Basic Information | |
---|---|
Family ID | F023324 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 210 |
Average Sequence Length | 42 residues |
Representative Sequence | LAGETDLKTLGAAALAGFLGPVLKWLDPSATEFGRGKK |
Number of Associated Samples | 128 |
Number of Associated Scaffolds | 210 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 0.48 % |
% of genes near scaffold ends (potentially truncated) | 98.10 % |
% of genes from short scaffolds (< 2000 bps) | 83.81 % |
Associated GOLD sequencing projects | 121 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.41 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (42.381 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (25.238 % of family members) |
Environment Ontology (ENVO) | Unclassified (53.333 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (56.667 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 34.85% β-sheet: 0.00% Coil/Unstructured: 65.15% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 210 Family Scaffolds |
---|---|---|
PF02467 | Whib | 11.90 |
PF12705 | PDDEXK_1 | 10.48 |
PF07659 | DUF1599 | 4.76 |
PF00227 | Proteasome | 3.81 |
PF09723 | Zn-ribbon_8 | 2.38 |
PF01391 | Collagen | 1.90 |
PF01844 | HNH | 1.90 |
PF13578 | Methyltransf_24 | 1.43 |
PF13481 | AAA_25 | 0.95 |
PF01755 | Glyco_transf_25 | 0.95 |
PF01930 | Cas_Cas4 | 0.95 |
PF13155 | Toprim_2 | 0.95 |
PF01807 | zf-CHC2 | 0.48 |
PF13362 | Toprim_3 | 0.48 |
PF02945 | Endonuclease_7 | 0.48 |
PF02767 | DNA_pol3_beta_2 | 0.48 |
COG ID | Name | Functional Category | % Frequency in 210 Family Scaffolds |
---|---|---|---|
COG0638 | 20S proteasome, alpha and beta subunits | Posttranslational modification, protein turnover, chaperones [O] | 3.81 |
COG3484 | Predicted proteasome-type protease | Posttranslational modification, protein turnover, chaperones [O] | 3.81 |
COG5405 | ATP-dependent protease HslVU (ClpYQ), peptidase subunit | Posttranslational modification, protein turnover, chaperones [O] | 3.81 |
COG1468 | CRISPR/Cas system-associated exonuclease Cas4, RecB family | Defense mechanisms [V] | 0.95 |
COG3306 | Glycosyltransferase involved in LPS biosynthesis, GR25 family | Cell wall/membrane/envelope biogenesis [M] | 0.95 |
COG0358 | DNA primase (bacterial type) | Replication, recombination and repair [L] | 0.48 |
COG0592 | DNA polymerase III sliding clamp (beta) subunit, PCNA homolog | Replication, recombination and repair [L] | 0.48 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 57.62 % |
Unclassified | root | N/A | 42.38 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000756|JGI12421J11937_10041584 | All Organisms → Viruses → Predicted Viral | 1559 | Open in IMG/M |
3300000756|JGI12421J11937_10120041 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 687 | Open in IMG/M |
3300002200|metazooDRAFT_1278724 | Not Available | 925 | Open in IMG/M |
3300002201|metazooDRAFT_1257759 | Not Available | 601 | Open in IMG/M |
3300002408|B570J29032_109425808 | Not Available | 755 | Open in IMG/M |
3300002835|B570J40625_100873540 | Not Available | 781 | Open in IMG/M |
3300002835|B570J40625_101035476 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 698 | Open in IMG/M |
3300005517|Ga0070374_10298612 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 818 | Open in IMG/M |
3300005527|Ga0068876_10413714 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 750 | Open in IMG/M |
3300005528|Ga0068872_10318524 | All Organisms → cellular organisms → Bacteria | 859 | Open in IMG/M |
3300005581|Ga0049081_10000475 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15322 | Open in IMG/M |
3300005581|Ga0049081_10271280 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 590 | Open in IMG/M |
3300005583|Ga0049085_10207111 | Not Available | 650 | Open in IMG/M |
3300005584|Ga0049082_10129350 | Not Available | 880 | Open in IMG/M |
3300005805|Ga0079957_1214511 | All Organisms → cellular organisms → Bacteria | 918 | Open in IMG/M |
3300006014|Ga0073919_1018355 | Not Available | 649 | Open in IMG/M |
3300006641|Ga0075471_10298759 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 820 | Open in IMG/M |
3300006802|Ga0070749_10486917 | Not Available | 673 | Open in IMG/M |
3300006802|Ga0070749_10516024 | Not Available | 650 | Open in IMG/M |
3300006802|Ga0070749_10628991 | Not Available | 577 | Open in IMG/M |
3300006917|Ga0075472_10457701 | Not Available | 633 | Open in IMG/M |
3300007177|Ga0102978_1285017 | All Organisms → Viruses → Predicted Viral | 1218 | Open in IMG/M |
3300007542|Ga0099846_1192943 | Not Available | 721 | Open in IMG/M |
3300007960|Ga0099850_1035930 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2149 | Open in IMG/M |
3300007973|Ga0105746_1214855 | Not Available | 658 | Open in IMG/M |
3300007974|Ga0105747_1173941 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C440 | 702 | Open in IMG/M |
3300007974|Ga0105747_1261623 | Not Available | 580 | Open in IMG/M |
3300008055|Ga0108970_10066641 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1777 | Open in IMG/M |
3300008055|Ga0108970_11273909 | Not Available | 553 | Open in IMG/M |
3300008055|Ga0108970_11352276 | All Organisms → Viruses → Predicted Viral | 3316 | Open in IMG/M |
3300008107|Ga0114340_1006405 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6649 | Open in IMG/M |
3300008107|Ga0114340_1036078 | All Organisms → Viruses → Predicted Viral | 4699 | Open in IMG/M |
3300008108|Ga0114341_10022952 | All Organisms → Viruses → Predicted Viral | 4377 | Open in IMG/M |
3300008110|Ga0114343_1183594 | Not Available | 626 | Open in IMG/M |
3300008113|Ga0114346_1133047 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1088 | Open in IMG/M |
3300008114|Ga0114347_1019773 | Not Available | 4306 | Open in IMG/M |
3300008114|Ga0114347_1043369 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1955 | Open in IMG/M |
3300008116|Ga0114350_1010537 | All Organisms → Viruses → Predicted Viral | 4651 | Open in IMG/M |
3300008116|Ga0114350_1063586 | All Organisms → cellular organisms → Bacteria | 1287 | Open in IMG/M |
3300008116|Ga0114350_1179850 | Not Available | 544 | Open in IMG/M |
3300008116|Ga0114350_1193071 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 510 | Open in IMG/M |
3300008117|Ga0114351_1226307 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 951 | Open in IMG/M |
3300008117|Ga0114351_1304843 | Not Available | 750 | Open in IMG/M |
3300008117|Ga0114351_1455303 | Not Available | 515 | Open in IMG/M |
3300008259|Ga0114841_1197957 | Not Available | 729 | Open in IMG/M |
3300008266|Ga0114363_1015983 | Not Available | 3401 | Open in IMG/M |
3300008266|Ga0114363_1062796 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2051 | Open in IMG/M |
3300008339|Ga0114878_1196719 | Not Available | 679 | Open in IMG/M |
3300008448|Ga0114876_1010040 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5460 | Open in IMG/M |
3300008448|Ga0114876_1024914 | All Organisms → Viruses → Predicted Viral | 3023 | Open in IMG/M |
3300008448|Ga0114876_1124867 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 980 | Open in IMG/M |
3300008450|Ga0114880_1033609 | All Organisms → Viruses → Predicted Viral | 2276 | Open in IMG/M |
3300009037|Ga0105093_10251016 | All Organisms → cellular organisms → Bacteria | 927 | Open in IMG/M |
3300009081|Ga0105098_10522552 | Not Available | 608 | Open in IMG/M |
3300009082|Ga0105099_10446692 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
3300009155|Ga0114968_10237334 | All Organisms → Viruses → Predicted Viral | 1041 | Open in IMG/M |
3300009165|Ga0105102_10277038 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 862 | Open in IMG/M |
3300009165|Ga0105102_10278024 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 860 | Open in IMG/M |
3300009165|Ga0105102_10333379 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 793 | Open in IMG/M |
3300009169|Ga0105097_10469534 | Not Available | 702 | Open in IMG/M |
3300009183|Ga0114974_10084896 | All Organisms → Viruses → Predicted Viral | 2057 | Open in IMG/M |
3300009187|Ga0114972_10297017 | Not Available | 959 | Open in IMG/M |
3300010318|Ga0136656_1214509 | Not Available | 642 | Open in IMG/M |
3300010354|Ga0129333_10332258 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1355 | Open in IMG/M |
3300010354|Ga0129333_10396857 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1221 | Open in IMG/M |
3300010354|Ga0129333_10655616 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 906 | Open in IMG/M |
3300010354|Ga0129333_10843933 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 778 | Open in IMG/M |
3300010354|Ga0129333_10896178 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 750 | Open in IMG/M |
3300010354|Ga0129333_11104998 | Not Available | 662 | Open in IMG/M |
3300010354|Ga0129333_11622626 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C440 | 527 | Open in IMG/M |
3300010354|Ga0129333_11696395 | Not Available | 514 | Open in IMG/M |
3300010370|Ga0129336_10078708 | All Organisms → Viruses → Predicted Viral | 1947 | Open in IMG/M |
3300010370|Ga0129336_10244135 | Not Available | 1011 | Open in IMG/M |
3300010370|Ga0129336_10269630 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 953 | Open in IMG/M |
3300010370|Ga0129336_10295408 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 902 | Open in IMG/M |
3300010370|Ga0129336_10478439 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 673 | Open in IMG/M |
3300010374|Ga0114986_1075496 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C440 | 608 | Open in IMG/M |
3300012666|Ga0157498_1038492 | Not Available | 735 | Open in IMG/M |
3300012709|Ga0157608_1048053 | Not Available | 532 | Open in IMG/M |
3300013004|Ga0164293_10674159 | Not Available | 665 | Open in IMG/M |
3300013005|Ga0164292_10585832 | Not Available | 722 | Open in IMG/M |
(restricted) 3300013126|Ga0172367_10073431 | All Organisms → Viruses → Predicted Viral | 2539 | Open in IMG/M |
(restricted) 3300013132|Ga0172372_10631681 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 686 | Open in IMG/M |
3300017701|Ga0181364_1025321 | Not Available | 968 | Open in IMG/M |
3300017701|Ga0181364_1076020 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 513 | Open in IMG/M |
3300017707|Ga0181363_1023710 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1191 | Open in IMG/M |
3300017716|Ga0181350_1054567 | All Organisms → Viruses → Predicted Viral | 1053 | Open in IMG/M |
3300017716|Ga0181350_1068831 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 912 | Open in IMG/M |
3300017716|Ga0181350_1121958 | Not Available | 625 | Open in IMG/M |
3300017723|Ga0181362_1118948 | Not Available | 518 | Open in IMG/M |
3300017747|Ga0181352_1155370 | Not Available | 604 | Open in IMG/M |
3300017761|Ga0181356_1009026 | All Organisms → Viruses → Predicted Viral | 3856 | Open in IMG/M |
3300017761|Ga0181356_1122283 | Not Available | 830 | Open in IMG/M |
3300017774|Ga0181358_1118766 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 931 | Open in IMG/M |
3300017774|Ga0181358_1161873 | Not Available | 756 | Open in IMG/M |
3300017774|Ga0181358_1162020 | Not Available | 756 | Open in IMG/M |
3300017774|Ga0181358_1197805 | Not Available | 659 | Open in IMG/M |
3300017777|Ga0181357_1078728 | All Organisms → Viruses → Predicted Viral | 1262 | Open in IMG/M |
3300017778|Ga0181349_1104775 | All Organisms → Viruses → Predicted Viral | 1056 | Open in IMG/M |
3300017778|Ga0181349_1113442 | All Organisms → Viruses → Predicted Viral | 1004 | Open in IMG/M |
3300017778|Ga0181349_1137349 | Not Available | 889 | Open in IMG/M |
3300017780|Ga0181346_1051469 | All Organisms → Viruses → Predicted Viral | 1666 | Open in IMG/M |
3300017780|Ga0181346_1096497 | All Organisms → Viruses → Predicted Viral | 1151 | Open in IMG/M |
3300017780|Ga0181346_1282280 | Not Available | 569 | Open in IMG/M |
3300017784|Ga0181348_1017968 | All Organisms → Viruses → Predicted Viral | 3029 | Open in IMG/M |
3300017784|Ga0181348_1100009 | All Organisms → Viruses → Predicted Viral | 1133 | Open in IMG/M |
3300017784|Ga0181348_1168752 | Not Available | 806 | Open in IMG/M |
3300017785|Ga0181355_1150244 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 940 | Open in IMG/M |
3300017785|Ga0181355_1165748 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 885 | Open in IMG/M |
3300017785|Ga0181355_1233854 | Not Available | 710 | Open in IMG/M |
3300017785|Ga0181355_1302889 | Not Available | 599 | Open in IMG/M |
3300019784|Ga0181359_1030201 | All Organisms → Viruses → Predicted Viral | 2089 | Open in IMG/M |
3300019784|Ga0181359_1112561 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 984 | Open in IMG/M |
3300019784|Ga0181359_1197210 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 651 | Open in IMG/M |
3300019784|Ga0181359_1223501 | Not Available | 590 | Open in IMG/M |
3300019784|Ga0181359_1240705 | Not Available | 555 | Open in IMG/M |
3300020048|Ga0207193_1683546 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
3300020109|Ga0194112_10940537 | Not Available | 552 | Open in IMG/M |
3300020193|Ga0194131_10009319 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 12440 | Open in IMG/M |
3300020193|Ga0194131_10018728 | Not Available | 6986 | Open in IMG/M |
3300020193|Ga0194131_10041803 | All Organisms → Viruses → Predicted Viral | 3347 | Open in IMG/M |
3300020198|Ga0194120_10102724 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1874 | Open in IMG/M |
3300020205|Ga0211731_11513997 | All Organisms → Viruses → Predicted Viral | 1450 | Open in IMG/M |
3300020220|Ga0194119_10012625 | Not Available | 10670 | Open in IMG/M |
3300020220|Ga0194119_10460318 | Not Available | 810 | Open in IMG/M |
3300020542|Ga0208857_1069999 | Not Available | 510 | Open in IMG/M |
3300021961|Ga0222714_10111804 | Not Available | 1705 | Open in IMG/M |
3300021963|Ga0222712_10457214 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 764 | Open in IMG/M |
3300022167|Ga0212020_1083032 | Not Available | 537 | Open in IMG/M |
3300022179|Ga0181353_1050868 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1085 | Open in IMG/M |
3300022190|Ga0181354_1203007 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 589 | Open in IMG/M |
3300022190|Ga0181354_1241210 | Not Available | 519 | Open in IMG/M |
3300022198|Ga0196905_1187400 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C440 | 522 | Open in IMG/M |
3300022200|Ga0196901_1156494 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 755 | Open in IMG/M |
3300022396|Ga0210364_1123812 | Not Available | 572 | Open in IMG/M |
3300022407|Ga0181351_1078968 | All Organisms → Viruses → Predicted Viral | 1316 | Open in IMG/M |
3300022407|Ga0181351_1098210 | All Organisms → Viruses → Predicted Viral | 1136 | Open in IMG/M |
3300022407|Ga0181351_1125520 | Not Available | 956 | Open in IMG/M |
3300022407|Ga0181351_1249077 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 554 | Open in IMG/M |
3300022752|Ga0214917_10046680 | All Organisms → Viruses → Predicted Viral | 2986 | Open in IMG/M |
3300022752|Ga0214917_10310638 | Not Available | 695 | Open in IMG/M |
3300024351|Ga0255141_1057870 | Not Available | 566 | Open in IMG/M |
3300024354|Ga0255171_1033204 | All Organisms → cellular organisms → Bacteria | 1001 | Open in IMG/M |
3300024495|Ga0255164_1056329 | Not Available | 624 | Open in IMG/M |
3300024496|Ga0255151_1078059 | Not Available | 526 | Open in IMG/M |
3300025635|Ga0208147_1168174 | Not Available | 503 | Open in IMG/M |
3300025635|Ga0208147_1169880 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 500 | Open in IMG/M |
3300025848|Ga0208005_1201728 | Not Available | 617 | Open in IMG/M |
3300025896|Ga0208916_10372197 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 623 | Open in IMG/M |
3300027141|Ga0255076_1079985 | Not Available | 535 | Open in IMG/M |
3300027155|Ga0255081_1051779 | Not Available | 852 | Open in IMG/M |
3300027393|Ga0209867_1000157 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15766 | Open in IMG/M |
3300027581|Ga0209651_1103177 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 802 | Open in IMG/M |
3300027608|Ga0208974_1176107 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 529 | Open in IMG/M |
3300027627|Ga0208942_1071318 | Not Available | 1029 | Open in IMG/M |
3300027644|Ga0209356_1024166 | Not Available | 2032 | Open in IMG/M |
3300027644|Ga0209356_1114788 | Not Available | 776 | Open in IMG/M |
3300027659|Ga0208975_1067952 | All Organisms → Viruses → Predicted Viral | 1069 | Open in IMG/M |
3300027688|Ga0209553_1122033 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 916 | Open in IMG/M |
3300027756|Ga0209444_10103054 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1163 | Open in IMG/M |
3300027785|Ga0209246_10088279 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1211 | Open in IMG/M |
3300027793|Ga0209972_10016089 | All Organisms → Viruses → Predicted Viral | 4749 | Open in IMG/M |
3300027793|Ga0209972_10375342 | Not Available | 609 | Open in IMG/M |
3300027793|Ga0209972_10487571 | Not Available | 508 | Open in IMG/M |
3300027797|Ga0209107_10095143 | All Organisms → Viruses → Predicted Viral | 1604 | Open in IMG/M |
3300027798|Ga0209353_10095541 | All Organisms → Viruses → Predicted Viral | 1343 | Open in IMG/M |
3300027956|Ga0209820_1172424 | Not Available | 601 | Open in IMG/M |
3300028025|Ga0247723_1068633 | Not Available | 960 | Open in IMG/M |
3300028275|Ga0255174_1081819 | Not Available | 524 | Open in IMG/M |
(restricted) 3300028559|Ga0247831_1010134 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9160 | Open in IMG/M |
3300031758|Ga0315907_10365061 | Not Available | 1171 | Open in IMG/M |
3300031784|Ga0315899_10241864 | All Organisms → Viruses → Predicted Viral | 1804 | Open in IMG/M |
3300031787|Ga0315900_10574874 | Not Available | 832 | Open in IMG/M |
3300031787|Ga0315900_10597908 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 807 | Open in IMG/M |
3300031787|Ga0315900_11132863 | Not Available | 501 | Open in IMG/M |
3300031857|Ga0315909_10028571 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5451 | Open in IMG/M |
3300031857|Ga0315909_10074131 | All Organisms → Viruses → Predicted Viral | 3032 | Open in IMG/M |
3300031857|Ga0315909_10681646 | Not Available | 670 | Open in IMG/M |
3300031857|Ga0315909_10814907 | Not Available | 588 | Open in IMG/M |
3300031951|Ga0315904_10083951 | All Organisms → Viruses → Predicted Viral | 3400 | Open in IMG/M |
3300031951|Ga0315904_10141101 | All Organisms → Viruses → Predicted Viral | 2456 | Open in IMG/M |
3300031951|Ga0315904_10182718 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2080 | Open in IMG/M |
3300031963|Ga0315901_10144637 | All Organisms → Viruses → Predicted Viral | 2130 | Open in IMG/M |
3300031963|Ga0315901_10367133 | All Organisms → Viruses → Predicted Viral | 1165 | Open in IMG/M |
3300031963|Ga0315901_10531695 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 908 | Open in IMG/M |
3300031963|Ga0315901_10966063 | Not Available | 599 | Open in IMG/M |
3300032050|Ga0315906_10418493 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1160 | Open in IMG/M |
3300032093|Ga0315902_10245348 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1748 | Open in IMG/M |
3300032093|Ga0315902_10322999 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1445 | Open in IMG/M |
3300032093|Ga0315902_10687935 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 835 | Open in IMG/M |
3300032116|Ga0315903_10252053 | All Organisms → Viruses → Predicted Viral | 1525 | Open in IMG/M |
3300032116|Ga0315903_10394101 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1130 | Open in IMG/M |
3300032116|Ga0315903_10509383 | Not Available | 948 | Open in IMG/M |
3300032116|Ga0315903_10664377 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 786 | Open in IMG/M |
3300032116|Ga0315903_10928103 | Not Available | 618 | Open in IMG/M |
3300032116|Ga0315903_11101407 | Not Available | 545 | Open in IMG/M |
3300033980|Ga0334981_0373399 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
3300033981|Ga0334982_0284727 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C440 | 783 | Open in IMG/M |
3300033993|Ga0334994_0381813 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C440 | 687 | Open in IMG/M |
3300033996|Ga0334979_0731440 | Not Available | 514 | Open in IMG/M |
3300034019|Ga0334998_0207001 | All Organisms → Viruses → Predicted Viral | 1215 | Open in IMG/M |
3300034019|Ga0334998_0304841 | Not Available | 944 | Open in IMG/M |
3300034062|Ga0334995_0503122 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 728 | Open in IMG/M |
3300034062|Ga0334995_0722795 | Not Available | 557 | Open in IMG/M |
3300034066|Ga0335019_0039316 | All Organisms → Viruses → Predicted Viral | 3259 | Open in IMG/M |
3300034092|Ga0335010_0521528 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 620 | Open in IMG/M |
3300034101|Ga0335027_0753397 | Not Available | 570 | Open in IMG/M |
3300034108|Ga0335050_0487944 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 530 | Open in IMG/M |
3300034118|Ga0335053_0365496 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 885 | Open in IMG/M |
3300034166|Ga0335016_0599689 | Not Available | 601 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 25.24% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 12.38% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 10.48% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 8.10% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 6.67% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 6.67% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 6.19% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 3.81% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 3.33% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 3.33% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 1.43% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 1.43% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.43% |
Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 1.43% |
Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 1.43% |
Lake | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake | 0.95% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.95% |
Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 0.95% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.48% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.48% |
Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.48% |
Freshwater, Surface Ice | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Surface Ice | 0.48% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 0.48% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.48% |
Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.48% |
Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.48% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000756 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 | Environmental | Open in IMG/M |
3300002200 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - APR 2013 | Environmental | Open in IMG/M |
3300002201 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - SEP 2013 | Environmental | Open in IMG/M |
3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
3300005583 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF | Environmental | Open in IMG/M |
3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
3300006014 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T3_25-Nov-14 | Environmental | Open in IMG/M |
3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
3300006917 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA | Environmental | Open in IMG/M |
3300007177 | Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface and Bottom layers) 16 sequencing projects | Environmental | Open in IMG/M |
3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
3300007974 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um | Environmental | Open in IMG/M |
3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
3300008114 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA | Environmental | Open in IMG/M |
3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
3300008117 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008259 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA | Environmental | Open in IMG/M |
3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008339 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Sept 29, 2014 all contigs | Environmental | Open in IMG/M |
3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
3300009037 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
3300009082 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
3300009187 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG | Environmental | Open in IMG/M |
3300010318 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_DNA | Environmental | Open in IMG/M |
3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
3300010374 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S-1-Day17 | Environmental | Open in IMG/M |
3300012666 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Surface Ice version 2 | Environmental | Open in IMG/M |
3300012709 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES134 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
3300013132 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5m | Environmental | Open in IMG/M |
3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017707 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.N | Environmental | Open in IMG/M |
3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
3300020109 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015016 Mahale Deep Cast 400m | Environmental | Open in IMG/M |
3300020193 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015053 Kigoma Offshore 120m | Environmental | Open in IMG/M |
3300020198 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015019 Mahale Deep Cast 65m | Environmental | Open in IMG/M |
3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
3300020220 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015018 Mahale Deep Cast 100m | Environmental | Open in IMG/M |
3300020542 | Freshwater microbial communities from Lake Mendota, WI - 05NOV2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
3300022167 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (v2) | Environmental | Open in IMG/M |
3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
3300022396 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.633 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
3300024351 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_0h | Environmental | Open in IMG/M |
3300024354 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepB_8d | Environmental | Open in IMG/M |
3300024495 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_8d | Environmental | Open in IMG/M |
3300024496 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepB_8h | Environmental | Open in IMG/M |
3300025635 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025848 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300027141 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepB_8h | Environmental | Open in IMG/M |
3300027155 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepA_8h | Environmental | Open in IMG/M |
3300027393 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_4-Nov-14 (SPAdes) | Environmental | Open in IMG/M |
3300027581 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027627 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027644 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027688 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.DN (SPAdes) | Environmental | Open in IMG/M |
3300027756 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
3300027956 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 (SPAdes) | Environmental | Open in IMG/M |
3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
3300028275 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepB_8d | Environmental | Open in IMG/M |
3300028559 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_1m | Environmental | Open in IMG/M |
3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
3300033980 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME09Aug2015-rr0007 | Environmental | Open in IMG/M |
3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
3300034019 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049 | Environmental | Open in IMG/M |
3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
3300034108 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Jun2014-rr0157 | Environmental | Open in IMG/M |
3300034118 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165 | Environmental | Open in IMG/M |
3300034166 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Sep2012-rr0079 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12421J11937_100415847 | 3300000756 | Freshwater And Sediment | ALYLAGETDLKTLAMAAVAGFAGPLLKWLDPSATDFGRGSK* |
JGI12421J11937_101200412 | 3300000756 | Freshwater And Sediment | MTGETNPKTLAAAALAGVAGPVLKWLDPSATEFGRGSK* |
metazooDRAFT_12787242 | 3300002200 | Lake | AAASAAVALYLAGETDPKKLGAAALAGFLGPVLKWLDPNSPEFGRKKK* |
metazooDRAFT_12577592 | 3300002201 | Lake | ALYLAGETDLKTLGTAALAGFLGPVLKWLDPSAGEFGKGAK* |
B570J29032_1094258081 | 3300002408 | Freshwater | ETNPKTLAAAALAGVAGPVLKWLDPSATDFGRGSK* |
B570J40625_1008735402 | 3300002835 | Freshwater | YLAGETDLKTLAYAALAGAAGPVLKWLDPSATEFGRGSK* |
B570J40625_1010354761 | 3300002835 | Freshwater | AIYMTGETNPKTLAAAALAGVAGPVLKWLDPSATDFGRGSK* |
Ga0070374_102986121 | 3300005517 | Freshwater Lake | YLAGETNLKVLGTAALAGFLGPLLKWLDPSATEFGRGSN* |
Ga0068876_104137143 | 3300005527 | Freshwater Lake | AIALYLAGETDLKVLGTAALAGFLGPVLKWLDTSAPEFGRGSN* |
Ga0068872_103185241 | 3300005528 | Freshwater Lake | GETDLKTLGMAALAGAAGPILKWLDSSAVDFGRGSK* |
Ga0049081_100004751 | 3300005581 | Freshwater Lentic | VALYVTGITDPKQLGAAALAGLAGPVLKWLDPSATQFGRGSE* |
Ga0049081_102712802 | 3300005581 | Freshwater Lentic | AIALYLAGETDLKVLGTAALAGLLGPVLKWLDPSAPEFGKGAK* |
Ga0049085_102071111 | 3300005583 | Freshwater Lentic | ALYMAGTTDPKTLAYALLSGFIGPALKWLDPSAKEFGRTQ* |
Ga0049082_101293501 | 3300005584 | Freshwater Lentic | GITDPKQLGAAALAGLAGPLLKWLDPSATQFGRGSE* |
Ga0079957_12145113 | 3300005805 | Lake | RAAASAAIALYLAGETDLKTLGTAALAGFLGPVLKYLDSSAKDFGRGAA* |
Ga0073919_10183551 | 3300006014 | Sand | TDLKTLAMAAVAGFAGPLLKWLDASATDFGRGSK* |
Ga0075471_102987591 | 3300006641 | Aqueous | ALYLAGETDIKTLGMAALAGFLGPVLKWLDPSATEFGRAK* |
Ga0070749_104869171 | 3300006802 | Aqueous | LYLAGETNLKVLGTAALAGFLGPVLKWLDPSASEFGRGSN* |
Ga0070749_105160241 | 3300006802 | Aqueous | GETDLKTLGMAALAGFLGPVLKWLDPSAKEFGRGAE* |
Ga0070749_106289912 | 3300006802 | Aqueous | ASAAIALYLAGETNLKTLGMAALAGFLGPVLKWLDPSATQFGRGAE* |
Ga0075472_104577011 | 3300006917 | Aqueous | AASAAIALYLAGETDFKTLGMAALAGFLGPVLKWLDPSATEFGRAK* |
Ga0102978_12850173 | 3300007177 | Freshwater Lake | ETDLEVLGLAALTGFLGPVLKWLDPSAKEFGRKK* |
Ga0099846_11929433 | 3300007542 | Aqueous | AGETDLKTLGMAALAGFLGPVLKWLDPSAKEFGRGAE* |
Ga0099850_10359306 | 3300007960 | Aqueous | IALYLTGVTDWKTLGTAALAGFLGPVLKWLDPSAPEFGRTAE* |
Ga0105746_12148551 | 3300007973 | Estuary Water | AASAIALYLAGETDLKTLAMAAVAGFAGPLLKWLDASATEFGRGSK* |
Ga0105747_11739413 | 3300007974 | Estuary Water | TDPKQLGAAALAGLAGPVLKWLDPSASEFGRGSE* |
Ga0105747_12616231 | 3300007974 | Estuary Water | IYMTGETNPKTLAAAALAGVAGPVLKWLDPSATDFGRGSK* |
Ga0108970_100666411 | 3300008055 | Estuary | IALYLAGETDVKVLGTAALAGFLGPVLKWLDPSAKEFGRK* |
Ga0108970_112739091 | 3300008055 | Estuary | VALYLVGETDLKTLGLAALSGAAGPVLKWLDASSPQFGRGSK* |
Ga0108970_113522769 | 3300008055 | Estuary | TDGRVLGTAALAGFLGPVLKWLDPSAAEFGRGAR* |
Ga0114340_100640514 | 3300008107 | Freshwater, Plankton | LSGITDPKQLGAAALAGLAGPVLKWLDPSATEFGRGSN* |
Ga0114340_103607811 | 3300008107 | Freshwater, Plankton | MNPQLYLSGITDPKQLGAAALAGLAGPVLKWLDPSATEFGRGSE* |
Ga0114341_100229521 | 3300008108 | Freshwater, Plankton | YLSGITDPKQLGAAALAGLAGPVLKWLDPSATEFGRGSE* |
Ga0114343_11835943 | 3300008110 | Freshwater, Plankton | RAAAASAIALYLAGQTDLKVLATAALTGFLGPVLKWLDGSSTDFGRGAE* |
Ga0114346_11330473 | 3300008113 | Freshwater, Plankton | AGETDFKTLGMAALAGFLGPVLKWLDPSASEFGRAK* |
Ga0114347_10197734 | 3300008114 | Freshwater, Plankton | VKRAAASAAIALYLAGETDLKTLGTAALAGFLGPVLKYLDSSAKDFGRGAA* |
Ga0114347_10433691 | 3300008114 | Freshwater, Plankton | RAAASAAIALYLAGETDLKTLGTAALAGFLGPVLKYLDTSAKDFGRGAA* |
Ga0114350_10105377 | 3300008116 | Freshwater, Plankton | VIALYLAGETDPKKLGAAALAGFAGPLLKWLDPSAPEFGRKKK* |
Ga0114350_10635861 | 3300008116 | Freshwater, Plankton | AAIALYLAGETDLKTLGMAALAGAAGPILKWLDSSAVDFGRGSK* |
Ga0114350_11798501 | 3300008116 | Freshwater, Plankton | RAAAAAAIALYLAGETDLKVLGTAALAGFLGPVLKWLDASAPEFGRGSN* |
Ga0114350_11930711 | 3300008116 | Freshwater, Plankton | LAGESDLKTLAMAALAGFAGPLLKWLDNSAPEFGRGSK* |
Ga0114351_12263071 | 3300008117 | Freshwater, Plankton | LASAGALFLAGTSDPKALGYAALSGFIGPVLKWLDPSAVEFGRKK* |
Ga0114351_13048431 | 3300008117 | Freshwater, Plankton | AAAIALYLAGETDLKVLGTAALAGFLGPVLKWLDASAPEFGRGSN* |
Ga0114351_14553032 | 3300008117 | Freshwater, Plankton | IALYLAGETDPKTLAAAAVAAVAGPVLKWLDPNAKEFGRGSK* |
Ga0114841_11979571 | 3300008259 | Freshwater, Plankton | AGETDLKVLGTAALAGFLGPVLKWLDKSAPEFGRGSN* |
Ga0114363_10159836 | 3300008266 | Freshwater, Plankton | GQTDLKVLATAALTGFLGPVLKWLDSSSTDFGRGAE* |
Ga0114363_10627966 | 3300008266 | Freshwater, Plankton | FRAAASAAIALYLAGETDVKTLGAAALAGFLGPVLKWLDPSAKEFGRK* |
Ga0114878_11967192 | 3300008339 | Freshwater Lake | FRAAASAAIALYLAGETDVKTLGAAALAGFLGPVLKWLDPSAKDFGRGAE* |
Ga0114876_101004012 | 3300008448 | Freshwater Lake | AAAAAVALYLAGETDLKTLGMAAIAGAAGPVLKWLDPSAAEFGRGSK* |
Ga0114876_10249148 | 3300008448 | Freshwater Lake | YLSGITDPKQLGAAALAGLAGPVLKWLDPSATEFGRGSN* |
Ga0114876_11248671 | 3300008448 | Freshwater Lake | AAAAAVALYLAGETDLKTLGMAAIAGAAGPVLKWLDPSATEFGRGSK* |
Ga0114880_10336091 | 3300008450 | Freshwater Lake | GETDPKVLGTAALAGFLGPVLKWLDPSAVEFGKKKK* |
Ga0105093_102510163 | 3300009037 | Freshwater Sediment | LAGETDLKTLGMAAIAGAAGPILKWLDSSAVEFGKGSK* |
Ga0105098_105225522 | 3300009081 | Freshwater Sediment | ALYLAGETDLKTLAMAAAAGFAGPLLKWLDPSATEFGRGSK* |
Ga0105099_104466921 | 3300009082 | Freshwater Sediment | AASAAVALYLAGETDLKTLGAAALAGFAGPLLKWLDPSATEFGRGSK* |
Ga0114968_102373342 | 3300009155 | Freshwater Lake | ALFLAGEQDLKTLAMAALAGFAGPLLKWLDASATEFGRGSK* |
Ga0105102_102770381 | 3300009165 | Freshwater Sediment | IQDPKQLGAAALAGLAGPVLKWLDPSASEFGRGSE* |
Ga0105102_102780241 | 3300009165 | Freshwater Sediment | LYLVGETDLKTLAMAALTGFAGPLLKWLDPSATEFGRGSK* |
Ga0105102_103333791 | 3300009165 | Freshwater Sediment | SAAIALYLVGETDLKTLAMAALTGFAGPLLKWLDPSATEFGRGSK* |
Ga0105097_104695341 | 3300009169 | Freshwater Sediment | SAAIALYLAGETDLKTLAMAAAAGFAGPLLKWLDPSATEFGRGSK* |
Ga0114974_100848961 | 3300009183 | Freshwater Lake | AAAAVVALYLSGITDPKQLGAAALAGLAGPVLKWLDPSATEFGRGSN* |
Ga0114972_102970174 | 3300009187 | Freshwater Lake | AAAAAVVAIYMTGETNPKTLAAAALAGVAGPVLKWLDPSAADFGRGSK* |
Ga0136656_12145091 | 3300010318 | Freshwater To Marine Saline Gradient | AAASAAIALYLAGETDVKTLGAAALAGFLGPVLKWLDPSATEFGRGSN* |
Ga0129333_103322581 | 3300010354 | Freshwater To Marine Saline Gradient | ITDPKQLGAAALAGLAGPLLKWLDPSATEFGRGSE* |
Ga0129333_103968573 | 3300010354 | Freshwater To Marine Saline Gradient | AAIALYLAGETDVKVLGTAALAGFLGPVLKWLDPNAPEFGRKKK* |
Ga0129333_106556162 | 3300010354 | Freshwater To Marine Saline Gradient | LAGETDVKVLGTAALAGFLGPVLKWLDPSAKEFGRK* |
Ga0129333_108439331 | 3300010354 | Freshwater To Marine Saline Gradient | ALYLAGETDLKVLGTAALAGFLGPVLKWLDPSAPEFGRKKK* |
Ga0129333_108961781 | 3300010354 | Freshwater To Marine Saline Gradient | IALYLAGETDLKTLGMAALAGFLGPVLKWLDPSAKEFGRGAE* |
Ga0129333_111049982 | 3300010354 | Freshwater To Marine Saline Gradient | ALYLAGETDVKTLGAAALAGFLGPVLKWLDPSAKDFGRGAE* |
Ga0129333_116226262 | 3300010354 | Freshwater To Marine Saline Gradient | AAIALYLAGETDFKTLGAAALAGFLGPVLKWLDPSASEFGRAK* |
Ga0129333_116963951 | 3300010354 | Freshwater To Marine Saline Gradient | SAAIALYLAGENNPKALATAALAGFLGPVLKWLDPSATEFGRGSK* |
Ga0129336_100787083 | 3300010370 | Freshwater To Marine Saline Gradient | FRAAAAAVVALYLAGETDPEKLVAAALAGFLGPVLKWLDPSAKEFGRKK* |
Ga0129336_102441351 | 3300010370 | Freshwater To Marine Saline Gradient | ASASAAIALYLAGETDLKTLAMAALAGFLGPVLKWLDPSAPEFGRKKK* |
Ga0129336_102696301 | 3300010370 | Freshwater To Marine Saline Gradient | RAAAAAAIALFLAGETDPKTLGLAALTGCLGPMLKWLDPSAKEFGRKK* |
Ga0129336_102954081 | 3300010370 | Freshwater To Marine Saline Gradient | LYLAGETDLKTLVMAALAGFLGPVLMWLYPSVTEFGRGSR* |
Ga0129336_104784391 | 3300010370 | Freshwater To Marine Saline Gradient | RAAAAAAIALFLAGETDPKTLGLAALTGCLGPMLKWLDPSAPEFGRKKK* |
Ga0114986_10754962 | 3300010374 | Deep Subsurface | VALYLAGETDFKTLGAAALAGFAGPLLKWLDPSATQFGKGSK* |
Ga0157498_10384923 | 3300012666 | Freshwater, Surface Ice | AAAAVVAIYMTGETNPKTLAAAALAGVAGPVLKWLDPSATEFGRGSK* |
Ga0157608_10480531 | 3300012709 | Freshwater | ALYLAGQTDLKVLATAALTGFLGPVLKWLDGSSTDFGRGAE* |
Ga0164293_106741591 | 3300013004 | Freshwater | AGETDLKTLAAAALAGFAGPLLKWLDPSATDFGRGSK* |
Ga0164292_105858321 | 3300013005 | Freshwater | VALYISGVTDPKQLGSAALAGLAGPLLKWLDPSATEFGRGSE* |
(restricted) Ga0172367_100734316 | 3300013126 | Freshwater | GETNFKTLGAAALAGFLGPVLKWLDPSAKEFGRGAE* |
(restricted) Ga0172372_106316811 | 3300013132 | Freshwater | YLAGETDLKVLGTAALAGFLGPVLKWLDPSAKEFGKGAE* |
Ga0181364_10253211 | 3300017701 | Freshwater Lake | AAASAIALYLAGETDLKTLAMAAVAGFAGPLLKWLDASATEFGRGSK |
Ga0181364_10760202 | 3300017701 | Freshwater Lake | AAAAAAIALYLAGETNLKVLGTAALAGLLGPVLKWLDPSAKEFGRGAE |
Ga0181363_10237101 | 3300017707 | Freshwater Lake | RAAASAAIALYLAGETDLKTLGAAALAGFLGPVLKWLDPSATEFGRGKK |
Ga0181350_10545674 | 3300017716 | Freshwater Lake | RAAAAAVVAIYMTGETNPKTLAAAALAGVAGPVLKWLDPSATEFGRGSK |
Ga0181350_10688311 | 3300017716 | Freshwater Lake | SAAVALYLAGETDLKTLGMAAVAGFAGPLLKWLDPSATEFGRGSK |
Ga0181350_11219581 | 3300017716 | Freshwater Lake | RAAAASAIALYLAGETDLKTLAMAAVAGFAGPALKWLDASSTEVGRGSK |
Ga0181362_11189481 | 3300017723 | Freshwater Lake | LAGQTDIKTLGMAALTGFLGPVLKWLDPSATEFGRGSE |
Ga0181352_11553701 | 3300017747 | Freshwater Lake | AAVIALYLAGETDPKKLGAAALAGFAGPLLKWLDPSAPEFGRKKK |
Ga0181356_10090261 | 3300017761 | Freshwater Lake | ITDPKQLGAAALAGLAGPVLKWLDPSATQFGRGSE |
Ga0181356_11222831 | 3300017761 | Freshwater Lake | LAGETDLKTLAMAAVAGFAGPLLKWLDASATEFGRGSK |
Ga0181358_11187662 | 3300017774 | Freshwater Lake | GETDLKTLAMAAVAGFAGPLLKWLDASATEFGRGSK |
Ga0181358_11618731 | 3300017774 | Freshwater Lake | AIALFLAGEQDLKTLAMAAVAGFAGPVLKWLDASATEFGRGPK |
Ga0181358_11620201 | 3300017774 | Freshwater Lake | AIALFLAGEQDLKTLAMAAVAGFAGPVLKWLDASATEFGRGSK |
Ga0181358_11978051 | 3300017774 | Freshwater Lake | AAVVALYVTGITDPKQLGAAALAGLAGPVLKWLDPSATQFGRGSE |
Ga0181357_10787281 | 3300017777 | Freshwater Lake | RAAAAVIALYLAGVTDPKQLASAALAGVAGPLLKYLDPSATQFGKGSE |
Ga0181349_11047754 | 3300017778 | Freshwater Lake | KGGTSPKTLAAAALAGVAGPVLKWLDPSATEFGRGSK |
Ga0181349_11134424 | 3300017778 | Freshwater Lake | YMTGEYSAKTLAAAALAGLAGPVLKWLDPSATEFGRGSE |
Ga0181349_11373491 | 3300017778 | Freshwater Lake | FRAAAAAVLVVYMTGETSPKTLAAAALAGVAGPVLKWLDPSATEFGRGSK |
Ga0181346_10514691 | 3300017780 | Freshwater Lake | GITDPKQLGAAALAGLAGPLLKWLDPSATQFGRGSE |
Ga0181346_10964971 | 3300017780 | Freshwater Lake | MTGETNPKTLAAAALAGVAGPVLKWLDPSATEFGRGSK |
Ga0181346_12822802 | 3300017780 | Freshwater Lake | YMAGTTDPKTLAYALLSGFIGPALKWLDPSAKEFGRTK |
Ga0181348_10179688 | 3300017784 | Freshwater Lake | ETGEYSAKTLAAAALAGVAGPVLKWLDPSATEFGRGSE |
Ga0181348_11000091 | 3300017784 | Freshwater Lake | IYMTGETSPKTLAAAALAGVAGPVLKWLDPSATEFGRGSK |
Ga0181348_11687522 | 3300017784 | Freshwater Lake | AAASAIALFLAGEQDLKTLAMAAVAGFAGPVLKWLDASATEFGRGSK |
Ga0181355_11502443 | 3300017785 | Freshwater Lake | ETSPKTLAAAGLAGVAGPLLKWLDPSATDFGRGSK |
Ga0181355_11657483 | 3300017785 | Freshwater Lake | IALYLAGETDLKTLGTAALAGFLGPVLKYLDTSAKDFGRGAA |
Ga0181355_12338541 | 3300017785 | Freshwater Lake | VVALYVTGITDPKQLGAAALAGLAGPLLKWLDPSATQFGRGSE |
Ga0181355_13028891 | 3300017785 | Freshwater Lake | LAGETDLKTLGAAALAGFLGPVLKWLDPSATEFGRGKK |
Ga0181359_10302014 | 3300019784 | Freshwater Lake | KAAAVVAIYMTGETNPKTLAAAALAGVAGPVLKWLDPSATEFGRGSK |
Ga0181359_11125615 | 3300019784 | Freshwater Lake | TVIALYLAGVTDPKQLASAALAGVAGPLLKYLDPSATQFGRGSE |
Ga0181359_11972103 | 3300019784 | Freshwater Lake | AAVVAIYMTGETSPKTLAAAALAGVAGPVLKWLDPSATEFGRGSK |
Ga0181359_12235011 | 3300019784 | Freshwater Lake | VTGITDPKQLGAAALAGLAGPVLKWLDPSATQFGRGSE |
Ga0181359_12407052 | 3300019784 | Freshwater Lake | DMTGETSPKTLAAAALAGVAGPVLKWLDPSATEFGRGSK |
Ga0207193_16835463 | 3300020048 | Freshwater Lake Sediment | LAGETDLKTLGMAALAGAAGPILKWLDSSAVDFGRGSK |
Ga0194112_109405371 | 3300020109 | Freshwater Lake | SAAIALYLTGVTDLKVLSAAALAGFLGPVLKWLDPSATEFGRGSN |
Ga0194131_100093191 | 3300020193 | Freshwater Lake | AAIALYLTGVTDLKVLSTAALAGFLGPVLKWLDPSATEFGRGSN |
Ga0194131_1001872815 | 3300020193 | Freshwater Lake | AAIALYLTGVTDLKVLSTAALAGFLGPVLKWLDPSATEFGRGKE |
Ga0194131_100418031 | 3300020193 | Freshwater Lake | FRAAASAAIALYLTGVTDLKVLSTAALAGFLGPVLKWLDPSATEFGRGSN |
Ga0194120_101027245 | 3300020198 | Freshwater Lake | AASAAIALYLTGVTDLKVLSTAALAGFLGPVLKWLDPSATEFGRGSN |
Ga0211731_115139973 | 3300020205 | Freshwater | AAASAAIALYLAGETDLKTLAAAALAGFAGPLLKWLDPSATDFGRGSK |
Ga0194119_100126251 | 3300020220 | Freshwater Lake | YLTGVTDLKVLSTAALAGFLGPVLKWLDPSATEFGRGKE |
Ga0194119_104603181 | 3300020220 | Freshwater Lake | GVTDLKVLSTAALAGFLGPVLKWLDPSATEFGRGSN |
Ga0208857_10699991 | 3300020542 | Freshwater | LYISGVTDPKQLGSAALAGLAGPLLKWLDPSATEFGRGSE |
Ga0222714_101118044 | 3300021961 | Estuarine Water | LYLAGQTDLKTLGMAALTGFLGPVLKWLDSSSTDFGRGAE |
Ga0222712_104572144 | 3300021963 | Estuarine Water | FRAAAAAVIALYLAGVTDPKQLASAALAGVAGPLLKYLDPSATQFGKGSE |
Ga0212020_10830321 | 3300022167 | Aqueous | LYLAGETNLKVLGTAALAGFLGPVLKWLDPSASEFGRGSN |
Ga0181353_10508681 | 3300022179 | Freshwater Lake | GNLAGETDVKVLGTAALAGFLGPVLKWLDPSAAEFGRGAN |
Ga0181354_12030071 | 3300022190 | Freshwater Lake | ASAVALYLAGETDLKTIGYAAVAGAAGPVLKWLDPSATEFGRGSK |
Ga0181354_12412101 | 3300022190 | Freshwater Lake | AAAAVVAIYMTGETSPKTLAAAALAGVAGPVLKWLDPSATEFGRGSK |
Ga0196905_11874001 | 3300022198 | Aqueous | IALYLAGETDIKTLAVAALAGFLGPVLKWLDPSAAEFGRVK |
Ga0196901_11564941 | 3300022200 | Aqueous | RAAAAAAIALYLAGETDVKVLGTAALAGFLGPVLKWLDPSATQFGRGAE |
Ga0210364_11238121 | 3300022396 | Estuarine | VALYLAGETNLKVLATAALAGFLGPVLKWLDPSATEFGRGSN |
Ga0181351_10789681 | 3300022407 | Freshwater Lake | YMTGETSPKTLAAAALAGVAGPVLKWLDPSATEFGRGSK |
Ga0181351_10982101 | 3300022407 | Freshwater Lake | AAAAVVAIYMTGETNPKTLAAAALAGVAGPVLKWLDPSATEFGRGSK |
Ga0181351_11255203 | 3300022407 | Freshwater Lake | ENDLKTLGYAALAGAAGPILKWLDSSAVDFGRGSK |
Ga0181351_12490771 | 3300022407 | Freshwater Lake | AAVALYLAGETDLKTLGMAAVAGFAGPLLKWLDPSATDFGRGSK |
Ga0214917_100466808 | 3300022752 | Freshwater | LAGETNLKVLGTAALAGFLGPVLKWLDPSAPEFGRGAE |
Ga0214917_103106381 | 3300022752 | Freshwater | SGETNLKVLGTAALAGFLGPVLKWLDPSATEFGRGSN |
Ga0255141_10578701 | 3300024351 | Freshwater | RAAASAAIALYLAGETDLKTLGTAALAGFLGPVLKYLDSSAKDFGRGAR |
Ga0255171_10332041 | 3300024354 | Freshwater | LYLAGETDVKTLGAAALAGFLGPVLKWLDPSAKEFGRGAE |
Ga0255164_10563291 | 3300024495 | Freshwater | LAGETDVKTLGAAALAGFLGPVLKWLDPSAKEFGRGAE |
Ga0255151_10780592 | 3300024496 | Freshwater | FRAAASAAIALYLAGETDLKTLGTAALAGFLGPVLKYLDSSAKDFGRGAR |
Ga0208147_11681742 | 3300025635 | Aqueous | SAAAAIALYLAGETNLKVLGTAALAGFLGPVLKWLDPSASEFGRGSN |
Ga0208147_11698802 | 3300025635 | Aqueous | AASAAIALYLAGETDLKTLGAAALAGFAGPLLKWLDPSATAFGRGSK |
Ga0208005_12017282 | 3300025848 | Aqueous | GETDLKTLGAAALAGFLGPVLKWLDPSASEFGRGSN |
Ga0208916_103721973 | 3300025896 | Aqueous | AAAVIALYLAGVTDPKQLASAALAGVAGPLLKYLDPSATQFGKGSE |
Ga0255076_10799853 | 3300027141 | Freshwater | RAAAAAAVALYLAGESDLKTLGMAALTGFLGPALKWLDSSSTEFGRGAE |
Ga0255081_10517793 | 3300027155 | Freshwater | AAAAAAVALYLAGESDLKTLGMAALTGFLGPALKWLDSSSTEFGRGAE |
Ga0209867_10001571 | 3300027393 | Sand | GETDLKTLAMAAVAGFAGPVLKWLDASSTEFGRGSK |
Ga0209651_11031771 | 3300027581 | Freshwater Lake | FLAGEQDLKTLAMAAVAGFAGPLLKWLDASATEFGRGSK |
Ga0208974_11761071 | 3300027608 | Freshwater Lentic | AAAVVAIYMTGETNPKTLAAAALAGVAGPVLKWLDPSATEFGRGSK |
Ga0208942_10713182 | 3300027627 | Freshwater Lentic | SAIALYLAGETDLKTLAMAAVAGFAGPVLKWLDASAPEFGRGSK |
Ga0209356_10241663 | 3300027644 | Freshwater Lake | FLAGENDLKTLGYAALAGAAGPILKWLDSSAVDFGRGSK |
Ga0209356_11147881 | 3300027644 | Freshwater Lake | GEYSAKTLAAAAVAGMAGPVLKWLDPSATEFGRGSE |
Ga0208975_10679521 | 3300027659 | Freshwater Lentic | SAAAVVALYVTGITDPKQLGAAALAGLAGPVLKWLDPSATQFGRGSE |
Ga0209553_11220334 | 3300027688 | Freshwater Lake | GTTDPKTLAYALLSGFIGPALKWLDPSAKEFGRTK |
Ga0209444_101030542 | 3300027756 | Freshwater Lake | ASAIALFLAGEQDLKTLAMAAVAGFAGPVLKWLDASATEFGRGSK |
Ga0209246_100882794 | 3300027785 | Freshwater Lake | TGITDPKQLGAAALAGLAGPVLKWLDPSATQFGRGSE |
Ga0209972_1001608911 | 3300027793 | Freshwater Lake | YLAGETNVKVLGTAALAGFLGPVLKWLDPSATEFGRGAK |
Ga0209972_103753421 | 3300027793 | Freshwater Lake | AIALYLAGETDVKTLGAAALAGFLGPVLKWLDPSAKDFGRGAE |
Ga0209972_104875711 | 3300027793 | Freshwater Lake | AAAAAAIALFLAGETDLKTLGLAALTGFLGPALKYLDPSAPEFGRKKK |
Ga0209107_100951431 | 3300027797 | Freshwater And Sediment | AAAAAVVAIYMTGETNPKTLAAAALAGVAGPVLKWLDPSATEFGRGSK |
Ga0209353_100955411 | 3300027798 | Freshwater Lake | YMTGETNPKTLAAAALAGVAGPVLKWLDPSATEFGRGSK |
Ga0209820_11724242 | 3300027956 | Freshwater Sediment | YLAGETDLKTLAMAAAAGFAGPLLKWLDPSATEFGRGSK |
Ga0247723_10686331 | 3300028025 | Deep Subsurface Sediment | ETDLKTLGLAALSGAAGPVLKWLDASAPEFGRGSK |
Ga0255174_10818191 | 3300028275 | Freshwater | AGETDVKTLGAAALAGFLGPVLKWLDPSAKEFGRGAE |
(restricted) Ga0247831_10101341 | 3300028559 | Freshwater | LYLAGETDFKTLGMAALAGFLGPVLKWLDSSATEFGRGAE |
Ga0315907_103650611 | 3300031758 | Freshwater | ALYLAGETDLKVLGTAALAGFLGPVLKWLDTSAPEFGRGSN |
Ga0315899_102418641 | 3300031784 | Freshwater | GETDLKTLAMAAVAGFAGPLLKWLDNSAPEFGRGSK |
Ga0315900_105748741 | 3300031787 | Freshwater | ESDLKTLSMAALAGAAGPILKWLDSSATEFGRSAQE |
Ga0315900_105979081 | 3300031787 | Freshwater | LAGETDFKTLGMAALAGFLGPVLKWLDPSASEFGRAK |
Ga0315900_111328631 | 3300031787 | Freshwater | AAASAAIALYLAGETDLKTLGIAALTGFLGPVLKWLDPSAPEFGRKK |
Ga0315909_100285719 | 3300031857 | Freshwater | ETDLKTLGTAALAGFLGPVLKYLDTSAKDFGRGAA |
Ga0315909_100741311 | 3300031857 | Freshwater | GITDPKQLGAAALAGLAGPVLKWLDPSATEFGRGSE |
Ga0315909_106816462 | 3300031857 | Freshwater | ALYLAGETDPKVLGTAALAGFLGPVLKWLDPSAVEFGKKKK |
Ga0315909_108149071 | 3300031857 | Freshwater | RAAASAAIALYLAGETDFKTLGAAALAGFLGPVLKWLDPSATEFGKNAR |
Ga0315904_100839519 | 3300031951 | Freshwater | AAAIALYLAGETDFKVLGTAALAGFLGPVLKWLDPSAPEFGRKK |
Ga0315904_101411018 | 3300031951 | Freshwater | ETDLKTLGAAALAGFAGPLLKWLDPSATAFGRGSK |
Ga0315904_101827185 | 3300031951 | Freshwater | AAASAAVALYLSGETDPKVLGTAALAGFLGPVLKWLDPSAVEFGKKKK |
Ga0315901_101446375 | 3300031963 | Freshwater | SAAIALYLAGETDVKTLGAAALAGFLGPVLKWLDPSAKEFGRGAE |
Ga0315901_103671333 | 3300031963 | Freshwater | ALYLAGETDLKVLGTAALAGFLGPVLKWLDPSAPEFGRVK |
Ga0315901_105316953 | 3300031963 | Freshwater | AASAAIALYLAGETDVKVLGTAALAGFLGPVLKWLDPSATEFGRGAR |
Ga0315901_109660631 | 3300031963 | Freshwater | AASAAIALYLAGETNLKTLGMAALAGFLGPVLKWLDPSATEFGRSK |
Ga0315906_104184931 | 3300032050 | Freshwater | AGETDFKTLGMAALAGFLGPVLKWLDPSASEFGRAK |
Ga0315902_102453484 | 3300032093 | Freshwater | AASAAVALYLAGETNLKVLATAALAGFLGPVLKWLDPSATEFGRGSN |
Ga0315902_103229994 | 3300032093 | Freshwater | GETDLKTLGAAALAGFLGPVLKWLDPSATEFGRGKK |
Ga0315902_106879351 | 3300032093 | Freshwater | AASAAIALYLAGETDLKTLGTAALAGFLGPVLKYLDTSAKDFGRGAA |
Ga0315903_102520534 | 3300032116 | Freshwater | YLAGETDPKVLGTAALAGFLGPVLKWLDPSAVEFGKKKK |
Ga0315903_103941011 | 3300032116 | Freshwater | LFLAGETDLKTLGLAALTGFLGPALKYLDPSAPEFGRKKK |
Ga0315903_105093831 | 3300032116 | Freshwater | GESDLKVLGYAFAAGFIGPVLKALDPKATEFGRGAKKKK |
Ga0315903_106643771 | 3300032116 | Freshwater | IALYLAGETNVKVLGTAALAGFLGPVLKWLDPSATEFGRGAK |
Ga0315903_109281032 | 3300032116 | Freshwater | SAAIALYLAGETDLKTLGAAALAGFLGPVLKWLDPSATEFGRGKK |
Ga0315903_111014071 | 3300032116 | Freshwater | AAIALYLAGETDLKTLGMAALAGFLGPVLKWLDPSATEFGRGSR |
Ga0334981_0373399_499_615 | 3300033980 | Freshwater | LAGETDLKTLGAAALAGFAGPLLKWLDPSATEFGRGSK |
Ga0334982_0284727_2_130 | 3300033981 | Freshwater | VALYVSGITDPKQLGAAALAGLAGPLLKWLDPSATEFGRGSE |
Ga0334994_0381813_572_685 | 3300033993 | Freshwater | AGETDLKTLAAAALAGFAGPLLKWLDPSATQFGRGSK |
Ga0334979_0731440_389_514 | 3300033996 | Freshwater | ALYLAGETNFKTLGAAALAGFLGPVLKWLDPSAKEFGRNAE |
Ga0334998_0207001_1_138 | 3300034019 | Freshwater | SAAIALYLAGETNFKTLGAAALAGFLGPVLKWLDPSAKEFGRNAE |
Ga0334998_0304841_806_943 | 3300034019 | Freshwater | ASAVALYLAGQTDLKVLATAALTGFLGPVLKWLDPSAAEFGRGSN |
Ga0334995_0503122_1_123 | 3300034062 | Freshwater | IALYLAGETDVKVLGTAALAGFLGPVLKWLDPSAKEFGRK |
Ga0334995_0722795_2_136 | 3300034062 | Freshwater | ASAAIALYLAGETDVKVLGTAALAGFLGPVLKWLDPSSKEFGRK |
Ga0335019_0039316_3149_3259 | 3300034066 | Freshwater | GETDLKTLGLAALSGAAGPVLKWLDASAPEFGRGSK |
Ga0335010_0521528_1_111 | 3300034092 | Freshwater | GETDLKTLGAAALAGFAGPLLKWLDPSATEFGRGSK |
Ga0335027_0753397_428_568 | 3300034101 | Freshwater | AAAAIALYLAGETNLKVLGTAALAGFLGPVLKWLDPSATEFGRGSN |
Ga0335050_0487944_1_111 | 3300034108 | Freshwater | GETNPKTLAAAGVSGLIGPALKWLDSSAKEFGRGSK |
Ga0335053_0365496_2_127 | 3300034118 | Freshwater | ALYLVGETDLKTLGLAALSGAAGPVLKWLDASSPEFGRGSK |
Ga0335016_0599689_485_601 | 3300034166 | Freshwater | VSGITDPKQLGAAALAGLAGPLLKWLDPSATEFGRGSE |
⦗Top⦘ |