Metagenome Family F023498

Basic Information
Family ID	F023498
Family Type	Metagenome
Number of Sequences	209
Average Sequence Length	39 residues
Representative Sequence	MTGFDLLTNYVEDPEALIRRTRAKLKKVSALESEDN
Number of Associated Samples	70
Number of Associated Scaffolds	209

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	78.68 %
% of genes near scaffold ends (potentially truncated)	27.75 %
% of genes from short scaffolds (< 2000 bps)	94.26 %
Associated GOLD sequencing projects	70
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.38

Most Common Taxonomy
Group	Unclassified (51.675 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere (96.651 % of family members)
Environment Ontology (ENVO)	Unclassified (97.129 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant surface (97.129 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 42.19% β-sheet: 0.00% Coil/Unstructured: 57.81%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 209 Family Scaffolds
PF03732	Retrotrans_gag	5.26

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	51.67 %
All Organisms	root	All Organisms	48.33 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	51.67 %
cellular organisms	root	All Organisms → cellular organisms	48.33 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	51.67 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	44.50 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	3.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	51.67 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	44.50 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	3.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	51.67 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	44.50 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	3.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	51.67 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	44.50 %
Aeromonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales	3.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	51.67 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	44.50 %
Aeromonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae	3.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	51.67 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	44.02 %
Aeromonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas	3.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	51.67 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	44.02 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	3.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	51.67 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	44.02 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	3.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	51.67 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	44.02 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	3.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	51.67 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	44.02 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	3.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	51.67 %
Liliopsida	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida	44.02 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	3.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	51.67 %
Petrosaviidae	subclass	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae	44.02 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	3.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	51.67 %
commelinids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids	44.02 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	3.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	51.67 %
Poales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales	44.02 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	3.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	51.67 %
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	44.02 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	3.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	51.67 %
PACMAD clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade	38.76 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	3.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	51.67 %
Panicoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	38.76 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	3.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	51.67 %
Andropogonodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae	38.76 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	3.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	51.67 %
Andropogoneae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	38.76 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	3.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	51.67 %
Sorghinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae	38.76 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	3.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	51.67 %
Sorghum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum	38.76 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	3.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	51.67 %
Sorghum bicolor	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	38.76 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	3.83 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300005840\|Ga0068870_10834036	Not Available	647	Open in IMG/M
3300011119\|Ga0105246_11673765	Not Available	604	Open in IMG/M
3300013296\|Ga0157374_12159277	Not Available	584	Open in IMG/M
3300013296\|Ga0157374_12202173	Not Available	578	Open in IMG/M
3300013297\|Ga0157378_12305474	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	590	Open in IMG/M
3300013297\|Ga0157378_12405095	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	579	Open in IMG/M
3300015267\|Ga0182122_1012143	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	814	Open in IMG/M
3300015267\|Ga0182122_1029571	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	645	Open in IMG/M
3300015267\|Ga0182122_1035426	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	615	Open in IMG/M
3300015267\|Ga0182122_1040806	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	591	Open in IMG/M
3300015267\|Ga0182122_1051956	Not Available	553	Open in IMG/M
3300015267\|Ga0182122_1055199	Not Available	544	Open in IMG/M
3300015267\|Ga0182122_1067913	Not Available	512	Open in IMG/M
3300015268\|Ga0182154_1052602	Not Available	554	Open in IMG/M
3300015269\|Ga0182113_1009128	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	993	Open in IMG/M
3300015269\|Ga0182113_1040315	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	655	Open in IMG/M
3300015269\|Ga0182113_1042816	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	644	Open in IMG/M
3300015269\|Ga0182113_1055940	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	597	Open in IMG/M
3300015269\|Ga0182113_1072235	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	552	Open in IMG/M
3300015269\|Ga0182113_1092933	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	510	Open in IMG/M
3300015274\|Ga0182188_1054141	Not Available	523	Open in IMG/M
3300015274\|Ga0182188_1057560	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	514	Open in IMG/M
3300015274\|Ga0182188_1063118	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	500	Open in IMG/M
3300015275\|Ga0182172_1046674	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	583	Open in IMG/M
3300015275\|Ga0182172_1049809	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	572	Open in IMG/M
3300015275\|Ga0182172_1055206	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	555	Open in IMG/M
3300015276\|Ga0182170_1010884	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	865	Open in IMG/M
3300015276\|Ga0182170_1027922	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	673	Open in IMG/M
3300015276\|Ga0182170_1040301	Not Available	608	Open in IMG/M
3300015276\|Ga0182170_1047535	Not Available	581	Open in IMG/M
3300015276\|Ga0182170_1061306	Not Available	540	Open in IMG/M
3300015277\|Ga0182128_1015918	Not Available	787	Open in IMG/M
3300015277\|Ga0182128_1051134	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	573	Open in IMG/M
3300015279\|Ga0182174_1010387	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	907	Open in IMG/M
3300015279\|Ga0182174_1017927	Not Available	784	Open in IMG/M
3300015279\|Ga0182174_1063939	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	550	Open in IMG/M
3300015281\|Ga0182160_1033254	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	655	Open in IMG/M
3300015281\|Ga0182160_1050094	Not Available	586	Open in IMG/M
3300015281\|Ga0182160_1050829	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	583	Open in IMG/M
3300015281\|Ga0182160_1064905	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	543	Open in IMG/M
3300015281\|Ga0182160_1074988	Not Available	520	Open in IMG/M
3300015282\|Ga0182124_1016403	Not Available	787	Open in IMG/M
3300015282\|Ga0182124_1025232	Not Available	702	Open in IMG/M
3300015282\|Ga0182124_1036647	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	635	Open in IMG/M
3300015282\|Ga0182124_1041028	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	616	Open in IMG/M
3300015282\|Ga0182124_1047393	Not Available	592	Open in IMG/M
3300015283\|Ga0182156_1053217	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	585	Open in IMG/M
3300015283\|Ga0182156_1056562	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	575	Open in IMG/M
3300015283\|Ga0182156_1065025	Not Available	551	Open in IMG/M
3300015283\|Ga0182156_1067366	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	545	Open in IMG/M
3300015283\|Ga0182156_1070317	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	538	Open in IMG/M
3300015285\|Ga0182186_1030593	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	672	Open in IMG/M
3300015285\|Ga0182186_1070639	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	528	Open in IMG/M
3300015286\|Ga0182176_1030688	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	693	Open in IMG/M
3300015286\|Ga0182176_1063121	Not Available	555	Open in IMG/M
3300015286\|Ga0182176_1070692	Not Available	535	Open in IMG/M
3300015286\|Ga0182176_1082655	Not Available	508	Open in IMG/M
3300015288\|Ga0182173_1005487	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	1074	Open in IMG/M
3300015288\|Ga0182173_1020862	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	751	Open in IMG/M
3300015288\|Ga0182173_1026581	Not Available	704	Open in IMG/M
3300015288\|Ga0182173_1035112	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	652	Open in IMG/M
3300015288\|Ga0182173_1060142	Not Available	561	Open in IMG/M
3300015288\|Ga0182173_1080234	Not Available	514	Open in IMG/M
3300015291\|Ga0182125_1025218	Not Available	738	Open in IMG/M
3300015291\|Ga0182125_1091381	Not Available	508	Open in IMG/M
3300015292\|Ga0182141_1027314	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	721	Open in IMG/M
3300015292\|Ga0182141_1031668	Not Available	692	Open in IMG/M
3300015292\|Ga0182141_1039437	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	650	Open in IMG/M
3300015294\|Ga0182126_1088299	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	516	Open in IMG/M
3300015295\|Ga0182175_1072719	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	553	Open in IMG/M
3300015296\|Ga0182157_1020676	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	804	Open in IMG/M
3300015298\|Ga0182106_1046927	Not Available	638	Open in IMG/M
3300015298\|Ga0182106_1076518	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	551	Open in IMG/M
3300015298\|Ga0182106_1084446	Not Available	535	Open in IMG/M
3300015298\|Ga0182106_1090696	Not Available	523	Open in IMG/M
3300015298\|Ga0182106_1096380	Not Available	513	Open in IMG/M
3300015299\|Ga0182107_1092884	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	522	Open in IMG/M
3300015299\|Ga0182107_1101822	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	506	Open in IMG/M
3300015300\|Ga0182108_1044414	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	657	Open in IMG/M
3300015300\|Ga0182108_1053202	Not Available	623	Open in IMG/M
3300015300\|Ga0182108_1053601	Not Available	622	Open in IMG/M
3300015300\|Ga0182108_1062290	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	594	Open in IMG/M
3300015300\|Ga0182108_1102372	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	509	Open in IMG/M
3300015302\|Ga0182143_1060300	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	596	Open in IMG/M
3300015302\|Ga0182143_1076396	Not Available	554	Open in IMG/M
3300015302\|Ga0182143_1086410	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	533	Open in IMG/M
3300015303\|Ga0182123_1041954	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	644	Open in IMG/M
3300015303\|Ga0182123_1056443	Not Available	593	Open in IMG/M
3300015303\|Ga0182123_1069724	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	558	Open in IMG/M
3300015303\|Ga0182123_1076715	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	543	Open in IMG/M
3300015303\|Ga0182123_1089048	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	519	Open in IMG/M
3300015304\|Ga0182112_1041198	Not Available	666	Open in IMG/M
3300015304\|Ga0182112_1050058	Not Available	630	Open in IMG/M
3300015304\|Ga0182112_1055431	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	612	Open in IMG/M
3300015304\|Ga0182112_1057268	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	606	Open in IMG/M
3300015304\|Ga0182112_1100669	Not Available	510	Open in IMG/M
3300015305\|Ga0182158_1093010	Not Available	521	Open in IMG/M
3300015305\|Ga0182158_1101728	Not Available	507	Open in IMG/M
3300015307\|Ga0182144_1013158	Not Available	929	Open in IMG/M
3300015307\|Ga0182144_1014114	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	911	Open in IMG/M
3300015307\|Ga0182144_1025621	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	771	Open in IMG/M
3300015307\|Ga0182144_1060672	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	601	Open in IMG/M
3300015308\|Ga0182142_1040526	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	690	Open in IMG/M
3300015308\|Ga0182142_1051106	Not Available	645	Open in IMG/M
3300015308\|Ga0182142_1059505	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	617	Open in IMG/M
3300015308\|Ga0182142_1074928	Not Available	575	Open in IMG/M
3300015308\|Ga0182142_1083388	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	557	Open in IMG/M
3300015314\|Ga0182140_1024927	Not Available	793	Open in IMG/M
3300015314\|Ga0182140_1048385	Not Available	657	Open in IMG/M
3300015321\|Ga0182127_1041508	Not Available	707	Open in IMG/M
3300015322\|Ga0182110_1040329	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	710	Open in IMG/M
3300015322\|Ga0182110_1056970	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	642	Open in IMG/M
3300015322\|Ga0182110_1115017	Not Available	515	Open in IMG/M
3300015323\|Ga0182129_1038424	Not Available	700	Open in IMG/M
3300015323\|Ga0182129_1109697	Not Available	511	Open in IMG/M
3300015341\|Ga0182187_1091657	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	665	Open in IMG/M
3300015341\|Ga0182187_1186229	Not Available	516	Open in IMG/M
3300015342\|Ga0182109_1088136	Not Available	712	Open in IMG/M
3300015342\|Ga0182109_1092329	Not Available	700	Open in IMG/M
3300015342\|Ga0182109_1152848	Not Available	582	Open in IMG/M
3300015342\|Ga0182109_1177905	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	549	Open in IMG/M
3300015342\|Ga0182109_1203187	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	521	Open in IMG/M
3300015343\|Ga0182155_1092431	Not Available	695	Open in IMG/M
3300015343\|Ga0182155_1118564	Not Available	637	Open in IMG/M
3300015344\|Ga0182189_1080997	Not Available	739	Open in IMG/M
3300015344\|Ga0182189_1112685	Not Available	656	Open in IMG/M
3300015344\|Ga0182189_1188894	Not Available	542	Open in IMG/M
3300015345\|Ga0182111_1144239	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	618	Open in IMG/M
3300015345\|Ga0182111_1166199	Not Available	585	Open in IMG/M
3300015346\|Ga0182139_1101090	Not Available	706	Open in IMG/M
3300015346\|Ga0182139_1208308	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	536	Open in IMG/M
3300015346\|Ga0182139_1217793	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	527	Open in IMG/M
3300015346\|Ga0182139_1223093	Not Available	522	Open in IMG/M
3300015346\|Ga0182139_1243756	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	503	Open in IMG/M
3300015347\|Ga0182177_1196591	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	551	Open in IMG/M
3300015347\|Ga0182177_1203963	Not Available	543	Open in IMG/M
3300015347\|Ga0182177_1231370	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	517	Open in IMG/M
3300015347\|Ga0182177_1242393	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	507	Open in IMG/M
3300015351\|Ga0182161_1100164	Not Available	740	Open in IMG/M
3300015351\|Ga0182161_1178908	Not Available	591	Open in IMG/M
3300015351\|Ga0182161_1188042	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	580	Open in IMG/M
3300015351\|Ga0182161_1219073	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	545	Open in IMG/M
3300015355\|Ga0182159_1114871	Not Available	811	Open in IMG/M
3300015355\|Ga0182159_1144350	Not Available	738	Open in IMG/M
3300015355\|Ga0182159_1235142	Not Available	599	Open in IMG/M
3300015355\|Ga0182159_1284774	Not Available	551	Open in IMG/M
3300015355\|Ga0182159_1309423	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	531	Open in IMG/M
3300015355\|Ga0182159_1333311	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	514	Open in IMG/M
3300015361\|Ga0182145_1134861	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	569	Open in IMG/M
3300015361\|Ga0182145_1137937	Not Available	565	Open in IMG/M
3300015361\|Ga0182145_1164569	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	532	Open in IMG/M
3300015361\|Ga0182145_1186795	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	509	Open in IMG/M
3300015361\|Ga0182145_1188068	Not Available	508	Open in IMG/M
3300015361\|Ga0182145_1188344	Not Available	508	Open in IMG/M
3300017410\|Ga0182207_1082365	Not Available	650	Open in IMG/M
3300017410\|Ga0182207_1112771	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	586	Open in IMG/M
3300017410\|Ga0182207_1162768	Not Available	516	Open in IMG/M
3300017411\|Ga0182208_1032122	Not Available	767	Open in IMG/M
3300017411\|Ga0182208_1088724	Not Available	567	Open in IMG/M
3300017411\|Ga0182208_1089169	Not Available	566	Open in IMG/M
3300017411\|Ga0182208_1118895	Not Available	516	Open in IMG/M
3300017413\|Ga0182222_1077992	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	548	Open in IMG/M
3300017413\|Ga0182222_1101113	Not Available	511	Open in IMG/M
3300017415\|Ga0182202_1084432	Not Available	591	Open in IMG/M
3300017417\|Ga0182230_1039225	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	829	Open in IMG/M
3300017417\|Ga0182230_1048049	Not Available	749	Open in IMG/M
3300017420\|Ga0182228_1109761	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	534	Open in IMG/M
3300017425\|Ga0182224_1061814	Not Available	688	Open in IMG/M
3300017425\|Ga0182224_1124739	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	552	Open in IMG/M
3300017427\|Ga0182190_1071002	Not Available	671	Open in IMG/M
3300017427\|Ga0182190_1091312	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	617	Open in IMG/M
3300017430\|Ga0182192_1050926	Not Available	766	Open in IMG/M
3300017430\|Ga0182192_1076019	Not Available	669	Open in IMG/M
3300017433\|Ga0182206_1079245	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	629	Open in IMG/M
3300017433\|Ga0182206_1081467	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	624	Open in IMG/M
3300017433\|Ga0182206_1105240	Not Available	575	Open in IMG/M
3300017433\|Ga0182206_1112420	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	563	Open in IMG/M
3300017433\|Ga0182206_1119708	Not Available	552	Open in IMG/M
3300017436\|Ga0182209_1097305	Not Available	607	Open in IMG/M
3300017438\|Ga0182191_1172706	Not Available	512	Open in IMG/M
3300017442\|Ga0182221_1100636	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	593	Open in IMG/M
3300017680\|Ga0182233_1113162	Not Available	508	Open in IMG/M
3300017681\|Ga0182226_1074037	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	628	Open in IMG/M
3300017682\|Ga0182229_1041307	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	785	Open in IMG/M
3300017683\|Ga0182218_1087030	Not Available	600	Open in IMG/M
3300017683\|Ga0182218_1088654	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	597	Open in IMG/M
3300017684\|Ga0182225_1038512	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	757	Open in IMG/M
3300017684\|Ga0182225_1119515	Not Available	534	Open in IMG/M
3300017685\|Ga0182227_1081852	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	609	Open in IMG/M
3300017685\|Ga0182227_1124345	Not Available	520	Open in IMG/M
3300017685\|Ga0182227_1125620	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	518	Open in IMG/M
3300017686\|Ga0182205_1025814	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	933	Open in IMG/M
3300017686\|Ga0182205_1104985	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	594	Open in IMG/M
3300017686\|Ga0182205_1128397	Not Available	555	Open in IMG/M
3300017689\|Ga0182231_1118524	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	517	Open in IMG/M
3300017690\|Ga0182223_1124073	Not Available	503	Open in IMG/M
3300021060\|Ga0182232_1063338	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	607	Open in IMG/M

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	100.00%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	100.00%

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	97.13%
Rhizosphere	Host-Associated → Plants → Rhizosphere	2.39%
Rhizoplane	Host-Associated → Plants → Rhizoplane	0.48%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	97.13%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	2.39%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	0.48%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	97.13%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	2.39%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	0.48%

Habitat	Taxonomy	Distribution
Miscanthus Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere	96.65%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.91%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	0.48%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.48%
Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere	0.48%

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Host-Associated	Open in IMG/M
3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Host-Associated	Open in IMG/M
3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Host-Associated	Open in IMG/M
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated	Open in IMG/M
3300015267	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015268	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015269	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015274	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015275	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015276	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015277	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015279	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015281	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015282	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015283	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015285	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015286	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015288	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015291	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015292	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015294	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015295	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015296	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015298	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015299	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015300	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015302	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015303	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015304	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015305	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015307	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015308	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015314	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015321	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015322	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015323	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015341	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015342	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015343	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015344	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015345	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015346	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015347	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015351	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015355	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015361	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300017410	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017411	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017413	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017415	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017417	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017420	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017425	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017427	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017430	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017433	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017436	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017438	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017442	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017443	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017680	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017681	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017682	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017683	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017684	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017685	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017686	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017689	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017690	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300021060	Phyllosphere microbial comminities from miscanthus, Michigan, USA - G6R3_NF_07NOV2016_LD2 MG	Host-Associated	Open in IMG/M

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0068870_108340361	3300005840	Miscanthus Rhizosphere	MTGFDLPTNYIDNPEALLKRTKAKLKKVSALESEDNHIW*
Ga0105246_116737651	3300011119	Miscanthus Rhizosphere	MTSFDLLTNYVENLEALIRRTRAKLKKVPALKLEDNHI
Ga0157374_121592771	3300013296	Miscanthus Rhizosphere	MIGFDLSTNYVEDPEALIRRTRAKLKKVPALKSKDNHIR*
Ga0157374_122021731	3300013296	Miscanthus Rhizosphere	MTSFDLPTNYVEDLKALMRRTRAKLKKVPALESEDNQIR*
Ga0157378_123054741	3300013297	Miscanthus Rhizosphere	MTGFDPPINYVDDLEALLKRTKAKLKKILALELEDN*
Ga0157378_124050951	3300013297	Miscanthus Rhizosphere	CMTCFDLPRNYVEDPEALIRRTRAKLKKVLALKSEDNHIR*
Ga0182122_10121431	3300015267	Miscanthus Phyllosphere	MYDWFDLPTNYVEDLEALIRRTKAKLKKVLALESKDNHIGEA*
Ga0182122_10295711	3300015267	Miscanthus Phyllosphere	TGFDLLTNYVEDTKALIRRTRAKLKKVPSLESEDNQTR*
Ga0182122_10354262	3300015267	Miscanthus Phyllosphere	MIGFDLPINYVEDPEALIRRTRAKLKKVPALESENN*
Ga0182122_10408062	3300015267	Miscanthus Phyllosphere	MTDFDLLTNYIEDPEALLKRTRAKLKKVLALKSEANHIR*
Ga0182122_10519561	3300015267	Miscanthus Phyllosphere	TGFNLPMNYVDDPEALVRRTRAKLKKVPALESEDN*
Ga0182122_10551991	3300015267	Miscanthus Phyllosphere	MTGFDLLTNYVDDPEALLKRTKAKLKKVLALELEDN*
Ga0182122_10679132	3300015267	Miscanthus Phyllosphere	MTGFDLSTNYIEDPEALIRRTRAKLKKVSALVSED
Ga0182154_10526022	3300015268	Miscanthus Phyllosphere	MTGFDLSTNYVEDIETLIRRTRAKLKKVLALKSEDNHIRRSLT
Ga0182113_10091281	3300015269	Miscanthus Phyllosphere	MIGFDLLTNYIEDPEVLIRRTRAKLKKVPALKSEDNHIR*
Ga0182113_10403151	3300015269	Miscanthus Phyllosphere	MTGFDLPTNYVEDPEVLIRRTRAKLKKVLALESEDN*
Ga0182113_10428162	3300015269	Miscanthus Phyllosphere	MTGFDLLTNYIEDPEALIRRTRAKLKKVLALDLEDN*
Ga0182113_10558761	3300015269	Miscanthus Phyllosphere	MTGFDLPTNYVEDPEALIRRTRAKLKKVLVLESEDNQIRQSLTLE
Ga0182113_10559402	3300015269	Miscanthus Phyllosphere	MADFDLPTDDVDNPKALLKRTRAKLKKVSALESEDQ*
Ga0182113_10722351	3300015269	Miscanthus Phyllosphere	MTGFDLPTNYIKDPEALIRRTRAKLKKVLALESEDNQTR*
Ga0182113_10929331	3300015269	Miscanthus Phyllosphere	MYDHFDLSTNHVENPEALIRRTRAKLKKTPALKSEDNHIRRSLTPEF*
Ga0182188_10541411	3300015274	Miscanthus Phyllosphere	MTGVDLLTKYVDDPEALIKRTKAKLKKVSALESEDNHIR*
Ga0182188_10575601	3300015274	Miscanthus Phyllosphere	MTGFDLLRNYVEDPEALIRRTKSKLNKVSTLESKGNQIL*
Ga0182188_10631181	3300015274	Miscanthus Phyllosphere	MTNFDLPTNYVEDLEALLKRTKAKLKKVLALELEDK*
Ga0182172_10466742	3300015275	Miscanthus Phyllosphere	CMTGFDPPINYVDDLEALLKRTKAKLKKILALELEDN*
Ga0182172_10498091	3300015275	Miscanthus Phyllosphere	MISFNLPTNYVEDLEALIRRTRAKLKKVLVLESEDNQIR*
Ga0182172_10552061	3300015275	Miscanthus Phyllosphere	MIGFDLPTNYVDDPEALLKRTKAKLKKVSALESEDNQIR*
Ga0182170_10108841	3300015276	Miscanthus Phyllosphere	MTGFDLLTNYVDYPEALLKRTKAKLKKVSALESEDNHIR*
Ga0182170_10279221	3300015276	Miscanthus Phyllosphere	MIGFDLPTNYVDDLEALLRKTKAKLKKVLALESKDNHIR*
Ga0182170_10403011	3300015276	Miscanthus Phyllosphere	MTDFDLPTNYVEDPEALIRRTRAKLKKVPSLESEDNQVR*
Ga0182170_10475352	3300015276	Miscanthus Phyllosphere	MTGIDLPTNYVDNLEKLLKRTRAKLKKVLALESEDNQIR*
Ga0182170_10613061	3300015276	Miscanthus Phyllosphere	MTDFDLSTNYVDDPEALLKRTKAKLKKVLALESEDNQIR*
Ga0182128_10159182	3300015277	Miscanthus Phyllosphere	MTGFDLPTNYVDNLEALLKRTRAKLKKVSVLESEDNRIR*
Ga0182128_10511342	3300015277	Miscanthus Phyllosphere	MTGFDLPTKYVEDPEAVIRRTRAKLKKVPALKSKDNHIR*
Ga0182174_10103871	3300015279	Miscanthus Phyllosphere	MTGFDLPINYVEDTKALIRRTRAKLKKVSALVSKDNHIR*
Ga0182174_10179271	3300015279	Miscanthus Phyllosphere	MTGFDLLTNYVEDLEALIRRTRAKLEKVSALESNDNQIR*
Ga0182174_10639391	3300015279	Miscanthus Phyllosphere	MIGFDLLTNYVEDPEALIRRTRAKLKKVLSLKLEDNHIR*
Ga0182160_10332541	3300015281	Miscanthus Phyllosphere	MTGFDLPTNYVDDLEALLKRSKAKLKKVSALESEDNQIR*
Ga0182160_10500941	3300015281	Miscanthus Phyllosphere	MTCFDLPTNYIEDPEALIKRTKAKLKKVSALESEDNQ
Ga0182160_10508292	3300015281	Miscanthus Phyllosphere	MTGFDLSTNYVEDPEALIKRTRAKLKKVSASESEDNQIR*
Ga0182160_10649051	3300015281	Miscanthus Phyllosphere	MTNFDLPTNYIEDPEALIKKTRAKLKKVLALELEDNQIR*
Ga0182160_10749882	3300015281	Miscanthus Phyllosphere	MTDFDLPTNYVEDPEALIRKASAKLKKVPALKSEDNHIK*
Ga0182124_10164031	3300015282	Miscanthus Phyllosphere	MTSFDLSTNYVDDLKALLRRTKAKLKKVSALELEDNQIR*
Ga0182124_10252321	3300015282	Miscanthus Phyllosphere	MTSFDLPTNYVEDPEALIRRTRAKLKKVLALESEDNQTRRSLTLVL
Ga0182124_10366471	3300015282	Miscanthus Phyllosphere	MTGFDPLTNYVEDPEVLIRRTRAKLKKVSALESEDN*
Ga0182124_10410282	3300015282	Miscanthus Phyllosphere	MTGFDLPTNYIEDPEALIRRTRAKLKKVSALELEDN*
Ga0182124_10473931	3300015282	Miscanthus Phyllosphere	MTGFDLQSNYVENPEALLRRTKAKLKKVSALESKDN*
Ga0182124_10742131	3300015282	Miscanthus Phyllosphere	MTGFDVLTNYIKNLEALLRRTKAKLKKVLALESEDNQIR*
Ga0182156_10532171	3300015283	Miscanthus Phyllosphere	MTGFDLSTNYVEDPEVLIRRTRAKLKKVPVLKSEDNHIG*
Ga0182156_10565622	3300015283	Miscanthus Phyllosphere	MTGFDLPTNYVEDPEALIRRTRAKLKKVLALDLEDN*
Ga0182156_10650251	3300015283	Miscanthus Phyllosphere	MTSFDLSTNFIEDLEALIRRTRAKLKMVSALESEDNQT
Ga0182156_10673662	3300015283	Miscanthus Phyllosphere	MTNFDLPINYVEDPEALIRRTRAKLKKVPALESENN*
Ga0182156_10703172	3300015283	Miscanthus Phyllosphere	MTGFDLPTNYIEDTEALIRRTRAKLKKVLALESKDNQTR*
Ga0182186_10305931	3300015285	Miscanthus Phyllosphere	MTGFDLPTNYVKDPEALIKRARAKLKKVPALEPEDNRIR*
Ga0182186_10706392	3300015285	Miscanthus Phyllosphere	MTSFDLPTNYVDDPEALLKRTKAKLKKVLALESKDNHIR*
Ga0182176_10306881	3300015286	Miscanthus Phyllosphere	MTSFDLPTNYIDDPEALLKRTKAKLKKVLALESEDN*
Ga0182176_10631212	3300015286	Miscanthus Phyllosphere	MMGFDLPTNYVENPEALLRRTKAKLKKVLALESEDN*
Ga0182176_10706921	3300015286	Miscanthus Phyllosphere	MTGFDLLTNYVENLEALHRRTKAKIKKVSALESEETRQGE
Ga0182176_10826552	3300015286	Miscanthus Phyllosphere	MTGFDIPTNYVEDPEALIRRTRAKLKKVSALELKGN*
Ga0182173_10054871	3300015288	Miscanthus Phyllosphere	LVFDLPINYVDDPEALIRRTRAKLKKVVALESEDNQIR*
Ga0182173_10208621	3300015288	Miscanthus Phyllosphere	MTDFDLPTNYVEDPEALLRKTKAKLKKVSALESEDNQIR*
Ga0182173_10265811	3300015288	Miscanthus Phyllosphere	MTGFDLPINYVEDPEALIRRTRAKLKKVPVLKLKDNYIR*
Ga0182173_10351122	3300015288	Miscanthus Phyllosphere	GFNLPTNYVEDPKALLKRTKAKLKKVLALESEDNRIR*
Ga0182173_10601421	3300015288	Miscanthus Phyllosphere	MTGFDLLTNYIDDLEALLKRTKAKLKKVLALESEDNHIT*
Ga0182173_10802341	3300015288	Miscanthus Phyllosphere	MIGFDLLTNYIDDPEALIRRIRAKLKKVLGLDSKNNQTR*
Ga0182125_10252181	3300015291	Miscanthus Phyllosphere	MTGFDLPTNYVEDPEALIRKTRAKLKVSALESEDN*
Ga0182125_10913811	3300015291	Miscanthus Phyllosphere	MTGFDPSTNYIKNPEALIRRTKAKLKKVLALDSEETRQGEA*
Ga0182141_10273142	3300015292	Miscanthus Phyllosphere	MTGFDIPTNYVEDPEALIRKTRAKLKKVSALKSEDNQIR*
Ga0182141_10316681	3300015292	Miscanthus Phyllosphere	MTGFDLSTNYIEDLEALIRITRAKLKKVSALESEDNQTRHSLT
Ga0182141_10394371	3300015292	Miscanthus Phyllosphere	MTIFDLPTNYVEDPEALIRRTRAKLKKVSALELEDY*
Ga0182126_10882992	3300015294	Miscanthus Phyllosphere	MTGFDLPIIYNENPEALLRRTKAKLKKVSALESKDN*
Ga0182175_10727191	3300015295	Miscanthus Phyllosphere	MTDFDLPTNFVEDPEALLKRTRAKLKKVLALESEDNQIR*
Ga0182157_10206762	3300015296	Miscanthus Phyllosphere	MTGFDLLANYVDNPEALLKRTKAKLKKVLALESEDNHIR*
Ga0182106_10469271	3300015298	Miscanthus Phyllosphere	MTGFYLLTKYIEDLEALIRRTRAKLKKVLALESEDN*
Ga0182106_10765182	3300015298	Miscanthus Phyllosphere	MIGFDLPTNYIEDLEALSRRTKAKLKKVSALESEDNQTR*
Ga0182106_10787712	3300015298	Miscanthus Phyllosphere	MTGFDLSTNYVEDPEALIRRTKAKVLASEVEDNQPRHNLTLVF*
Ga0182106_10844461	3300015298	Miscanthus Phyllosphere	MTGFDLPTNYVEDQEELFRRTKAKLKKVSALESEDNQ
Ga0182106_10906961	3300015298	Miscanthus Phyllosphere	MTGFDFSTNYVENSETLLRRTKAKLKKVSALELEDN*
Ga0182106_10963801	3300015298	Miscanthus Phyllosphere	MTGFNLSTNFVENLEALIRRTRAKLKKTLASKSEDNHIRRSLILEFE
Ga0182107_10928842	3300015299	Miscanthus Phyllosphere	MTGFDLPTNYVEDPEALIRRTRAKLKKVPALKSEDNHIR*
Ga0182107_11018221	3300015299	Miscanthus Phyllosphere	SFDLPTNYVDNPEALLKRTRAKLKKVLALESKDNQIR*
Ga0182108_10444141	3300015300	Miscanthus Phyllosphere	MTSFDLLINYVDDPEALLKRTKAKLKKVLALESGTTI*
Ga0182108_10532021	3300015300	Miscanthus Phyllosphere	MIGFDLPTNYVDNPKALLKRTKAKLKKVSALESEDNHIR*
Ga0182108_10536011	3300015300	Miscanthus Phyllosphere	MTSSDLPTNYVDNLEALLKRTRAILKKVLVLESED
Ga0182108_10622901	3300015300	Miscanthus Phyllosphere	MIGFDLPTNYVEDPEALIRKASAKLKKVPALKSEDNHIK*
Ga0182108_10768611	3300015300	Miscanthus Phyllosphere	MTSFDLLKNFIEDPEALIRRTKAKVLASEVEDNQPRHNLTLVF*
Ga0182108_11023722	3300015300	Miscanthus Phyllosphere	MTGFDLSINYIEDPEALIRRTRAKLKKVPALDSKDNHTRRSLTPVF*
Ga0182143_10603001	3300015302	Miscanthus Phyllosphere	MIDFDLPTNYVEDPEALIKKTRAKIKKVSALMLEDNHIR*
Ga0182143_10763962	3300015302	Miscanthus Phyllosphere	MYDWFDLLTNYIDDPEALLRRTKAKLKKVSASESEDN*
Ga0182143_10864102	3300015302	Miscanthus Phyllosphere	MTGFDLPTNYVEDPKVLIRRTRAKLKKVLALELEDN*
Ga0182123_10359111	3300015303	Miscanthus Phyllosphere	MTGFDLPTNYVENLEALLRRTKAKLKKVLALESEDN*
Ga0182123_10419541	3300015303	Miscanthus Phyllosphere	MTGFDLLTNYIEDLEALNRRTRAKLKKVSAIELEDNLTR*
Ga0182123_10564431	3300015303	Miscanthus Phyllosphere	MIGFDFPRNYVDDPEALIRRTRAKLKKVLALESEDN*
Ga0182123_10697241	3300015303	Miscanthus Phyllosphere	MTGFDLLTNYIEDPEALIRRTKAKLKKVLALESEDNQIRQS*
Ga0182123_10767152	3300015303	Miscanthus Phyllosphere	MIGFDLPTNYVGDPKALLKRTKAKLKNVLALESEDK*
Ga0182123_10890481	3300015303	Miscanthus Phyllosphere	MTGFDLLTNYVDDPEALLKRTKAKLKKVSALESEDN*
Ga0182112_10411981	3300015304	Miscanthus Phyllosphere	VTGFDLSTNYVEYPEALIRRTGAKLKKVSALESEDNQIR*
Ga0182112_10500582	3300015304	Miscanthus Phyllosphere	MTGFDLLTNYVEDLEALIRRIRAKLKKVSTLESKDNQI
Ga0182112_10554312	3300015304	Miscanthus Phyllosphere	MTGFGLLTNYVKDLEALFRRTKAKLKKVSALESEDN*
Ga0182112_10572681	3300015304	Miscanthus Phyllosphere	MIGFDLPTNYVEDPKALIRRTRAKLKKVPALEPEDNRIR*
Ga0182112_11006691	3300015304	Miscanthus Phyllosphere	MTGFDLPINYVEDLEALIKRTKAKLKKVLALELEDN*
Ga0182158_10930101	3300015305	Miscanthus Phyllosphere	MTGFDLPTNYVVDPKALIRRTRAKLKKVSALESKGNQTRR
Ga0182158_11017281	3300015305	Miscanthus Phyllosphere	MQGNVCGFDHPTNYIEDLEALIRRTRSKLKKVPALESKDNQ
Ga0182144_10131581	3300015307	Miscanthus Phyllosphere	MTGFDLPTNYVEDPEALLKRTRAKLKKIPALKSEDNHIRRSLTP*
Ga0182144_10141141	3300015307	Miscanthus Phyllosphere	MTSFDLLTNYVENPETLFRRTMAKLKKVLALELEDN*
Ga0182144_10256212	3300015307	Miscanthus Phyllosphere	MIDFDLPTNTVDDPEALISWTRAKLKKVPALESEDN*
Ga0182144_10606722	3300015307	Miscanthus Phyllosphere	MTGFDLLINYVEDPEALIRRTRAKLKKVLALESEDN*
Ga0182142_10405262	3300015308	Miscanthus Phyllosphere	MTGFDLLINYVENPEALLRRTKAKLKKVSALESKDIQTR*
Ga0182142_10511061	3300015308	Miscanthus Phyllosphere	MTGFDLSTNYVDDPKALLKRTKVKLKKVLALESEDNQIR*
Ga0182142_10595051	3300015308	Miscanthus Phyllosphere	MTGFDLLTNYVDNPEALLKRTKAKLKKVLALESKDN*
Ga0182142_10749281	3300015308	Miscanthus Phyllosphere	MTDFDLPTNYIEDPEALIRKTRAKLKKVLALKLEDNHIRRSLT
Ga0182142_10833882	3300015308	Miscanthus Phyllosphere	MAGFDLLINYVDDPEALLRKTKAKFKNVSALESEDNQIR*
Ga0182140_10249271	3300015314	Miscanthus Phyllosphere	MTGFDLPTNYVEDPEALIRRTRAKLKKVLALKSEDNHIRRSLT
Ga0182140_10483851	3300015314	Miscanthus Phyllosphere	MTGFDLPTNYVKNPEQLLKRTKAKLKKVSALELEDNQTR
Ga0182127_10415081	3300015321	Miscanthus Phyllosphere	MIGFDFLTNYVEDPEALIRRTKAKLKNVLALELEDN*
Ga0182110_10403291	3300015322	Miscanthus Phyllosphere	MTGFDLPTNYIDDLEALLKRTKAKLKKVSALESEDNQIR*
Ga0182110_10569702	3300015322	Miscanthus Phyllosphere	MTGFDLPTNYVDDPKALLKRTKAKLKKVLALELEDNHIR*
Ga0182110_11150171	3300015322	Miscanthus Phyllosphere	MTSFDLPTNYVEDLEALIRRTKAKLKKVLALDLEDNQTRQSLTPKF
Ga0182129_10384241	3300015323	Miscanthus Phyllosphere	MIGFDLPTNYVDDLEALLRKTKAKLKKVLALESKDN*
Ga0182129_10462282	3300015323	Miscanthus Phyllosphere	MTGFDLPTNYVDVPKALIRRTRAKLKKVLALESKDNQIRRSLTPEF*
Ga0182129_11096972	3300015323	Miscanthus Phyllosphere	MTGFDLPTNYVEDPEVLIRRTRAQLKKVSALESKKNK*
Ga0182187_10916571	3300015341	Miscanthus Phyllosphere	MTGFDLLKNYVEDLEASIRRTRAKLKKILASESEDN*
Ga0182187_11862291	3300015341	Miscanthus Phyllosphere	MTGFDLSTNYVEDPEALLKRTKAKLKKVLALELEDNQIRQSLTPKFE
Ga0182109_10881361	3300015342	Miscanthus Phyllosphere	MTGFDLPTNYVDDLEALLKRTKAKLKKVLALESKDNQIRRS
Ga0182109_10923291	3300015342	Miscanthus Phyllosphere	MTGFDLPTNYVEDPEALIRRTRAKLKKTLALKLEDNHKR*
Ga0182109_11528481	3300015342	Miscanthus Phyllosphere	MTGFDLSINYIEDPEALIRRTRAKLKKVSALELEDN*
Ga0182109_11779053	3300015342	Miscanthus Phyllosphere	MTGFDLLTNYVEDPEALIRRTRAKLKKVSALELKGN*
Ga0182109_12031871	3300015342	Miscanthus Phyllosphere	MTGFDLLTNYVENPEALLKRTKTKLKKVLALESEDN*
Ga0182155_10924311	3300015343	Miscanthus Phyllosphere	MIGFNLSTNYVEDLEALIRRTRAKLKKVPASELEDNRIR*
Ga0182155_11185641	3300015343	Miscanthus Phyllosphere	MTGFDLPTNYVEDPKALIRRTRAKLKKVSALKSEDNHI
Ga0182155_11883461	3300015343	Miscanthus Phyllosphere	MTGFDLPTNYIDDPEALLRRTKAKLKKVYALESKDNQIRRSLTLEFE
Ga0182189_10809971	3300015344	Miscanthus Phyllosphere	MTGFDLSTNYVEDPEALIRSTRAKLKKVLALELKDNH
Ga0182189_11126851	3300015344	Miscanthus Phyllosphere	MTGFDLSTNYVKDLEALIRRTRAKLKKVLALESKDNQTRHSL
Ga0182189_11888941	3300015344	Miscanthus Phyllosphere	MTYFDLLTNYIEDPEALIRRTRAKLKKVLALKSEDNHIR
Ga0182111_11442392	3300015345	Miscanthus Phyllosphere	PTNYIDNPEALLKRTKAKLKKVSALESEDNHIRQSLTP*
Ga0182111_11661992	3300015345	Miscanthus Phyllosphere	MTDFDLPTNYVEDPEALVRRIRVKLKKVSALELEDN*
Ga0182139_11010901	3300015346	Miscanthus Phyllosphere	MAGFDLPTNYIEDPEALIRRTKAKLKKVLALESEDNKIK*
Ga0182139_12083082	3300015346	Miscanthus Phyllosphere	MTGFDLPTNYVDDPEALLKRTKAKLKKVLALELEDNHIR*
Ga0182139_12177931	3300015346	Miscanthus Phyllosphere	MTGFDLPMNYVEDLEALLKRTKAKLKKVLALESENN*
Ga0182139_12230931	3300015346	Miscanthus Phyllosphere	MTGFDLLTNYVDDPEALLKRTMAKLNKVLALELEDNQIR*
Ga0182139_12437561	3300015346	Miscanthus Phyllosphere	MTGFDLPTNYVEDPEALLRRTKAKLKKVLALESEDNKIK*
Ga0182177_11965912	3300015347	Miscanthus Phyllosphere	MTGFDLPTNYVDDSEALLKRTKAKLKKVLALDSEDNHIR*
Ga0182177_12039632	3300015347	Miscanthus Phyllosphere	MIGFNLSTNYIEDPEALIRKTRAKLKKVSALKLEDN*
Ga0182177_12313702	3300015347	Miscanthus Phyllosphere	MTDFDLPTNHVEDPGALIRRTRAKLKKVSALESEDNQIR*
Ga0182177_12423932	3300015347	Miscanthus Phyllosphere	MIGFNLPTTYIEDPEALIRRTRAKLKKVPASESEDIWIR*
Ga0182161_11001642	3300015351	Miscanthus Phyllosphere	MQGNVCGFDQPTNYIEDLEALIRRTRAKLKKVLALELQDNHIR*
Ga0182161_11789081	3300015351	Miscanthus Phyllosphere	MAGFDLLINYVEDPKALIRRTKAKLKKVLALVSKDNHIRQSL
Ga0182161_11880423	3300015351	Miscanthus Phyllosphere	MTGFDLPTNYVEDPEALLKMTKAKLKKVLALESEDN*
Ga0182161_12190731	3300015351	Miscanthus Phyllosphere	MTGFGLPTNYVDDPEALLKRTKAKLKKVSALVLKDN*
Ga0182161_12417782	3300015351	Miscanthus Phyllosphere	MIGFDLTTNYIEDLEALIRKTRAKLKKVSTLKSEDNHIRQILTP*
Ga0182159_11148712	3300015355	Miscanthus Phyllosphere	MTGFDPPINYVDDPKALIRRTRAKLKKVPALESKDNQTR
Ga0182159_11443501	3300015355	Miscanthus Phyllosphere	MTGFDLPTNYVDDPAALLKRTKAKLKKVSALESEDNQIR*
Ga0182159_12351421	3300015355	Miscanthus Phyllosphere	MTGFDLSTNYVDDPEALLKRTKAKLKKVSALELEDNHIRRSLTP*
Ga0182159_12847741	3300015355	Miscanthus Phyllosphere	MTGFDLPTNYVDDPEALLKRTKAKLKKVSALESEDNQIR
Ga0182159_13094231	3300015355	Miscanthus Phyllosphere	CMTGFDLPTNYVEDPEALIRRTRAKLKKVLALELKDN*
Ga0182159_13333112	3300015355	Miscanthus Phyllosphere	MTSFDLSINYVDDLEALLKRTKAKLKKVLALESEDN*
Ga0182145_11348612	3300015361	Miscanthus Phyllosphere	MTGFDLSTNYVDDPKALLKRTKAKLKKVSALESEDNHIW*
Ga0182145_11379371	3300015361	Miscanthus Phyllosphere	MTGFDLLTNYVEDPEALIRRTRAKLKKVSALESEDN
Ga0182145_11645691	3300015361	Miscanthus Phyllosphere	MTGFDLLINYVEDPEALIMTTAKLKKVLALDSEDNK
Ga0182145_11867951	3300015361	Miscanthus Phyllosphere	MTGFDLSTNYIEDPEALIRRTRAKLKKVPTLKSEDNHIR*
Ga0182145_11880681	3300015361	Miscanthus Phyllosphere	MTGFDLLTNYIEDPEALIRKTRAKLKKVPALKSKDNHIRRSL
Ga0182145_11883441	3300015361	Miscanthus Phyllosphere	MTGFDLLTNYVDNPEALLKRTRAKLKKVSALESGDHR
Ga0182207_10823651	3300017410	Miscanthus Phyllosphere	MTGFDLSTNYVDDPEALLKRTKAKLKKVSALVLKDN
Ga0182207_10866391	3300017410	Miscanthus Phyllosphere	MTGFDLPTNYVENLEALLRRTKAKLKKVLALESEDN
Ga0182207_11127711	3300017410	Miscanthus Phyllosphere	MIGFDLPTNYVDNPKALLKRTKAKLKKVLALESKDNHIR
Ga0182207_11627681	3300017410	Miscanthus Phyllosphere	MNGFDLPTNYVEDPEALIRKTRAKLKVSALESEDN
Ga0182208_10321221	3300017411	Miscanthus Phyllosphere	MTGFDLPTNYVDDPKALLKRTKVQLKKVSALESEDNQIR
Ga0182208_10887241	3300017411	Miscanthus Phyllosphere	MTGFDPPINYVDDLEALLKRTKAKLKKILALELEDN
Ga0182208_10891691	3300017411	Miscanthus Phyllosphere	MTGFDLPKNYVENPEALIKRTQVKLKKTLALNSKDRYIRRSLTPEFE
Ga0182208_11188951	3300017411	Miscanthus Phyllosphere	MTGFDLPTNYVDNPEALLKRTKVKLKKVLALESKDN
Ga0182222_10779922	3300017413	Miscanthus Phyllosphere	MTGFDLPTNYVEDPEALIRRTRAKLKKTPALKSEDNQLR
Ga0182222_11011132	3300017413	Miscanthus Phyllosphere	MTSFDLPTNYVEDPEALIRRTRAKLKKVLALELKDN
Ga0182202_10844321	3300017415	Miscanthus Phyllosphere	MTGFDLPTNYVEDPEALIRRTRAKLKKVLALELKDN
Ga0182230_10392253	3300017417	Miscanthus Phyllosphere	MTSFDPPTNYIDDPEALLRRTKVKLKKVPASESEDN
Ga0182230_10480491	3300017417	Miscanthus Phyllosphere	MTSFDLPTNYVEDPEALIRRTRAKLKKVSALESEDN
Ga0182228_11097611	3300017420	Miscanthus Phyllosphere	IGFNLSTNYIEDPEALIRKTRAKLKKVSALKLEDN
Ga0182224_10618141	3300017425	Miscanthus Phyllosphere	MTGFDLPTNYVEDLEALIRRTRAKLKKVLDLESKDNQT
Ga0182224_11247392	3300017425	Miscanthus Phyllosphere	MIGFDLPTNYVDDLEALLKRTKAKLKKVLALELEDK
Ga0182190_10710021	3300017427	Miscanthus Phyllosphere	MTSFDLPTNYIEDPEALFRRTKAKLKKVLALELEDS
Ga0182190_10913121	3300017427	Miscanthus Phyllosphere	MIGFDLPINYVDDPEALIRRTKAKLKKVLALESEDNQIRQS
Ga0182192_10509261	3300017430	Miscanthus Phyllosphere	TNYVDDPEALLKRTKAKLKKVLALESEDNQIRLKL
Ga0182192_10760191	3300017430	Miscanthus Phyllosphere	LTSFDLPTNYVNDPEALLKRTKAKLKKVLALESDDNHI
Ga0182192_11543181	3300017430	Miscanthus Phyllosphere	MTGFDLPTNYAENLEALLRRTKAKLKVPDLESEDN
Ga0182206_10792451	3300017433	Miscanthus Phyllosphere	CMTDFDLPTNYVEDPEALIRRTRAKLKKTLALKSEDNQIRRSLTP
Ga0182206_10814672	3300017433	Miscanthus Phyllosphere	MTSFDLPTNYVEDPEALIRRTRAKLKKVPTLDSEDN
Ga0182206_11052402	3300017433	Miscanthus Phyllosphere	MTSFDLPTNYVEDPKVLFRRTKAKLKKVSALESEDN
Ga0182206_11124201	3300017433	Miscanthus Phyllosphere	GFDLSTNYIEDLEALIRRTRAKLKKVPALDLEDNQIR
Ga0182206_11197081	3300017433	Miscanthus Phyllosphere	MTSFDLPTNYVDNPGALLKRTKAKLKKVSALELEDN
Ga0182209_10973052	3300017436	Miscanthus Phyllosphere	MIGFDLPINYVEDPEALIRRTRAKLKKVLALKSEDNHIR
Ga0182191_11727061	3300017438	Miscanthus Phyllosphere	MTDFDLLTNYVEDSKALIRRTRAKLKKVPALKSDDNHIK
Ga0182221_11006362	3300017442	Miscanthus Phyllosphere	MIGFDLPKNYVDNPEALLKRTRAKLKKVSALELKGEA
Ga0182193_11241211	3300017443	Miscanthus Phyllosphere	MTGFNLSTNYVDNPEALLKRTRAKLKKVLALESEDNQIRRSLTLEFEA
Ga0182233_11131621	3300017680	Miscanthus Phyllosphere	MTSFDLPTNYVEDPEALIRRTRAKLKKVLALESKDN
Ga0182226_10740372	3300017681	Miscanthus Phyllosphere	MTGFDLPTNYVEDPEVLFRRTKVKLKKVSALESEDN
Ga0182229_10413072	3300017682	Miscanthus Phyllosphere	MTGFDLPINYVDDPEALLKRTKAKLKKVLALESEDNQKAKLNT
Ga0182218_10839081	3300017683	Miscanthus Phyllosphere	MTGFDLSTNYVDDPEALLKRTRAKLKKVLALESEDNQIRRA
Ga0182218_10870301	3300017683	Miscanthus Phyllosphere	MTDFDLPTNYIDDPEALLKRTKAKLKKVSALELEDNHIRR
Ga0182218_10886542	3300017683	Miscanthus Phyllosphere	MTGFDLSTNYVEDPKALIRRTRAKLKKVPVLKSEDNHIR
Ga0182225_10385122	3300017684	Miscanthus Phyllosphere	MIGFDLLTNYIDDPEALIRRTRAKLKKVLALESEDN
Ga0182225_11195151	3300017684	Miscanthus Phyllosphere	MTGFDLPTNYIDDPEALLRRTKAKLKKVSASESEDN
Ga0182227_10818522	3300017685	Miscanthus Phyllosphere	TNFDLPINYVEDPEALIRRTRAKLKKVPSLELEDNQIGRS
Ga0182227_11243451	3300017685	Miscanthus Phyllosphere	MTSFDLPTNYIDDPEALLKRTKVKLKKVSALESEDNQIRRSLT
Ga0182227_11256201	3300017685	Miscanthus Phyllosphere	MIGFDLSTNYVENPKALLKTTKAKLKKVSALESEETRQGEAQESF
Ga0182205_10258142	3300017686	Miscanthus Phyllosphere	MTSFDLLTNYVENPEALLRRTKAKLKKVSALESKDN
Ga0182205_11049851	3300017686	Miscanthus Phyllosphere	MTGFDLLTNYVEDPEALIRRTRAKLKKVSALESKDNQIR
Ga0182205_11283971	3300017686	Miscanthus Phyllosphere	MTGFDLSTNYVEDPEALIMRTRAKLKKTLALKSADNHIRRSLTPEFEA
Ga0182231_11185241	3300017689	Miscanthus Phyllosphere	MTSFDLSTNYVDDPEALLKRTKAKLNKVSALESEDNHIR
Ga0182223_11240731	3300017690	Miscanthus Phyllosphere	MIGFDLPTNYVEDSEALISRTRAKLKKVLALKSED
Ga0182232_10633381	3300021060	Phyllosphere	FDLPRNYVEDPEALIRRTRAKLKKVLALKSEDNHIR

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.38
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.38
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F023498

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign