738	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis	1200	Open in IMG/M
2140918006\|ConsensusfromContig102340	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis	708	Open in IMG/M
2140918007\|ConsensusfromContig193819	Not Available	625	Open in IMG/M
2166559005\|cont_contig55713	Not Available	827	Open in IMG/M
2170459013\|GO6OHWN01EU4IP	Not Available	532	Open in IMG/M
2170459014\|G1P06HT01CZGJ5	Not Available	524	Open in IMG/M
2199352025\|deepsgr_contig00498.357	All Organisms → cellular organisms → Bacteria	7688	Open in IMG/M
2199352025\|deepsgr__Contig_191572	Not Available	576	Open in IMG/M
2199352025\|deepsgr__Contig_22863	All Organisms → cellular organisms → Bacteria	2469	Open in IMG/M
3300000313\|WSSedB1CaDRAFT_10057002	Not Available	739	Open in IMG/M
3300000363\|ICChiseqgaiiFebDRAFT_10858029	Not Available	818	Open in IMG/M
3300000364\|INPhiseqgaiiFebDRAFT_100765174	All Organisms → cellular organisms → Bacteria	1153	Open in IMG/M
3300000580\|AF_2010_repII_A01DRAFT_1000665	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	5264	Open in IMG/M
3300000729\|JGI12371J11900_1009179	Not Available	665	Open in IMG/M
3300000890\|JGI11643J12802_11569973	Not Available	582	Open in IMG/M
3300000956\|JGI10216J12902_106515172	Not Available	1205	Open in IMG/M
3300003369\|JGI24140J50213_10094999	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	995	Open in IMG/M
3300005563\|Ga0068855_101766674	Not Available	629	Open in IMG/M
3300005564\|Ga0070664_100684704	Not Available	954	Open in IMG/M
3300005713\|Ga0066905_100002705	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	6727	Open in IMG/M
3300005713\|Ga0066905_100005518	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	5381	Open in IMG/M
3300005713\|Ga0066905_100261640	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1336	Open in IMG/M
3300005713\|Ga0066905_100462942	Not Available	1045	Open in IMG/M
3300005718\|Ga0068866_10915947	Not Available	618	Open in IMG/M
3300005764\|Ga0066903_100015901	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	7669	Open in IMG/M
3300005764\|Ga0066903_101195231	All Organisms → cellular organisms → Bacteria	1411	Open in IMG/M
3300005764\|Ga0066903_105566824	Not Available	663	Open in IMG/M
3300005937\|Ga0081455_10008475	All Organisms → cellular organisms → Bacteria	10687	Open in IMG/M
3300005937\|Ga0081455_10054337	Not Available	3414	Open in IMG/M
3300005938\|Ga0066795_10058386	Not Available	1139	Open in IMG/M
3300005947\|Ga0066794_10183723	Not Available	628	Open in IMG/M
3300005983\|Ga0081540_1020610	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	3957	Open in IMG/M
3300006028\|Ga0070717_11456359	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	621	Open in IMG/M
3300006041\|Ga0075023_100161008	Not Available	835	Open in IMG/M
3300006047\|Ga0075024_100193736	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis	949	Open in IMG/M
3300006047\|Ga0075024_100546559	Not Available	614	Open in IMG/M
3300006049\|Ga0075417_10199448	Not Available	947	Open in IMG/M
3300006052\|Ga0075029_100299076	Not Available	1027	Open in IMG/M
3300006052\|Ga0075029_100866925	Not Available	618	Open in IMG/M
3300006055\|Ga0097691_1090718	Not Available	919	Open in IMG/M
3300006172\|Ga0075018_10009465	All Organisms → cellular organisms → Bacteria	3568	Open in IMG/M
3300006173\|Ga0070716_100087733	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1875	Open in IMG/M
3300006174\|Ga0075014_100179279	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1055	Open in IMG/M
3300006237\|Ga0097621_101263594	Not Available	696	Open in IMG/M
3300006636\|Ga0075525_10031212	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis	1058	Open in IMG/M
3300006640\|Ga0075527_10085725	Not Available	864	Open in IMG/M
3300006806\|Ga0079220_10158898	Not Available	1257	Open in IMG/M
3300006844\|Ga0075428_100327097	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1647	Open in IMG/M
3300006845\|Ga0075421_101906624	Not Available	636	Open in IMG/M
3300006871\|Ga0075434_100289552	All Organisms → cellular organisms → Bacteria → Proteobacteria	1658	Open in IMG/M
3300007076\|Ga0075435_100951372	Not Available	750	Open in IMG/M
3300009029\|Ga0066793_10088332	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1787	Open in IMG/M
3300009036\|Ga0105244_10362748	Not Available	667	Open in IMG/M
3300009090\|Ga0099827_11948793	Not Available	511	Open in IMG/M
3300009094\|Ga0111539_10582587	Not Available	1303	Open in IMG/M
3300009094\|Ga0111539_13061518	Not Available	540	Open in IMG/M
3300009098\|Ga0105245_10838245	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → unclassified Bradyrhizobiaceae → Bradyrhizobiaceae bacterium	959	Open in IMG/M
3300009100\|Ga0075418_10045601	All Organisms → cellular organisms → Bacteria	4715	Open in IMG/M
3300009147\|Ga0114129_10127569	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → Afipia carboxidovorans	3497	Open in IMG/M
3300009147\|Ga0114129_11896523	Not Available	723	Open in IMG/M
3300009148\|Ga0105243_10452216	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis	1205	Open in IMG/M
3300009174\|Ga0105241_12222770	Not Available	544	Open in IMG/M
3300009553\|Ga0105249_13431826	Not Available	510	Open in IMG/M
3300009792\|Ga0126374_10533621	Not Available	853	Open in IMG/M
3300009792\|Ga0126374_10705287	Not Available	759	Open in IMG/M
3300010043\|Ga0126380_10008853	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Rhizobiales bacterium GAS113	4425	Open in IMG/M
3300010043\|Ga0126380_10012959	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	3801	Open in IMG/M
3300010043\|Ga0126380_10068126	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	2006	Open in IMG/M
3300010043\|Ga0126380_10384839	Not Available	1035	Open in IMG/M
3300010046\|Ga0126384_10093112	All Organisms → cellular organisms → Bacteria	2203	Open in IMG/M
3300010046\|Ga0126384_10415079	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1140	Open in IMG/M
3300010047\|Ga0126382_10002956	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	7275	Open in IMG/M
3300010047\|Ga0126382_11858999	Not Available	568	Open in IMG/M
3300010048\|Ga0126373_10042395	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	4011	Open in IMG/M
3300010147\|Ga0126319_1411218	All Organisms → cellular organisms → Bacteria	681	Open in IMG/M
3300010359\|Ga0126376_11643342	Not Available	676	Open in IMG/M
3300010359\|Ga0126376_12457248	Not Available	568	Open in IMG/M
3300010359\|Ga0126376_12956367	Not Available	525	Open in IMG/M
3300010359\|Ga0126376_13243748	Not Available	503	Open in IMG/M
3300010366\|Ga0126379_10799992	All Organisms → cellular organisms → Bacteria → Proteobacteria	1042	Open in IMG/M
3300010366\|Ga0126379_12534523	Not Available	611	Open in IMG/M
3300010371\|Ga0134125_13010212	Not Available	511	Open in IMG/M
3300010376\|Ga0126381_101119754	All Organisms → cellular organisms → Bacteria → Proteobacteria	1137	Open in IMG/M
3300010397\|Ga0134124_10037102	All Organisms → cellular organisms → Bacteria	4061	Open in IMG/M
3300010398\|Ga0126383_12407552	All Organisms → cellular organisms → Bacteria	611	Open in IMG/M
3300010863\|Ga0124850_1007378	Not Available	3478	Open in IMG/M
3300011000\|Ga0138513_100009558	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	1190	Open in IMG/M
3300011003\|Ga0138514_100102276	Not Available	622	Open in IMG/M
3300011270\|Ga0137391_10122650	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	2256	Open in IMG/M
3300012010\|Ga0120118_1029632	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → unclassified Spartobacteria → Spartobacteria bacterium	1445	Open in IMG/M
3300012019\|Ga0120139_1071908	All Organisms → cellular organisms → Bacteria → Proteobacteria	844	Open in IMG/M
3300012200\|Ga0137382_10137247	Not Available	1648	Open in IMG/M
3300012492\|Ga0157335_1022363	Not Available	610	Open in IMG/M
3300012499\|Ga0157350_1042851	Not Available	548	Open in IMG/M
3300012955\|Ga0164298_10217634	All Organisms → cellular organisms → Bacteria	1129	Open in IMG/M
3300012955\|Ga0164298_11362386	Not Available	547	Open in IMG/M
3300012961\|Ga0164302_10042722	All Organisms → cellular organisms → Bacteria	2188	Open in IMG/M
3300012984\|Ga0164309_10412556	Not Available	1010	Open in IMG/M
3300012985\|Ga0164308_10039852	Not Available	2950	Open in IMG/M
3300012986\|Ga0164304_10025921	Not Available	2922	Open in IMG/M
3300012989\|Ga0164305_10795181	All Organisms → cellular organisms → Bacteria	784	Open in IMG/M
3300013296\|Ga0157374_10759368	Not Available	984	Open in IMG/M
3300013297\|Ga0157378_10722908	All Organisms → cellular organisms → Bacteria	1017	Open in IMG/M
3300013297\|Ga0157378_11042249	Not Available	853	Open in IMG/M
3300013306\|Ga0163162_12214556	Not Available	631	Open in IMG/M
3300013307\|Ga0157372_12923697	Not Available	547	Open in IMG/M
3300013503\|Ga0120127_10040816	Not Available	901	Open in IMG/M
3300013503\|Ga0120127_10070527	Not Available	736	Open in IMG/M
3300013832\|Ga0120132_1001587	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	3288	Open in IMG/M
3300014058\|Ga0120149_1063952	Not Available	946	Open in IMG/M
3300014325\|Ga0163163_10019366	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	6392	Open in IMG/M
3300014969\|Ga0157376_12837860	Not Available	524	Open in IMG/M
3300015371\|Ga0132258_10830631	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → unclassified Bradyrhizobiaceae → Bradyrhizobiaceae bacterium	2330	Open in IMG/M
3300015371\|Ga0132258_11222891	Not Available	1899	Open in IMG/M
3300015371\|Ga0132258_12894165	Not Available	1193	Open in IMG/M
3300015372\|Ga0132256_102069287	Not Available	675	Open in IMG/M
3300015374\|Ga0132255_100081658	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	4332	Open in IMG/M
3300017792\|Ga0163161_11093853	Not Available	685	Open in IMG/M
3300017930\|Ga0187825_10136451	Not Available	862	Open in IMG/M
3300017936\|Ga0187821_10394442	Not Available	565	Open in IMG/M
3300017939\|Ga0187775_10000909	All Organisms → cellular organisms → Bacteria → Proteobacteria	7074	Open in IMG/M
3300017944\|Ga0187786_10031836	All Organisms → cellular organisms → Bacteria	1485	Open in IMG/M
3300017947\|Ga0187785_10003556	All Organisms → cellular organisms → Bacteria → Proteobacteria	5094	Open in IMG/M
3300017947\|Ga0187785_10006307	All Organisms → cellular organisms → Bacteria → Proteobacteria	3934	Open in IMG/M
3300017947\|Ga0187785_10065748	Not Available	1389	Open in IMG/M
3300017959\|Ga0187779_10017744	Not Available	4050	Open in IMG/M
3300017966\|Ga0187776_11573122	Not Available	507	Open in IMG/M
3300017974\|Ga0187777_10000323	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	35193	Open in IMG/M
3300017974\|Ga0187777_10090873	Not Available	1996	Open in IMG/M
3300017974\|Ga0187777_10863842	All Organisms → cellular organisms → Bacteria	649	Open in IMG/M
3300017994\|Ga0187822_10184598	Not Available	688	Open in IMG/M
3300018028\|Ga0184608_10286263	All Organisms → cellular organisms → Bacteria	725	Open in IMG/M
3300018029\|Ga0187787_10341346	Not Available	574	Open in IMG/M
3300018030\|Ga0187869_10631982	Not Available	504	Open in IMG/M
3300018031\|Ga0184634_10424462	Not Available	603	Open in IMG/M
3300018058\|Ga0187766_10039681	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2750	Open in IMG/M
3300018060\|Ga0187765_10066282	All Organisms → cellular organisms → Bacteria	1897	Open in IMG/M
3300018072\|Ga0184635_10052340	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1578	Open in IMG/M
3300018081\|Ga0184625_10127947	Not Available	1322	Open in IMG/M
3300018081\|Ga0184625_10157091	Not Available	1188	Open in IMG/M
3300019878\|Ga0193715_1107328	All Organisms → cellular organisms → Bacteria	553	Open in IMG/M
3300019888\|Ga0193751_1107726	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	1061	Open in IMG/M
3300020006\|Ga0193735_1097712	Not Available	822	Open in IMG/M
3300021510\|Ga0222621_1042045	Not Available	952	Open in IMG/M
3300021560\|Ga0126371_10012121	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	7814	Open in IMG/M
3300021560\|Ga0126371_10422572	Not Available	1477	Open in IMG/M
3300021560\|Ga0126371_10616190	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1234	Open in IMG/M
3300022534\|Ga0224452_1025929	Not Available	1665	Open in IMG/M
3300022883\|Ga0247786_1024577	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → unclassified Bradyrhizobiaceae → Bradyrhizobiaceae bacterium	1152	Open in IMG/M
3300022892\|Ga0247753_1003646	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → unclassified Bradyrhizobiaceae → Bradyrhizobiaceae bacterium	1481	Open in IMG/M
3300025271\|Ga0207666_1057587	Not Available	620	Open in IMG/M
3300025457\|Ga0208850_1004279	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	3137	Open in IMG/M
3300025474\|Ga0208479_1081361	All Organisms → cellular organisms → Bacteria	607	Open in IMG/M
3300025484\|Ga0208587_1077747	Not Available	699	Open in IMG/M
3300025505\|Ga0207929_1001051	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	7133	Open in IMG/M
3300025900\|Ga0207710_10010743	All Organisms → cellular organisms → Bacteria → Proteobacteria	3856	Open in IMG/M
3300025903\|Ga0207680_10116506	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1741	Open in IMG/M
3300025906\|Ga0207699_10858887	Not Available	669	Open in IMG/M
3300025912\|Ga0207707_10049371	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	3666	Open in IMG/M
3300025917\|Ga0207660_10624833	Not Available	878	Open in IMG/M
3300025928\|Ga0207700_10269765	Not Available	1460	Open in IMG/M
3300025931\|Ga0207644_10397170	All Organisms → cellular organisms → Bacteria	1126	Open in IMG/M
3300025933\|Ga0207706_11185857	Not Available	635	Open in IMG/M
3300025961\|Ga0207712_12098192	Not Available	506	Open in IMG/M
3300025972\|Ga0207668_12073050	Not Available	512	Open in IMG/M
3300025981\|Ga0207640_10573561	All Organisms → cellular organisms → Bacteria	951	Open in IMG/M
3300025986\|Ga0207658_10152494	All Organisms → cellular organisms → Bacteria	1884	Open in IMG/M
3300026035\|Ga0207703_11185214	Not Available	734	Open in IMG/M
3300026088\|Ga0207641_11248345	Not Available	743	Open in IMG/M
3300026746\|Ga0207454_103996	Not Available	532	Open in IMG/M
3300026833\|Ga0207728_117475	Not Available	650	Open in IMG/M
3300026921\|Ga0207860_1010823	Not Available	1226	Open in IMG/M
3300027680\|Ga0207826_1070665	Not Available	962	Open in IMG/M
3300027909\|Ga0209382_10277883	Not Available	1894	Open in IMG/M
3300027915\|Ga0209069_10023373	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae	2894	Open in IMG/M
3300027915\|Ga0209069_10648015	Not Available	614	Open in IMG/M
3300028381\|Ga0268264_12687211	Not Available	502	Open in IMG/M
3300028715\|Ga0307313_10055281	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1168	Open in IMG/M
3300028715\|Ga0307313_10268364	Not Available	531	Open in IMG/M
3300028718\|Ga0307307_10195903	Not Available	639	Open in IMG/M
3300028787\|Ga0307323_10089628	All Organisms → cellular organisms → Bacteria	1100	Open in IMG/M
3300028791\|Ga0307290_10362595	Not Available	530	Open in IMG/M
3300028799\|Ga0307284_10333340	Not Available	613	Open in IMG/M
3300028814\|Ga0307302_10070407	Not Available	1647	Open in IMG/M
3300028885\|Ga0307304_10313905	Not Available	695	Open in IMG/M
3300030989\|Ga0308196_1054445	Not Available	561	Open in IMG/M
3300031058\|Ga0308189_10166895	Not Available	770	Open in IMG/M
3300031170\|Ga0307498_10017330	Not Available	1579	Open in IMG/M
3300031170\|Ga0307498_10268583	All Organisms → cellular organisms → Bacteria	625	Open in IMG/M
3300031231\|Ga0170824_116292938	Not Available	786	Open in IMG/M
3300031360\|Ga0307444_1064500	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1178	Open in IMG/M
3300031446\|Ga0170820_15628194	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	940	Open in IMG/M
3300031740\|Ga0307468_101711693	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	592	Open in IMG/M
3300031819\|Ga0318568_10342655	All Organisms → cellular organisms → Bacteria → Proteobacteria	930	Open in IMG/M
3300031854\|Ga0310904_10248369	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1101	Open in IMG/M
3300031858\|Ga0310892_10251428	Not Available	1091	Open in IMG/M
3300032782\|Ga0335082_10745270	Not Available	841	Open in IMG/M
3300032828\|Ga0335080_11079784	Not Available	813	Open in IMG/M
3300033412\|Ga0310810_10011257	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	10455	Open in IMG/M
3300033433\|Ga0326726_10011495	All Organisms → cellular organisms → Bacteria	7805	Open in IMG/M
3300033433\|Ga0326726_10211320	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis	1794	Open in IMG/M
3300033433\|Ga0326726_10320510	Not Available	1457	Open in IMG/M
3300033513\|Ga0316628_102655072	Not Available	660	Open in IMG/M
3300033758\|Ga0314868_043886	Not Available	537	Open in IMG/M
3300033887\|Ga0334790_007000	All Organisms → cellular organisms → Bacteria → Proteobacteria	6584	Open in IMG/M
3300033887\|Ga0334790_016947	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	3431	Open in IMG/M
3300034090\|Ga0326723_0205310	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	873	Open in IMG/M
3300034090\|Ga0326723_0414271	Not Available	613	Open in IMG/M
3300034090\|Ga0326723_0510084	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	552	Open in IMG/M
3300034090\|Ga0326723_0609007	Not Available	506	Open in IMG/M
3300034661\|Ga0314782_139793	Not Available	585	Open in IMG/M
3300034819\|Ga0373958_0008501	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis	1665	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	75.94%
Host-Associated	Host-Associated	23.11%
Engineered	Engineered	0.94%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	65.09%
Plants	Host-Associated → Plants	23.11%
Aquatic	Environmental → Aquatic	10.85%
Solid Waste	Engineered → Solid Waste	0.47%
Modeled	Engineered → Modeled	0.47%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	59.91%
Rhizosphere	Host-Associated → Plants → Rhizosphere	14.62%
Sediment	Environmental → Aquatic → Sediment	7.55%
Rhizoplane	Host-Associated → Plants → Rhizoplane	7.55%
Peat	Environmental → Terrestrial → Peat	4.25%
Freshwater	Environmental → Aquatic → Freshwater	2.36%
Marine	Environmental → Aquatic → Marine	0.94%
Agricultural Field	Environmental → Terrestrial → Agricultural Field	0.94%
Roots	Host-Associated → Plants → Roots	0.94%
Grass	Engineered → Solid Waste → Grass	0.47%
Simulated Communities (Sequence Read Mixture)	Engineered → Modeled → Simulated Communities (Sequence Read Mixture)	0.47%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	41.98%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	10.85%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	9.43%
Loam	Environmental → Terrestrial → Soil → Loam	8.49%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	7.55%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	5.66%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	4.25%
Soil	Host-Associated → Plants → Rhizosphere → Soil	3.77%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	1.89%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	1.89%
Unclassified	Environmental → Terrestrial → Agricultural Field → Unclassified	0.94%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.94%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater	0.47%
Intertidal Zone	Environmental → Aquatic → Marine → Intertidal Zone	0.47%
Wetlands	Environmental → Aquatic → Marine → Wetlands	0.47%
Composting	Engineered → Solid Waste → Grass → Composting	0.47%
Unclassified	Engineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified	0.47%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	25.94%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	10.85%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost	8.02%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	8.02%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	7.55%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	5.66%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	5.66%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	4.25%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	3.77%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	2.83%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	2.36%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	2.36%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	1.89%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	1.89%
Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment	1.42%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	1.42%
Permafrost	Environmental → Terrestrial → Soil → Wetlands → Permafrost	1.42%
Unclassified	Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified	0.94%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	0.94%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog	0.47%
Unclassified	Environmental → Aquatic → Freshwater → Groundwater → Unclassified	0.47%
Salt Marsh	Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh	0.47%
Sediment	Environmental → Aquatic → Marine → Wetlands → Sediment	0.47%
Unclassified	Engineered → Solid Waste → Grass → Composting → Unclassified	0.47%
Unclassified	Engineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified	0.47%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	10.85%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	10.38%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	6.13%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	5.66%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	5.19%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	4.25%
Arctic Peat Soil	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil	3.77%
Peat Soil	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil	3.30%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost	2.83%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	2.36%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	1.89%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	1.89%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	1.89%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.89%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	1.89%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment	1.42%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	1.42%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	1.42%
Soil	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil	1.42%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	1.42%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	1.42%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	1.42%
Tabebuia Heterophylla Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere	1.42%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	1.42%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	1.42%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.42%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.94%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	0.94%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	0.94%
Soil	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil	0.94%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	0.94%
Soil	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil	0.94%
Soil	Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil	0.94%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	0.94%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.94%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	0.94%
Peatland	Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland	0.47%
Soil	Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil	0.47%
Salt Marsh	Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh	0.47%
Wetland	Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland	0.47%
Unplanted Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil	0.47%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	0.47%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	0.47%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	0.47%
Grass Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil	0.47%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	0.47%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	0.47%
Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland	0.47%
Prmafrost Soil	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil	0.47%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	0.47%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere	0.47%
Miscanthus Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere	0.47%
Switchgrass Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere	0.47%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.47%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.47%
Rhizosphere Soil	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil	0.47%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere	0.47%
Switchgrass, Maize And Mischanthus Litter	Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter	0.47%
Simulated	Engineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated	0.47%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2088090004	Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Permafrost Layer P1	Environmental	Open in IMG/M
2140918006	Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Permafrost Layer P1	Environmental	Open in IMG/M
2140918007	Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active_all	Environmental	Open in IMG/M
2166559005	Simulated microbial communities from Lyon, France	Engineered	Open in IMG/M
2170459013	Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis soil at the rocks surface 0-21cm	Environmental	Open in IMG/M
2170459014	Litter degradation PV2	Engineered	Open in IMG/M
2199352025	Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOIL	Environmental	Open in IMG/M
3300000313	Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Feb2011 Site B1 Cattail	Environmental	Open in IMG/M
3300000363	Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil	Environmental	Open in IMG/M
3300000364	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300000580	Forest soil microbial communities from Amazon forest - 2010 replicate II A01	Environmental	Open in IMG/M
3300000729	Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 35	Environmental	Open in IMG/M
3300000890	Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil	Environmental	Open in IMG/M
3300000956	Soil microbial communities from Great Prairies - Kansas, Native Prairie soil	Environmental	Open in IMG/M
3300003369	Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 002-22A	Environmental	Open in IMG/M
3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Host-Associated	Open in IMG/M
3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Host-Associated	Open in IMG/M
3300005713	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)	Environmental	Open in IMG/M
3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Host-Associated	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Host-Associated	Open in IMG/M
3300005938	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191	Environmental	Open in IMG/M
3300005947	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-190	Environmental	Open in IMG/M
3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Host-Associated	Open in IMG/M
3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Environmental	Open in IMG/M
3300006041	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014	Environmental	Open in IMG/M
3300006047	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013	Environmental	Open in IMG/M
3300006049	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1	Host-Associated	Open in IMG/M
3300006052	Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013	Environmental	Open in IMG/M
3300006055	Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 deep-072012	Environmental	Open in IMG/M
3300006172	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014	Environmental	Open in IMG/M
3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Environmental	Open in IMG/M
3300006174	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014	Environmental	Open in IMG/M
3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)	Host-Associated	Open in IMG/M
3300006636	Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost154B-two	Environmental	Open in IMG/M
3300006640	Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost305-11B	Environmental	Open in IMG/M
3300006806	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100	Environmental	Open in IMG/M
3300006844	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Host-Associated	Open in IMG/M
3300006845	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5	Host-Associated	Open in IMG/M
3300006871	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Host-Associated	Open in IMG/M
3300007076	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Host-Associated	Open in IMG/M
3300009029	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189	Environmental	Open in IMG/M
3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Host-Associated	Open in IMG/M
3300009090	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG	Environmental	Open in IMG/M
3300009094	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)	Host-Associated	Open in IMG/M
3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Host-Associated	Open in IMG/M
3300009100	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2	Host-Associated	Open in IMG/M
3300009147	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)	Host-Associated	Open in IMG/M
3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Host-Associated	Open in IMG/M
3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Host-Associated	Open in IMG/M
3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Host-Associated	Open in IMG/M
3300009792	Tropical forest soil microbial communities from Panama - MetaG Plot_12	Environmental	Open in IMG/M
3300010043	Tropical forest soil microbial communities from Panama - MetaG Plot_26	Environmental	Open in IMG/M
3300010046	Tropical forest soil microbial communities from Panama - MetaG Plot_36	Environmental	Open in IMG/M
3300010047	Tropical forest soil microbial communities from Panama - MetaG Plot_30	Environmental	Open in IMG/M
3300010048	Tropical forest soil microbial communities from Panama - MetaG Plot_11	Environmental	Open in IMG/M
3300010147	Soil microbial communities from California, USA to study soil gas exchange rates - BB-CA-RED metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010359	Tropical forest soil microbial communities from Panama - MetaG Plot_15	Environmental	Open in IMG/M
3300010366	Tropical forest soil microbial communities from Panama - MetaG Plot_24	Environmental	Open in IMG/M
3300010371	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1	Environmental	Open in IMG/M
3300010376	Tropical forest soil microbial communities from Panama - MetaG Plot_28	Environmental	Open in IMG/M
3300010397	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4	Environmental	Open in IMG/M
3300010398	Tropical forest soil microbial communities from Panama - MetaG Plot_35	Environmental	Open in IMG/M
3300010863	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (PacBio error correction)	Environmental	Open in IMG/M
3300011000	Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t6i015	Environmental	Open in IMG/M
3300011003	Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015	Environmental	Open in IMG/M
3300011270	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG	Environmental	Open in IMG/M
3300012010	Permafrost microbial communities from Nunavut, Canada - A7_35cm_12M	Environmental	Open in IMG/M
3300012019	Permafrost microbial communities from Nunavut, Canada - A7_5cm_12M	Environmental	Open in IMG/M
3300012200	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG	Environmental	Open in IMG/M
3300012492	Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610	Host-Associated	Open in IMG/M
3300012499	Unplanted soil (control) microbial communities from North Carolina - M.Soil.2.yng.030610	Environmental	Open in IMG/M
3300012955	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG	Environmental	Open in IMG/M
3300012961	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG	Environmental	Open in IMG/M
3300012984	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG	Environmental	Open in IMG/M
3300012985	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG	Environmental	Open in IMG/M
3300012986	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG	Environmental	Open in IMG/M
3300012989	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG	Environmental	Open in IMG/M
3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Host-Associated	Open in IMG/M
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated	Open in IMG/M
3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Host-Associated	Open in IMG/M
3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Host-Associated	Open in IMG/M
3300013503	Permafrost microbial communities from Nunavut, Canada - A23_5cm_12M	Environmental	Open in IMG/M
3300013832	Permafrost microbial communities from Nunavut, Canada - A3_5cm_0M	Environmental	Open in IMG/M
3300014058	Permafrost microbial communities from Nunavut, Canada - A3_65cm_0.25M	Environmental	Open in IMG/M
3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Host-Associated	Open in IMG/M
3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Host-Associated	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300015372	Soil combined assembly	Host-Associated	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Host-Associated	Open in IMG/M
3300017930	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5	Environmental	Open in IMG/M
3300017936	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1	Environmental	Open in IMG/M
3300017939	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG	Environmental	Open in IMG/M
3300017944	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG	Environmental	Open in IMG/M
3300017947	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG	Environmental	Open in IMG/M
3300017959	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG	Environmental	Open in IMG/M
3300017966	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG	Environmental	Open in IMG/M
3300017974	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG	Environmental	Open in IMG/M
3300017994	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2	Environmental	Open in IMG/M
3300018028	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex	Environmental	Open in IMG/M
3300018029	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MG	Environmental	Open in IMG/M
3300018030	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100	Environmental	Open in IMG/M
3300018031	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1	Environmental	Open in IMG/M
3300018058	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG	Environmental	Open in IMG/M
3300018060	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG	Environmental	Open in IMG/M
3300018072	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2	Environmental	Open in IMG/M
3300018081	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1	Environmental	Open in IMG/M
3300019878	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m2	Environmental	Open in IMG/M
3300019888	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2	Environmental	Open in IMG/M
3300020006	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2	Environmental	Open in IMG/M
3300021510	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_coex	Environmental	Open in IMG/M
3300021560	Tropical forest soil microbial communities from Panama - MetaG Plot_4	Environmental	Open in IMG/M
3300022534	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1	Environmental	Open in IMG/M
3300022883	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S066-202C-4	Environmental	Open in IMG/M
3300022892	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S169-409R-5	Environmental	Open in IMG/M
3300025271	Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes)	Environmental	Open in IMG/M
3300025457	Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 shallow-092012 (SPAdes)	Environmental	Open in IMG/M
3300025474	Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-3 deep-072012 (SPAdes)	Environmental	Open in IMG/M
3300025484	Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210 deep-092012 (SPAdes)	Environmental	Open in IMG/M
3300025505	Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-1 deep-072012 (SPAdes)	Environmental	Open in IMG/M
3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)	Environmental	Open in IMG/M
3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)	Environmental	Open in IMG/M
3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026746	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G06K2-12 (SPAdes)	Environmental	Open in IMG/M
3300026833	Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 54 (SPAdes)	Environmental	Open in IMG/M
3300026921	Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 28 (SPAdes)	Environmental	Open in IMG/M
3300027680	Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 80 (SPAdes)	Environmental	Open in IMG/M
3300027909	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)	Host-Associated	Open in IMG/M
3300027915	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes)	Environmental	Open in IMG/M
3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300028715	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203	Environmental	Open in IMG/M
3300028718	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194	Environmental	Open in IMG/M
3300028787	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381	Environmental	Open in IMG/M
3300028791	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144	Environmental	Open in IMG/M
3300028799	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123	Environmental	Open in IMG/M
3300028814	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183	Environmental	Open in IMG/M
3300028885	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185	Environmental	Open in IMG/M
3300030989	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_197 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031058	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031170	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S	Environmental	Open in IMG/M
3300031231	Coassembly Site 11 (all samples) - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031360	Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - SW1603-40	Environmental	Open in IMG/M
3300031446	Fir Summer Coassembly Site 11 - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031740	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05	Environmental	Open in IMG/M
3300031819	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21	Environmental	Open in IMG/M
3300031854	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1	Environmental	Open in IMG/M
3300031858	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2	Environmental	Open in IMG/M
3300032782	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1	Environmental	Open in IMG/M
3300032828	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4	Environmental	Open in IMG/M
3300033412	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC	Environmental	Open in IMG/M
3300033433	Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN	Environmental	Open in IMG/M
3300033513	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C	Environmental	Open in IMG/M
3300033758	Tropical peat soil microbial communities from peatlands in Loreto, Peru - SR_A	Environmental	Open in IMG/M
3300033887	Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-1-X1	Environmental	Open in IMG/M
3300034090	Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N	Environmental	Open in IMG/M
3300034661	Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R3 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300034819	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1	Host-Associated	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
P1_DRAFT_00395310	2088090004	Soil	MLAYVVSEGRLFALKPSEWSMLLVGVALCGFVTLLF
P1_C_00565190	2140918006	Soil	AMLAYVVSEGRLFALKPSEWSMLLVGVALCGFVTLLF
A_all_C_02829180	2140918007	Soil	MQRVSAIMSYVVNDGRLFALKPSEWSMLLFGLALCGFVMLFF
cont_0713.00003800	2166559005	Simulated	MGISMLAYVVSEGRLFALKPSEWSLLLGGVMFCGLLTLLFG
N57_03312410	2170459013	Grass Soil	MMAYVVNDGRLLALKPSEWFLMLGGVALTGFLTLLI
2PV_00657880	2170459014	Switchgrass, Maize And Mischanthus Litter	MMAYVVSEGRLCALKPAEWSLLLSGVVLCGIATLLFLMLHA
deepsgr_00276000	2199352025	Soil	MLAYVVSEGRLFALKPSEWSLLLGGVMFCGLLTLLFG
deepsgr_03306890	2199352025	Soil	MLAYVKSDGRLFGLNSSEWSMLLGGVTLCGLLTLLLAG
deepsgr_03400270	2199352025	Soil	MMAYVISEGRLFGLKPSEWSLMLVGVALCGLMTLLF
WSSedB1CaDRAFT_100570022	3300000313	Wetland	MMAYVVSDGRLFALKPSEWSLLLVGVALCGLFALLL*
ICChiseqgaiiFebDRAFT_108580291	3300000363	Soil	MLAYVKSEGRLFGLNPSEWSMLLGGVILCGLLTLLLTA*
INPhiseqgaiiFebDRAFT_1007651742	3300000364	Soil	AMLAYVVSEGRLFALKPSDWSMLLGGVTLCGLMTLLLG*
AF_2010_repII_A01DRAFT_10006656	3300000580	Forest Soil	MVSPINVSAAGLAMLAYVVSEGRFFALKPSDWSLLLGGVMFCGLLTLVFG*
JGI12371J11900_10091791	3300000729	Tropical Forest Soil	ATLAYVVSEGRLFALTPSEWSILLVGGALCRFVEQLF*
JGI11643J12802_115699731	3300000890	Soil	MQRVTAMMAYVVSEGRLCALKPAEWSLLLTGVAVCGI
JGI10216J12902_1065151722	3300000956	Soil	SARMVSLQTNSAAGLTMLAYVVSEGRFFALKPSDWSLLLGGVMFCGLLTLVFG*
JGI24140J50213_100949991	3300003369	Arctic Peat Soil	VSAMLAYVVSEGRLFALKPSEWSMLLVGVALCGFVTLLF*
Ga0068855_1017666742	3300005563	Corn Rhizosphere	MMAYVVNDGRLLALKPSEWFLMLTGVALTGFLALLF*
Ga0070664_1006847042	3300005564	Corn Rhizosphere	MLAYVVSEGRFFALKPSDWSLLLGGVMFCGLLTLVFG*
Ga0066905_1000027052	3300005713	Tropical Forest Soil	MLAYVVSEGRLFALKPSDWSMLLGGVILCGLMTLLLG*
Ga0066905_1000055184	3300005713	Tropical Forest Soil	MLAYVVSEGRLFALKPSDWSMLLGGVTLCGILTLLLG*
Ga0066905_1002616403	3300005713	Tropical Forest Soil	MLAYVVSEGRLFALKPSEWSMLLGGVTLCGLLALLLG*
Ga0066905_1004629422	3300005713	Tropical Forest Soil	MLAYVVSEGRFFALKPSDWSLLLGGVMLCGLLTLVFG*
Ga0068866_109159471	3300005718	Miscanthus Rhizosphere	MMAYVISEGRLFGLKPSEWSLMLVGVALCGLMTLLF*
Ga0066903_1000159017	3300005764	Tropical Forest Soil	MMTYVISEGRLFGLTPSEWSMMLGGVALCGLMTLLF*
Ga0066903_1011952312	3300005764	Tropical Forest Soil	MLAYVLSEGRFFALKPSDWSLLLGGVMFCGLLTLVFG*
Ga0066903_1055668241	3300005764	Tropical Forest Soil	MMSYVVSEGRLFALKPSEWLILLIGVALSGLLTLLLLL*
Ga0081455_100084755	3300005937	Tabebuia Heterophylla Rhizosphere	MLAYVVSEGRLFALKPSDWSMLLGGVTLCGLMTLLLG*
Ga0081455_100543376	3300005937	Tabebuia Heterophylla Rhizosphere	MMAYVASEGRLFALKPSEWGILLVGVALCGFATLLF*
Ga0066795_100583861	3300005938	Soil	MLAYVVSEGRLFALKPSEWSMLLVGVALCGFVTLLF*
Ga0066794_101837232	3300005947	Soil	LAYVVSEGRLFALKPSEWSMLLVGVALCGFVTLLF*
Ga0081540_10206108	3300005983	Tabebuia Heterophylla Rhizosphere	MLAYVKNEGRLFGLNPSEWSVLLGGVILCGLLTLLLTA*
Ga0070717_114563592	3300006028	Corn, Switchgrass And Miscanthus Rhizosphere	MMAYVVNDGRLLALKPSEWFLMLAGVALTGFLALLI*
Ga0075023_1001610082	3300006041	Watersheds	MMTYVISEGRLFALKPSEWAMMLVGVALCGFITLLF*
Ga0075024_1001937361	3300006047	Watersheds	MERVSALMAYVVSEGRLCALKPSEWSLLLAGVALCGF
Ga0075024_1005465592	3300006047	Watersheds	MHMMAYVISEGRLLGLDAAEWSIMLVGVVLCGFVALLF*
Ga0075417_101994483	3300006049	Populus Rhizosphere	MLAYVVSEGRLFALNPSEWAMLLVGVAACGFLTLLF*
Ga0075029_1002990762	3300006052	Watersheds	MMAYVVSDGRLFALKPSEWSLLLVGVALCGLIALLL*
Ga0075029_1008669251	3300006052	Watersheds	MMAYVVSDGRLFALKLSEWSMLLVGVTLCGFIALLF*
Ga0097691_10907182	3300006055	Arctic Peat Soil	MMAYLISDGRLLALKPSEWSALLVGVALCGMAVLLF*
Ga0075018_100094655	3300006172	Watersheds	MMAYVVSEGRLFALKPSEWTMLLVGVALCGFITLLF*
Ga0070716_1000877332	3300006173	Corn, Switchgrass And Miscanthus Rhizosphere	MMAYVVNEGRLLALKPSEWAMMLGGVALCGLIALLF*
Ga0075014_1001792792	3300006174	Watersheds	MQSLSAMMACVVSEGRLFALKPSEWSMLLVGVALCGFIALLF*
Ga0097621_1012635941	3300006237	Miscanthus Rhizosphere	MMTYVISEGRLFGLKPSEWSLMLVGVALCGLMTLLF
Ga0075525_100312123	3300006636	Arctic Peat Soil	LAYVVSEGRLFALNPSEWSMLLVGVALCGFVTLLF*
Ga0075527_100857251	3300006640	Arctic Peat Soil	MAYVVSDGRLFALKPSEWSVLLVGVALCGVVTLLF*
Ga0079220_101588981	3300006806	Agricultural Soil	MLSFVISEGRFFALKPSDWSMLLGGVALCGLLALLF*
Ga0075428_1003270973	3300006844	Populus Rhizosphere	APAMLAYVVSEGRLFALNPSEWAMLLVGVAACGFLTLLF*
Ga0075421_1019066241	3300006845	Populus Rhizosphere	SRYVLGHKLRVRAMLAYVVSDGRLFALKPSEWTMLLVGVAACGFLALLF*
Ga0075434_1002895523	3300006871	Populus Rhizosphere	QRGSAMLAYVVSEGRLFALKPSDWSMLLGGVTLCGLMTLLLG*
Ga0075435_1009513722	3300007076	Populus Rhizosphere	MMAYVMSDGRLFALKPSEWAMLLFGVASCGFLAVLFSV*
Ga0066793_100883324	3300009029	Prmafrost Soil	MMAYVVSDGRLFALKPSEWSVLLVGVALCGVVTLLF*
Ga0105244_103627482	3300009036	Miscanthus Rhizosphere	MMAYVVSEGRLCALKPAEWSLLLTGVALCGVATLLFLMLHA*
Ga0099827_119487933	3300009090	Vadose Zone Soil	VSAIMSYVVSEGRVCALKPSEWSLLLVGVALCGIVALLL*
Ga0111539_105825872	3300009094	Populus Rhizosphere	MLAYVVSDGRLFALKPSEWAVLVVGVAICGLVTLFFSV*
Ga0111539_130615181	3300009094	Populus Rhizosphere	MLAYLVSDGRSLALKPPEWAVLLSGAAVCGFLTVFF
Ga0105245_108382451	3300009098	Miscanthus Rhizosphere	TAMMAYVVSEGRLCALKPAEWSLLLTGVALCGIATLLFLMLHA*
Ga0075418_100456018	3300009100	Populus Rhizosphere	MMAYVASEGTLFALKPSEWGILVVGVALCGFATLLF*
Ga0114129_101275697	3300009147	Populus Rhizosphere	MLAYVVSEGRLFALNPSDWAMLLVGVALCGFGTLLF*
Ga0114129_118965231	3300009147	Populus Rhizosphere	RVPAMLAYVMSDGRLFALKASKWAVLLVGVVLCGFLTLVFSV*
Ga0105243_104522163	3300009148	Miscanthus Rhizosphere	MMAYVVSEGRLCALKPAEWSLLLTGVALCGIATLLFLMLHA*
Ga0105241_122227701	3300009174	Corn Rhizosphere	AAGLTMLAYVVSEGRFFALKPSDWSLLLGGVMFCGLLTLVFG*
Ga0105249_134318262	3300009553	Switchgrass Rhizosphere	EGRLCALKPAEWSLLLAGVTLCGIATLLFLMLHA*
Ga0126374_105336212	3300009792	Tropical Forest Soil	MMTYVIGEGRLFGLTPSEWSMMLGGVALCGFITLLF*
Ga0126374_107052871	3300009792	Tropical Forest Soil	MMTYVISEGRLLGLTPSEWSMMLGGVALCGFITLLF*
Ga0126380_100088532	3300010043	Tropical Forest Soil	MLTYVKGDGRLFGLNPSEWSMLIGGVILCGFVTLLLTA*
Ga0126380_100129596	3300010043	Tropical Forest Soil	MMTYVISEGRLFGLTPSEWSMMLGGVAICGIITLLF*
Ga0126380_100681263	3300010043	Tropical Forest Soil	LAMLAYVVSEGRFFALKPSDWSLLLGGGLLFKIKTLVFG*
Ga0126380_103848392	3300010043	Tropical Forest Soil	MLAYVVSDGRLFALKPSEWTILFVGVAACGFLTLLF*
Ga0126384_100931121	3300010046	Tropical Forest Soil	SPINVSAAGLAMLAYVVSEGRFFALKPSDWSLLLGGVMFCGLLTLVFG*
Ga0126384_104150792	3300010046	Tropical Forest Soil	MLAYVVSDGRLFALKPSEWAMLLVGVAVCGFLTLLF*
Ga0126382_1000295610	3300010047	Tropical Forest Soil	AMLAYVVSEGRFFALKPSDWSLLLGGVMFCGLLTLVFG*
Ga0126382_118589991	3300010047	Tropical Forest Soil	AVRQRVFAMLTYVKSDGRLFALNPSEWSMLIGGVILCGLLTLLLTA*
Ga0126373_100423956	3300010048	Tropical Forest Soil	MMTYVIGEGRLFGLTPSEWSMMLGGVAICGIITLLF*
Ga0126319_14112181	3300010147	Soil	EYMQMMAYVISEGRLFGLKPSEWSLMLVGVALCGLMTLLF*
Ga0126376_116433421	3300010359	Tropical Forest Soil	MMAYVVNEGRLCALKPSEWSLLLAGVTLCGAATLLFLMVHA*
Ga0126376_124572481	3300010359	Tropical Forest Soil	SAMLTYVMSDGRLFGLNSSEWSMLIGGVILCGFLTLLLV*
Ga0126376_129563671	3300010359	Tropical Forest Soil	MLAYVISEGRLFELKPSEWAMMLGGVALCGFMALLFG*
Ga0126376_132437481	3300010359	Tropical Forest Soil	MMTYVISDGRLLGLTPSEWSMMLGGVALCGFITLLF*
Ga0126379_107999921	3300010366	Tropical Forest Soil	NDSAAGLAMLAYVVSEGRFFALKPSDWSLLLGGVMLCGLLTLVFG*
Ga0126379_125345231	3300010366	Tropical Forest Soil	MVSHNDSAAGLAMLAYVVSAGRFFALKPSDWSLLLGGVMLCGLLTLV
Ga0134125_130102121	3300010371	Terrestrial Soil	MLEYVVSEGRLFALKPSEWSMLLGGVTLCGLLTLLF
Ga0126381_1011197542	3300010376	Tropical Forest Soil	MLTYVKSDGRLFGLNPSEWSMLIGGVILCGLLTLLLTA*
Ga0134124_100371021	3300010397	Terrestrial Soil	VALQPSRGSARMVSPQTNSAAGLTMLAYVVSEGRFFALKPSDWSLLLGGVMFCGLLTLVFG*
Ga0126383_124075521	3300010398	Tropical Forest Soil	MLMYVKGDGRLFGLSPSEWSILIGGVILCGFLTLLL
Ga0124850_10073785	3300010863	Tropical Forest Soil	MMTFVISEGRLFGLTPSEWSLMLGGVALCGFIKLLF*
Ga0138513_1000095583	3300011000	Soil	MLAYVVSEGRLFALNPSDWAMLLVGVALCGFVTLLF*
Ga0138514_1001022762	3300011003	Soil	MMAYVASEGRLFALKPSEWGILLGGVALCGFATLLF*
Ga0137391_101226502	3300011270	Vadose Zone Soil	MSYVVSEGRVCALKPSEWSLLLVGVALCGIVALLL*
Ga0120118_10296323	3300012010	Permafrost	MQSVSAMMAYVVSEGRLCALKPSDWAMLLVGVALCGFIALLF*
Ga0120139_10719083	3300012019	Permafrost	MQSVSAMMAYVVNYGRLCALKPSEWSMLLVGVIIYGFIALLF*
Ga0137382_101372473	3300012200	Vadose Zone Soil	MLAYVMSEGRLFALNPSDWAMLLVGVTLCGLGTLLF*
Ga0157335_10223632	3300012492	Arabidopsis Rhizosphere	QPSRGSARMVSPQTNSAAGLTMLAYVVSEGRFFALKPSDWSLLLGGVMFCGLLTLVFG*
Ga0157350_10428512	3300012499	Unplanted Soil	SPQTNSAAGLTMLAYVVSEGRFFALKPSDWSLLLGGVMFCGLLTLVFG*
Ga0164298_102176341	3300012955	Soil	MMAYVISEGRLFGLKPSEWSLMLVGGALCIIMTLLF*
Ga0164298_113623862	3300012955	Soil	SAAGLAMLAYVLSEGRFFALKPSDWSLLLGGVMFCGLLTLVFG*
Ga0164302_100427224	3300012961	Soil	YVVSEGRFFALKPSDWSLLLGGVMFCGLLTLVFG*
Ga0164309_104125562	3300012984	Soil	MSMLSYVISEGRLFALKPSDWSMLLGGVALCGLLALLF*
Ga0164308_100398523	3300012985	Soil	MMAYVVNDGRLLALKPSEWFLMLAGVAFTGFLTLLV*
Ga0164304_100259212	3300012986	Soil	MMAYVVNDGRLLALKPSELFLMLAGVALTGFLALLI*
Ga0164305_107951812	3300012989	Soil	AYVVSEGRFFALKPSDWSLLLGGVMFCGLLTLLFG*
Ga0157374_107593681	3300013296	Miscanthus Rhizosphere	QTNSAAGLTMLAYVVSEGRFFALKPSDWSLLLGGVMFCGLLTLVFG*
Ga0157378_107229081	3300013297	Miscanthus Rhizosphere	MRMMAYVISEGRLFGLKPSEWSLMLVGVALCGLMTLLF*
Ga0157378_110422491	3300013297	Miscanthus Rhizosphere	MMAYVISEGRLFGLKPSEWSLMLVGVALCGLMTLL
Ga0163162_122145561	3300013306	Switchgrass Rhizosphere	NSAAGLTMLAYVVSEGRFFALKPSDWSLLLGGVMFCGLLTLVFG*
Ga0157372_129236971	3300013307	Corn Rhizosphere	ESINDSAAGLTMLAYVVSEGRFFALKPSDWSLLLGGVMFCGLLTLVFG*
Ga0120127_100408162	3300013503	Permafrost	MMAYVVSDGRVFALKPSEWSMLLVGVAICGFVTLLF*
Ga0120127_100705271	3300013503	Permafrost	MMAYLINDGRLLALKPSEWSTLLVGVALCGIAVLLF*
Ga0120132_10015874	3300013832	Permafrost	MMAYLFSDGRLLALKPSEWSTLIVGVALCGIAILLF*
Ga0120149_10639522	3300014058	Permafrost	MQSVSAMMAYVVSEGRLCALKPSEWSMLLVGVIICGFIALLF*
Ga0163163_100193666	3300014325	Switchgrass Rhizosphere	MMAYVVSEGRLCALKPAEWSLLLTGVALCGVATLLFLVLHA*
Ga0157376_128378601	3300014969	Miscanthus Rhizosphere	CPYGEPINDSAAGLTMLAYVVSEGRFFALKPSDWSLLLGGVMFCGLLTLVFG*
Ga0132258_108306311	3300015371	Arabidopsis Rhizosphere	VVSEGRVCALKPAEWLLLLTGVALCGIATLLFLMLHA*
Ga0132258_112228913	3300015371	Arabidopsis Rhizosphere	MLTYVKGDGRLFGLDPSEWSMLIGGVILCGFFTLLLTA*
Ga0132258_128941651	3300015371	Arabidopsis Rhizosphere	MMAYVVSEGRVFALKPSEWGMLLIGVALCGFATLFF*
Ga0132256_1020692872	3300015372	Arabidopsis Rhizosphere	MMTYVISEGRLFGLTPAEWSMMLGGVAICGIITLLF*
Ga0132255_1000816581	3300015374	Arabidopsis Rhizosphere	MQRVTAIMAYVVSEGRLCALRPAEWSLLLFGVALCG
Ga0163161_110938532	3300017792	Switchgrass Rhizosphere	MMAYVISDGRLFALKPSEWAMLLFGVASCGFLAVLFSV
Ga0187825_101364513	3300017930	Freshwater Sediment	MMAYVVSDGRLLALKPSEWSMLLVGVALCGMLVLLFTAN
Ga0187821_103944422	3300017936	Freshwater Sediment	AMMACVVSEGRLCALKPSEWSMLLVGVALCGFIALLF
Ga0187775_100009097	3300017939	Tropical Peatland	MLSFVISEGRLFALKPSDWSMLLGGVALCGLLALLF
Ga0187786_100318362	3300017944	Tropical Peatland	MVEFVISEGRLFALKPSEWSMLLGGVMFCGLLTLLF
Ga0187785_100035563	3300017947	Tropical Peatland	MHMIAYVISEGRLFGLDAAEWSIMLVGVALCGFVALLF
Ga0187785_100063073	3300017947	Tropical Peatland	MMTYVVSDGRLLGLNPAEWSIMLVGVALCGFMTLLF
Ga0187785_100657482	3300017947	Tropical Peatland	MVSHINDSAAGLAMLAYVVSEGRFFALKPSDWSLLLGGVMLCGLLTLVFG
Ga0187779_100177442	3300017959	Tropical Peatland	MLSYVINEGRLFALKPSDWSMLLGGVALCGLLALLF
Ga0187776_115731222	3300017966	Tropical Peatland	MMAYIVSEGRLFALKPSEWSMLLVGVTLCGFAALLF
Ga0187777_100003233	3300017974	Tropical Peatland	MMAYVVSEGRLFALKPSDWLILLIGVSFAGLLALLL
Ga0187777_100908732	3300017974	Tropical Peatland	MLAYVVSEGRFFALKPSDWSLLLGGVMLCGLVTLVLG
Ga0187777_108638422	3300017974	Tropical Peatland	MLTYVKGDGRLFGLNPSEWSMLIGGVILCGFFTLLLTA
Ga0187822_101845982	3300017994	Freshwater Sediment	MMAYVVSDGRLLALKPSEWSVLLVGVALCGMLVLLFTAN
Ga0184608_102862631	3300018028	Groundwater Sediment	MLAYVVSEGRLFALKPSEWSLLLGGVFCGLLTLLFG
Ga0187787_103413461	3300018029	Tropical Peatland	VLPKMMMYAVSEGRLCALKPSEWSILLMGVALCGILTLLF
Ga0187869_106319821	3300018030	Peatland	EGKTAMMAYVVSEGRLCGLKPSDWSVLLVAVALCGSLTLLF
Ga0184634_104244621	3300018031	Groundwater Sediment	MMAYVASEGRLFALKPSEWGILLGGVALCGFATLLF
Ga0187766_100396813	3300018058	Tropical Peatland	MMAYVVSEGRLFALKPSDWLILLIGVSFAGLMALLL
Ga0187765_100662823	3300018060	Tropical Peatland	MMTFVISEGRLFGLTPAEWSMMLGGVAICGIITLLF
Ga0184635_100523403	3300018072	Groundwater Sediment	MMTYVASEGRLFALKPSEWGILLGGVALCGFATLLF
Ga0184625_101279472	3300018081	Groundwater Sediment	MMAYVASEGRLFALKPSEWGILLVGVALCGFATLLF
Ga0184625_101570912	3300018081	Groundwater Sediment	MLAYVKSDGRLFGLNSSDWSMLLGGVTLCGLLTLLLTG
Ga0193715_11073282	3300019878	Soil	TMLAYVVSEGRLFALKPSEWSLLLGGVMFCGLLTLLFG
Ga0193751_11077261	3300019888	Soil	MSFVVSEGRVCALKPSEWSLLLVGVALCGIVALLL
Ga0193735_10977123	3300020006	Soil	MLAYVVSEGRLFALNPSDWAMLLVGVALCGFVTLLF
Ga0222621_10420451	3300021510	Groundwater Sediment	MLAYVLSEGRLFALNLSDWAMLLVGVALCGFVTLLF
Ga0126371_100121212	3300021560	Tropical Forest Soil	MLTYVKGDGRLFGLNPSEWSMLIGGVILCGFVTLLLTA
Ga0126371_104225721	3300021560	Tropical Forest Soil	MLTYVKSDGRLFGLNPSEWSMLIGGVILCGLLTLLLTA
Ga0126371_106161903	3300021560	Tropical Forest Soil	MVSPINVSAAGLAMLAYVVSEGRFFALKPSDWSLLLGGVMFCGLLTLVFG
Ga0224452_10259294	3300022534	Groundwater Sediment	MLAYVMSEGRLFALNPSDWAMLLVGVTLCGFGTLLF
Ga0247786_10245773	3300022883	Soil	AMMAYVVSEGRLCALKPAEWSLLLTGVALCGIATLLFLMLHA
Ga0247753_10036464	3300022892	Soil	SEGRLCALKPAEWSLLLTGVALCGIATLLFLMLHA
Ga0207666_10575871	3300025271	Corn, Switchgrass And Miscanthus Rhizosphere	MQRVTAMMAYVVSEGRVCALKPAEWSLLLTGVALCG
Ga0208850_10042795	3300025457	Arctic Peat Soil	LAYVVSEGRLFALKPSEWSMLLVGVALCGFVTLLF
Ga0208479_10813612	3300025474	Arctic Peat Soil	MMAYVISDGRLLALKPSEWSTLLAGVALCGIAVLLF
Ga0208587_10777471	3300025484	Arctic Peat Soil	MMAYVVSDGRLFALKPSEWSVLLVGVALCGVVTLLF
Ga0207929_10010512	3300025505	Arctic Peat Soil	MMAYVVSDGRVFALKPSEWSMLLVGVAICGFVTLLF
Ga0207710_100107434	3300025900	Switchgrass Rhizosphere	MLAYVVSEGRFFALKPSDWSLLLGGVMFCGLLTLVFG
Ga0207680_101165062	3300025903	Switchgrass Rhizosphere	YMRMMAYVISEGRLFGLKPSEWSLMLVGVALCGLMTLLF
Ga0207699_108588871	3300025906	Corn, Switchgrass And Miscanthus Rhizosphere	MMAYVVNDGRLLALKPSEWFLMLAGVTLTGFLALLI
Ga0207707_100493713	3300025912	Corn Rhizosphere	MMAYVVNDGRLLALKPSEWFLMLTGVALTGFLALLF
Ga0207660_106248331	3300025917	Corn Rhizosphere	MQRVTAMMAYVVSEGRLCALKPAEWSLLLIGVALCGIA
Ga0207700_102697651	3300025928	Corn, Switchgrass And Miscanthus Rhizosphere	ARMVSPQTNSAAGLTMLAYVVSEGRFFALKPSDWSLLLGGVMFCGLLTLVFG
Ga0207644_103971701	3300025931	Switchgrass Rhizosphere	QRVSTEYMQMMAYVISEGRLFGLKPSEWSLMLVGVALCGLMTLLF
Ga0207706_111858572	3300025933	Corn Rhizosphere	MMAYVVSEGRLCALKPAEWSLLLTGVALCGIATLLFLMLHA
Ga0207712_120981921	3300025961	Switchgrass Rhizosphere	MLAYVVSEGRFFALKPSDWSLLLGGVMFCGLLTLV
Ga0207668_120730501	3300025972	Switchgrass Rhizosphere	SEGRLCALKPAEWSLLLAGVTLCGIATLLFLMLHA
Ga0207640_105735611	3300025981	Corn Rhizosphere	ATVQRISTEYMRMMAYVISEGRLFGLKPSEWSLMLVGVALCGLMTLLF
Ga0207658_101524944	3300025986	Switchgrass Rhizosphere	SAGLSEGRLCALKPAEWSLLLTGVALCGVATLLFLMLHA
Ga0207703_111852141	3300026035	Switchgrass Rhizosphere	MVSLQTNSAAGLTMLAYVVSEGRFFALKPSDWSLLLGGVMFCGLLTLVFG
Ga0207641_112483452	3300026088	Switchgrass Rhizosphere	VSSEYMQMMTYVISEGRLFGLKPSEWSLMLVGVALCGLMTLLF
Ga0207454_1039961	3300026746	Soil	MMAYVVSEGRVCALKPAEWSLLLTGVALCGIATLLFLMLHA
Ga0207728_1174751	3300026833	Tropical Forest Soil	SATLAYVVSEGRLFALTPSEWSILLVGGALCRFVEQLF
Ga0207860_10108231	3300026921	Tropical Forest Soil	LPLRYSAWHDSTAGFYVLSYVVSEGRLFALKPSEWSMLLCGVALCGLL
Ga0207826_10706651	3300027680	Tropical Forest Soil	LAYVVSEGRLFALTPSEWSILLVGGALCRFVEQLF
Ga0209382_102778831	3300027909	Populus Rhizosphere	MMAYVASEGTLFALKPSEWGILVVGVALCGFATLLF
Ga0209069_100233731	3300027915	Watersheds	MMAYVVSEGRLFALKPSEWTMLLVGVALCGFITLLF
Ga0209069_106480151	3300027915	Watersheds	MHMMAYVISEGRLLGLDAAEWSIMLVGVVLCGFVALLF
Ga0268264_126872112	3300028381	Switchgrass Rhizosphere	MQRVTAMMAYVVSEGRLCALKPAEWSLLLTGVALCGIATLLFL
Ga0307313_100552812	3300028715	Soil	MLAYVVSEGRLFALNPSDWAMLLVGVTLCGLGTLLF
Ga0307313_102683642	3300028715	Soil	MLAYVLSEGRLFALNPSDWAMLLVGVTLCGFGTLLF
Ga0307307_101959031	3300028718	Soil	MMAYVVIEGRLFALKSSEWSMLLVGVALCGFLTMLF
Ga0307323_100896282	3300028787	Soil	NSTTGITMLAYVVSEGRLFALKPSEWSLLLGGVMFCGLLTLLFG
Ga0307290_103625952	3300028791	Soil	MMAYVVSEGRLFALKPSEWSMLLVGVALCGFLTMLF
Ga0307284_103333402	3300028799	Soil	YLGHEQRAPAMLAYVMSEGRLFALNPSDWAMLLVGVTLCGFGTLLF
Ga0307302_100704072	3300028814	Soil	MLAYVVSEGRLFALKPSEWSMLLGGVTLCGLLTLLF
Ga0307304_103139052	3300028885	Soil	MLAYVVSEGRLFALNPSDWAMLLIGVALCGLPILGPANERA
Ga0308196_10544452	3300030989	Soil	HEQRAPAMLAYVVSEGRLFALNPSDWAMLLVGVALCGFVTLLF
Ga0308189_101668951	3300031058	Soil	SEHLRCWRYVLSEGRLFALNPSDWAMLLVGVTLCGLGTLLF
Ga0307498_100173301	3300031170	Soil	MAYVASEGRLFALKPSEWGILLGGVALCGFATLLF
Ga0307498_102685831	3300031170	Soil	ITMLAYVVSEGRLFALKPSEWSLLLGGVMFCGLLTLLFG
Ga0170824_1162929382	3300031231	Forest Soil	MMAYVVNDGRLLALKPSEWFLMLAGVALTGLLALLM
Ga0307444_10645003	3300031360	Salt Marsh	MKAYLVSDGRLFALKPSEWAMLLVGVAICGLAALLF
Ga0170820_156281942	3300031446	Forest Soil	MMAYVVNDGRLLALKPSEWFLMLAGVALTGFLTLLI
Ga0307468_1017116933	3300031740	Hardwood Forest Soil	MLAYVVSEGRFFALKPSDWSLLLGGVMFCGLLTLLFG
Ga0318568_103426551	3300031819	Soil	NDSAAGLAMLAYVVSEGRFFALKPSDWSLLLGGVMLCGLLTLVFG
Ga0310904_102483691	3300031854	Soil	MMAYVVSEGRVFALKPSEWGMLLIGVALCGFATLFF
Ga0310892_102514281	3300031858	Soil	ARVCPYGESINDSAAGLTMLAYVVSEGRFFALKPSDWSLLLGGVMFCGLLTLVFG
Ga0335082_107452701	3300032782	Soil	MLSFVISEGRFFALKPSDWSMLLGGVALCGLLALLF
Ga0335080_110797841	3300032828	Soil	MVEFVISEGRLFALKPSEWSMLLGGVVFCGLLTLLF
Ga0310810_1001125711	3300033412	Soil	MLAYVVSDGRLLQLKPSDWTFLLVGICLCGMLTVFA
Ga0326726_100114954	3300033433	Peat Soil	MMTYVVSEGRLFALKPSEWAMMLVGVALCGFITLLF
Ga0326726_102113203	3300033433	Peat Soil	MAYVVSEGRLCALKPSEWSLLLAGVALCGFATLVFLISGL
Ga0326726_103205101	3300033433	Peat Soil	MIAYIVSEGRVFELKPSEWAIMLVGVALCGFIALLF
Ga0316628_1026550721	3300033513	Soil	MMAYVVSDGRLFALKPSEWSLLLVGVALCGLIALLL
Ga0314868_043886_430_537	3300033758	Peatland	MQRVAALMSYVVNEGRVCALKPSEWSLLLAGVALCG
Ga0334790_007000_3241_3351	3300033887	Soil	MMAYVISDGRLLALRPSEWSTLLVGVALCGIAVLLF
Ga0334790_016947_389_499	3300033887	Soil	MMAYVVSDGRVFALKPSEWSMLLVGVTICGFVTLLF
Ga0326723_0205310_691_798	3300034090	Peat Soil	MSYVVSEGRLFELKPSEWAMMLVGVALCGLITLLF
Ga0326723_0414271_310_420	3300034090	Peat Soil	MMAYVVSEGRLFALKPLDWGMLLVGVALCGFVSLLF
Ga0326723_0510084_365_475	3300034090	Peat Soil	MMAYVVSEGRLFALKPSEWSMLLAGVAICGVATLLF
Ga0326723_0609007_365_475	3300034090	Peat Soil	MLAYVASDGRLFALKPSEWAMLLVGVAVCGFLTMLF
Ga0314782_139793_470_583	3300034661	Soil	RMMAYVISEGRLFGLKPSEWSLMLVGVALCGLMTLLF
Ga0373958_0008501_1541_1663	3300034819	Rhizosphere Soil	MQRVTAMMAYVVSEGRLCALKPAEWSFLLVGVTLCGIATLL

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.37
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.37
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F022968

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign