Metagenome Family F023512

Basic Information
Family ID	F023512
Family Type	Metagenome
Number of Sequences	209
Average Sequence Length	44 residues
Representative Sequence	MTGDARMFNSINTNDSNGYDSITFGDNGKGKVKGLGKIAIS
Number of Associated Samples	80
Number of Associated Scaffolds	208

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	24.85 %
% of genes near scaffold ends (potentially truncated)	68.90 %
% of genes from short scaffolds (< 2000 bps)	75.60 %
Associated GOLD sequencing projects	80
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.39

Most Common Taxonomy
Group	Bacteria (43.541 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere (77.990 % of family members)
Environment Ontology (ENVO)	Unclassified (93.301 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant surface (79.904 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 0.00% β-sheet: 21.74% Coil/Unstructured: 78.26%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 208 Family Scaffolds
PF13976	gag_pre-integrs	3.37
PF14223	Retrotran_gag_2	1.44
PF00665	rve	1.44
PF00098	zf-CCHC	0.48
PF07727	RVT_2	0.48
PF13243	SQHop_cyclase_C	0.48

COG ID	Name	Functional Category	% Frequency in 208 Family Scaffolds
COG2801	Transposase InsO and inactivated derivatives	Mobilome: prophages, transposons [X]	1.44
COG2826	Transposase and inactivated derivatives, IS30 family	Mobilome: prophages, transposons [X]	1.44
COG3316	Transposase (or an inactivated derivative), DDE domain	Mobilome: prophages, transposons [X]	1.44
COG4584	Transposase	Mobilome: prophages, transposons [X]	1.44

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	65.07 %
Unclassified	root	N/A	34.93 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	65.07 %
Unclassified	root	N/A	34.93 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	43.54 %
Unclassified	root	N/A	34.93 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	21.53 %

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	43.54 %
Unclassified	root	N/A	34.93 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	17.70 %
Opisthokonta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta	3.35 %

Name	Rank	Taxonomy	Distribution
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	37.32 %
Unclassified	root	N/A	34.93 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	17.70 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	4.31 %
Metazoa	kingdom	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa	3.35 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	34.93 %
Aeromonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales	21.05 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	17.70 %
Enterobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales	14.35 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	4.31 %
Eumetazoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa	3.35 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	34.93 %
Aeromonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae	21.05 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	17.70 %
Yersiniaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae	14.35 %
Rhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae	4.31 %
Bilateria	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria	3.35 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	34.93 %
Aeromonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas	21.05 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	16.75 %
Serratia	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Serratia	14.35 %
Rhizobium/Agrobacterium group	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group	4.31 %
Deuterostomia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia	3.35 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	34.93 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	21.05 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	16.75 %
Serratia marcescens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Serratia → Serratia marcescens	14.35 %
Rhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium	4.31 %
Chordata	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata	3.35 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	34.93 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	21.05 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	16.75 %
Serratia marcescens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Serratia → Serratia marcescens	14.35 %
Rhizobium leguminosarum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium leguminosarum	4.31 %
Craniata	subphylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata	3.35 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	34.93 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	21.05 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	16.75 %
Serratia marcescens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Serratia → Serratia marcescens	14.35 %
Rhizobium leguminosarum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium leguminosarum	4.31 %
Vertebrata	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata	3.35 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	34.93 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	21.05 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	16.75 %
Serratia marcescens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Serratia → Serratia marcescens	14.35 %
Rhizobium leguminosarum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium leguminosarum	4.31 %
Gnathostomata	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata	3.35 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	34.93 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	21.05 %
Liliopsida	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida	16.75 %
Serratia marcescens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Serratia → Serratia marcescens	14.35 %
Rhizobium leguminosarum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium leguminosarum	4.31 %
Teleostomi	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi	3.35 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	34.93 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	21.05 %
Petrosaviidae	subclass	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae	16.75 %
Serratia marcescens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Serratia → Serratia marcescens	14.35 %
Rhizobium leguminosarum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium leguminosarum	4.31 %
Euteleostomi	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi	3.35 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	34.93 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	21.05 %
commelinids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids	16.75 %
Serratia marcescens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Serratia → Serratia marcescens	14.35 %
Rhizobium leguminosarum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium leguminosarum	4.31 %
Sarcopterygii	superclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii	3.35 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	34.93 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	21.05 %
Poales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales	16.75 %
Serratia marcescens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Serratia → Serratia marcescens	14.35 %
Rhizobium leguminosarum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium leguminosarum	4.31 %
Dipnotetrapodomorpha	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha	3.35 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	34.93 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	21.05 %
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	16.75 %
Serratia marcescens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Serratia → Serratia marcescens	14.35 %
Rhizobium leguminosarum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium leguminosarum	4.31 %
Tetrapoda	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda	3.35 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	34.93 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	21.05 %
Serratia marcescens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Serratia → Serratia marcescens	14.35 %
BOP clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade	12.92 %
Rhizobium leguminosarum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium leguminosarum	4.31 %
Amniota	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota	3.35 %
PACMAD clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	34.93 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	21.05 %
Serratia marcescens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Serratia → Serratia marcescens	14.35 %
Oryzoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae	12.92 %
Rhizobium leguminosarum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium leguminosarum	4.31 %
Sauropsida	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida	3.35 %
Panicoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	34.93 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	21.05 %
Serratia marcescens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Serratia → Serratia marcescens	14.35 %
Oryzeae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae	12.92 %
Rhizobium leguminosarum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium leguminosarum	4.31 %
Sauria	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria	3.35 %
Andropogonodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	34.93 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	21.05 %
Serratia marcescens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Serratia → Serratia marcescens	14.35 %
Oryzinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae	12.92 %
Rhizobium leguminosarum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium leguminosarum	4.31 %
Archelosauria	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria	3.35 %
Andropogoneae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	34.93 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	21.05 %
Serratia marcescens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Serratia → Serratia marcescens	14.35 %
Oryza	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	12.92 %
Rhizobium leguminosarum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium leguminosarum	4.31 %
Archosauria	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria	3.35 %
Sorghinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae	0.48 %
Tripsacinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae	0.48 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	34.93 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	21.05 %
Serratia marcescens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Serratia → Serratia marcescens	14.35 %
Oryza sativa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	7.66 %
Rhizobium leguminosarum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium leguminosarum	4.31 %
Dinosauria	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria	3.35 %
Sorghum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum	0.48 %
Zea	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea	0.48 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	34.93 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	21.05 %
Serratia marcescens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Serratia → Serratia marcescens	14.35 %
Oryza sativa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	7.66 %
Rhizobium leguminosarum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium leguminosarum	4.31 %
Saurischia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia	3.35 %
Zea mays	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays	0.48 %
Sorghum bicolor	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	0.48 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	34.93 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	21.05 %
Serratia marcescens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Serratia → Serratia marcescens	14.35 %
Oryza sativa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	7.66 %
Rhizobium leguminosarum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium leguminosarum	4.31 %
Theropoda	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda	3.35 %
Zea mays	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays	0.48 %
Sorghum bicolor	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	0.48 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	34.93 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	21.05 %
Serratia marcescens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Serratia → Serratia marcescens	14.35 %
Oryza sativa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	7.66 %
Rhizobium leguminosarum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium leguminosarum	4.31 %
Coelurosauria	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria	3.35 %
Zea mays	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays	0.48 %
Sorghum bicolor	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	0.48 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	34.93 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	21.05 %
Serratia marcescens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Serratia → Serratia marcescens	14.35 %
Oryza sativa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	7.66 %
Rhizobium leguminosarum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium leguminosarum	4.31 %
Aves	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves	3.35 %
Zea mays	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays	0.48 %
Sorghum bicolor	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	0.48 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	34.93 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	21.05 %
Serratia marcescens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Serratia → Serratia marcescens	14.35 %
Oryza sativa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	7.66 %
Rhizobium leguminosarum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium leguminosarum	4.31 %
Neognathae	infraclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae	3.35 %
Zea mays	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays	0.48 %
Sorghum bicolor	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	0.48 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	34.93 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	21.05 %
Serratia marcescens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Serratia → Serratia marcescens	14.35 %
Oryza sativa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	7.66 %
Rhizobium leguminosarum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium leguminosarum	4.31 %
Charadriiformes	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Charadriiformes	3.35 %
Zea mays	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays	0.48 %
Sorghum bicolor	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	0.48 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	34.93 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	21.05 %
Serratia marcescens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Serratia → Serratia marcescens	14.35 %
Oryza sativa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	7.66 %
Rhizobium leguminosarum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium leguminosarum	4.31 %
Charadriidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Charadriiformes → Charadriidae	3.35 %
Zea mays	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays	0.48 %
Sorghum bicolor	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	0.48 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	34.93 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	21.05 %
Serratia marcescens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Serratia → Serratia marcescens	14.35 %
Oryza sativa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	7.66 %
Rhizobium leguminosarum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium leguminosarum	4.31 %
Charadrius	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Charadriiformes → Charadriidae → Charadrius	3.35 %
Zea mays	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays	0.48 %
Sorghum bicolor	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	0.48 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	34.93 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	21.05 %
Serratia marcescens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Serratia → Serratia marcescens	14.35 %
Oryza sativa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	7.66 %
Rhizobium leguminosarum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium leguminosarum	4.31 %
Charadrius vociferus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Charadriiformes → Charadriidae → Charadrius → Charadrius vociferus	3.35 %
Zea mays	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays	0.48 %
Sorghum bicolor	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	0.48 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300003319\|soilL2_10016781	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	1801	Open in IMG/M
3300005459\|Ga0068867_101883974	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	563	Open in IMG/M
3300005543\|Ga0070672_100831406	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	814	Open in IMG/M
3300009098\|Ga0105245_13087626	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Serratia → Serratia marcescens	516	Open in IMG/M
3300009176\|Ga0105242_12903804	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	530	Open in IMG/M
3300013296\|Ga0157374_12957551	Not Available	502	Open in IMG/M
3300014486\|Ga0182004_10021284	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	4848	Open in IMG/M
3300014486\|Ga0182004_10022917	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	4609	Open in IMG/M
3300014486\|Ga0182004_10023350	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium leguminosarum	4550	Open in IMG/M
3300014486\|Ga0182004_10027048	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	4074	Open in IMG/M
3300014486\|Ga0182004_10035528	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium leguminosarum	3292	Open in IMG/M
3300014486\|Ga0182004_10060490	All Organisms → cellular organisms → Bacteria → Proteobacteria	2060	Open in IMG/M
3300014486\|Ga0182004_10108565	Not Available	1184	Open in IMG/M
3300014486\|Ga0182004_10153305	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	861	Open in IMG/M
3300014486\|Ga0182004_10180055	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Serratia → Serratia marcescens	749	Open in IMG/M
3300014486\|Ga0182004_10183748	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	736	Open in IMG/M
3300014486\|Ga0182004_10196631	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	696	Open in IMG/M
3300014486\|Ga0182004_10205030	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	672	Open in IMG/M
3300014486\|Ga0182004_10208606	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	663	Open in IMG/M
3300014486\|Ga0182004_10211636	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	655	Open in IMG/M
3300014486\|Ga0182004_10221143	Not Available	632	Open in IMG/M
3300014486\|Ga0182004_10231999	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	609	Open in IMG/M
3300014486\|Ga0182004_10238745	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Serratia → Serratia marcescens	595	Open in IMG/M
3300014486\|Ga0182004_10250454	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Serratia → Serratia marcescens	574	Open in IMG/M
3300014486\|Ga0182004_10289677	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	515	Open in IMG/M
3300014486\|Ga0182004_10292252	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	512	Open in IMG/M
3300014486\|Ga0182004_10294681	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	509	Open in IMG/M
3300014486\|Ga0182004_10300722	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Serratia → Serratia marcescens	501	Open in IMG/M
3300014745\|Ga0157377_11301796	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	568	Open in IMG/M
3300014745\|Ga0157377_11530452	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Serratia → Serratia marcescens	531	Open in IMG/M
3300015267\|Ga0182122_1065007	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Serratia → Serratia marcescens	518	Open in IMG/M
3300015268\|Ga0182154_1055559	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	546	Open in IMG/M
3300015269\|Ga0182113_1055584	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	598	Open in IMG/M
3300015269\|Ga0182113_1083998	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	526	Open in IMG/M
3300015276\|Ga0182170_1031539	All Organisms → cellular organisms → Bacteria → Proteobacteria	651	Open in IMG/M
3300015279\|Ga0182174_1071772	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	532	Open in IMG/M
3300015281\|Ga0182160_1033451	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Charadriiformes → Charadriidae → Charadrius → Charadrius vociferus	654	Open in IMG/M
3300015282\|Ga0182124_1041998	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	612	Open in IMG/M
3300015282\|Ga0182124_1043821	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Charadriiformes → Charadriidae → Charadrius → Charadrius vociferus	605	Open in IMG/M
3300015283\|Ga0182156_1066178	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Serratia → Serratia marcescens	548	Open in IMG/M
3300015285\|Ga0182186_1054610	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	570	Open in IMG/M
3300015285\|Ga0182186_1074889	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	519	Open in IMG/M
3300015285\|Ga0182186_1079968	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	509	Open in IMG/M
3300015286\|Ga0182176_1052959	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	586	Open in IMG/M
3300015288\|Ga0182173_1046937	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	602	Open in IMG/M
3300015288\|Ga0182173_1069566	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	537	Open in IMG/M
3300015288\|Ga0182173_1072659	Not Available	530	Open in IMG/M
3300015288\|Ga0182173_1074906	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Serratia → Serratia marcescens	525	Open in IMG/M
3300015289\|Ga0182138_1021659	Not Available	752	Open in IMG/M
3300015291\|Ga0182125_1073357	Not Available	543	Open in IMG/M
3300015291\|Ga0182125_1079577	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	530	Open in IMG/M
3300015291\|Ga0182125_1079906	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	529	Open in IMG/M
3300015292\|Ga0182141_1049950	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	607	Open in IMG/M
3300015292\|Ga0182141_1057718	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	582	Open in IMG/M
3300015294\|Ga0182126_1045975	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	626	Open in IMG/M
3300015294\|Ga0182126_1084596	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Serratia → Serratia marcescens	523	Open in IMG/M
3300015295\|Ga0182175_1076583	Not Available	544	Open in IMG/M
3300015295\|Ga0182175_1079219	Not Available	538	Open in IMG/M
3300015295\|Ga0182175_1079978	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Serratia → Serratia marcescens	537	Open in IMG/M
3300015295\|Ga0182175_1080551	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	535	Open in IMG/M
3300015296\|Ga0182157_1047022	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	638	Open in IMG/M
3300015296\|Ga0182157_1062698	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Serratia → Serratia marcescens	586	Open in IMG/M
3300015296\|Ga0182157_1076184	Not Available	552	Open in IMG/M
3300015298\|Ga0182106_1082943	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	538	Open in IMG/M
3300015299\|Ga0182107_1052857	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Serratia → Serratia marcescens	620	Open in IMG/M
3300015299\|Ga0182107_1078683	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	550	Open in IMG/M
3300015299\|Ga0182107_1104783	Not Available	502	Open in IMG/M
3300015300\|Ga0182108_1008880	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	1035	Open in IMG/M
3300015300\|Ga0182108_1041935	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Serratia → Serratia marcescens	668	Open in IMG/M
3300015300\|Ga0182108_1088514	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Charadriiformes → Charadriidae → Charadrius → Charadrius vociferus	533	Open in IMG/M
3300015300\|Ga0182108_1100155	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Serratia → Serratia marcescens	512	Open in IMG/M
3300015303\|Ga0182123_1025297	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	740	Open in IMG/M
3300015303\|Ga0182123_1080523	Not Available	535	Open in IMG/M
3300015304\|Ga0182112_1002881	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium leguminosarum	1385	Open in IMG/M
3300015304\|Ga0182112_1101977	Not Available	508	Open in IMG/M
3300015305\|Ga0182158_1096309	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	516	Open in IMG/M
3300015308\|Ga0182142_1097343	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Serratia → Serratia marcescens	530	Open in IMG/M
3300015314\|Ga0182140_1071091	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Serratia → Serratia marcescens	586	Open in IMG/M
3300015314\|Ga0182140_1095898	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	534	Open in IMG/M
3300015314\|Ga0182140_1097720	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	531	Open in IMG/M
3300015321\|Ga0182127_1094343	Not Available	550	Open in IMG/M
3300015322\|Ga0182110_1051805	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Serratia → Serratia marcescens	660	Open in IMG/M
3300015322\|Ga0182110_1085424	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Serratia → Serratia marcescens	567	Open in IMG/M
3300015323\|Ga0182129_1054123	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	633	Open in IMG/M
3300015323\|Ga0182129_1066688	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Charadriiformes → Charadriidae → Charadrius → Charadrius vociferus	595	Open in IMG/M
3300015323\|Ga0182129_1074919	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	575	Open in IMG/M
3300015323\|Ga0182129_1083158	Not Available	557	Open in IMG/M
3300015323\|Ga0182129_1097648	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	531	Open in IMG/M
3300015341\|Ga0182187_1100716	Not Available	644	Open in IMG/M
3300015341\|Ga0182187_1153067	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Charadriiformes → Charadriidae → Charadrius → Charadrius vociferus	555	Open in IMG/M
3300015342\|Ga0182109_1028983	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Serratia → Serratia marcescens	1045	Open in IMG/M
3300015342\|Ga0182109_1111669	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	653	Open in IMG/M
3300015342\|Ga0182109_1140704	Not Available	600	Open in IMG/M
3300015342\|Ga0182109_1178918	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Serratia → Serratia marcescens	547	Open in IMG/M
3300015343\|Ga0182155_1096095	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	686	Open in IMG/M
3300015343\|Ga0182155_1109697	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	655	Open in IMG/M
3300015343\|Ga0182155_1195463	Not Available	530	Open in IMG/M
3300015344\|Ga0182189_1118885	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	644	Open in IMG/M
3300015346\|Ga0182139_1105677	All Organisms → cellular organisms → Bacteria → Proteobacteria	694	Open in IMG/M
3300015346\|Ga0182139_1170260	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	580	Open in IMG/M
3300015346\|Ga0182139_1197296	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	548	Open in IMG/M
3300015347\|Ga0182177_1129476	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	646	Open in IMG/M
3300015347\|Ga0182177_1185399	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	564	Open in IMG/M
3300015347\|Ga0182177_1203990	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	543	Open in IMG/M
3300015347\|Ga0182177_1217109	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	530	Open in IMG/M
3300015347\|Ga0182177_1229044	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	519	Open in IMG/M
3300015347\|Ga0182177_1229044	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	519	Open in IMG/M
3300015351\|Ga0182161_1223222	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	541	Open in IMG/M
3300015351\|Ga0182161_1257383	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	510	Open in IMG/M
3300015355\|Ga0182159_1126330	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium leguminosarum	780	Open in IMG/M
3300015355\|Ga0182159_1179396	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	673	Open in IMG/M
3300015355\|Ga0182159_1279188	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	556	Open in IMG/M
3300015355\|Ga0182159_1332647	Not Available	514	Open in IMG/M
3300015361\|Ga0182145_1150185	Not Available	549	Open in IMG/M
3300015361\|Ga0182145_1153150	Not Available	545	Open in IMG/M
3300015361\|Ga0182145_1189890	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	506	Open in IMG/M
3300017409\|Ga0182204_1102697	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Serratia → Serratia marcescens	527	Open in IMG/M
3300017410\|Ga0182207_1035161	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium leguminosarum	851	Open in IMG/M
3300017410\|Ga0182207_1155325	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Serratia → Serratia marcescens	525	Open in IMG/M
3300017410\|Ga0182207_1157054	Not Available	523	Open in IMG/M
3300017410\|Ga0182207_1177714	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Serratia → Serratia marcescens	501	Open in IMG/M
3300017413\|Ga0182222_1086411	Not Available	533	Open in IMG/M
3300017420\|Ga0182228_1093424	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	566	Open in IMG/M
3300017424\|Ga0182219_1068051	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Charadriiformes → Charadriidae → Charadrius → Charadrius vociferus	630	Open in IMG/M
3300017424\|Ga0182219_1085743	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	587	Open in IMG/M
3300017425\|Ga0182224_1017049	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium leguminosarum	1008	Open in IMG/M
3300017425\|Ga0182224_1120933	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Serratia → Serratia marcescens	558	Open in IMG/M
3300017425\|Ga0182224_1157902	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	510	Open in IMG/M
3300017427\|Ga0182190_1015327	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium leguminosarum	1103	Open in IMG/M
3300017427\|Ga0182190_1084277	Not Available	633	Open in IMG/M
3300017427\|Ga0182190_1096364	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	605	Open in IMG/M
3300017427\|Ga0182190_1096710	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	605	Open in IMG/M
3300017427\|Ga0182190_1117627	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays	565	Open in IMG/M
3300017430\|Ga0182192_1056216	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	741	Open in IMG/M
3300017430\|Ga0182192_1089470	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	633	Open in IMG/M
3300017430\|Ga0182192_1118794	Not Available	574	Open in IMG/M
3300017430\|Ga0182192_1157008	Not Available	520	Open in IMG/M
3300017430\|Ga0182192_1166810	Not Available	509	Open in IMG/M
3300017436\|Ga0182209_1057959	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium leguminosarum	714	Open in IMG/M
3300017436\|Ga0182209_1147979	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	530	Open in IMG/M
3300017436\|Ga0182209_1155723	Not Available	521	Open in IMG/M
3300017442\|Ga0182221_1090971	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	612	Open in IMG/M
3300017442\|Ga0182221_1139769	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Serratia → Serratia marcescens	535	Open in IMG/M
3300017442\|Ga0182221_1151309	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Serratia → Serratia marcescens	522	Open in IMG/M
3300017442\|Ga0182221_1155459	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Serratia → Serratia marcescens	517	Open in IMG/M
3300017680\|Ga0182233_1077128	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	602	Open in IMG/M
3300017680\|Ga0182233_1097094	Not Available	543	Open in IMG/M
3300017681\|Ga0182226_1098150	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	552	Open in IMG/M
3300017682\|Ga0182229_1106540	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	501	Open in IMG/M
3300017683\|Ga0182218_1125964	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	535	Open in IMG/M
3300017683\|Ga0182218_1138828	Not Available	519	Open in IMG/M
3300017683\|Ga0182218_1147318	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	509	Open in IMG/M
3300017684\|Ga0182225_1020909	All Organisms → cellular organisms → Bacteria → Proteobacteria	919	Open in IMG/M
3300017684\|Ga0182225_1076079	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	614	Open in IMG/M
3300017685\|Ga0182227_1085799	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	598	Open in IMG/M
3300017685\|Ga0182227_1087176	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Serratia → Serratia marcescens	594	Open in IMG/M
3300017685\|Ga0182227_1092038	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	582	Open in IMG/M
3300017686\|Ga0182205_1073029	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	670	Open in IMG/M
3300017689\|Ga0182231_1103209	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	551	Open in IMG/M
3300017690\|Ga0182223_1030086	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	741	Open in IMG/M
3300017690\|Ga0182223_1038782	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	692	Open in IMG/M
3300021060\|Ga0182232_1059000	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Serratia → Serratia marcescens	632	Open in IMG/M
3300026121\|Ga0207683_10124925	All Organisms → cellular organisms → Eukaryota	2312	Open in IMG/M
3300028151\|Ga0268308_1002761	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium leguminosarum	1108	Open in IMG/M
3300032002\|Ga0307416_103068579	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Charadriiformes → Charadriidae → Charadrius → Charadrius vociferus	559	Open in IMG/M

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
soilL2_100167813	3300003319	Sugarcane Root And Bulk Soil	MTGTSRMFDSINDNDSGVDSITFGNNKKGKVIGLGKIAISN
Ga0068867_1018839741	3300005459	Miscanthus Rhizosphere	VLDSGCTQHMTSDPRMFNSINENKSNGIDSITFGDNGKGKVKGLGKIAI
Ga0070679_1018693912	3300005530	Corn Rhizosphere	VLDSGCTQHMTGDMRMFTEMSEEGCSTYDSITFGDNRKGKVKGLGK
Ga0070672_1008314061	3300005543	Miscanthus Rhizosphere	MTGDARMFNSINTNGNDGYDSITFGDNGKGKVKGLGKIAISNDMSISN
Ga0105245_130876261	3300009098	Miscanthus Rhizosphere	MIGDARMFNSINTNGNDDYDSITFGDNGKGKVKGLGKIAISN
Ga0105243_110343912	3300009148	Miscanthus Rhizosphere	VLDSGCTQHMTSNPRMFNSINENKSNGLEVSYLVTM
Ga0105242_129038041	3300009176	Miscanthus Rhizosphere	MTGDSRMFNSINTNESNGVDSITFGDNGKGKVKGLGKI
Ga0157374_129575511	3300013296	Miscanthus Rhizosphere	MTGDSRMFNSINKNDGNGIDSITFGDNDKVKVKGLGLVML
Ga0182004_1000251913	3300014486	Root	VLDSGCTQHMTGDSRMFNSINTNDDNGVDSITASNNGKGKV*
Ga0182004_100173224	3300014486	Root	VLDSGCTQHMTGDSRMFNSINASDDNRVDSITFGDNGKGKVK*
Ga0182004_100212842	3300014486	Root	MTGDGRMFNSINRNDDNGVDCITFGDNGKDKVKGLDKIAISNDLSISNVLLVEA*
Ga0182004_100229171	3300014486	Root	MTGDSRMFNSINTNDDNGVDSITFGDNGKGKVKGLGKIAISND
Ga0182004_100233504	3300014486	Root	MTGDARMFSSINPNDDNGVDSITFGDNGKGKVKGLGKIAIYNDLSISMCY*
Ga0182004_100270481	3300014486	Root	MTGNSRMFNSIDTNDNDGIHSITFGDNGKGKVKGLGKIAISNDLSISNVLLV
Ga0182004_100355285	3300014486	Root	MTGDARIFNSINPNDDNGVDSITFGDNGKGKVKGLG
Ga0182004_100604903	3300014486	Root	MFKSIDTNQNGGFDSITFGNNKKGKVKGLGKIAISNE*
Ga0182004_101085651	3300014486	Root	MTGDSRMFNSINPNDDNGVDSITFGDNGKDKVKGLGKIA
Ga0182004_101147092	3300014486	Root	MTGDSRMFSSINPNDDNGADSITFGDNGKGKVKGIGKIAISNDLSISNVLLVESLNFNL
Ga0182004_101533051	3300014486	Root	MFKSIDTSQNGGFDSITFGNNKKGKVKGLGKIAISNDMHIKCVAS*
Ga0182004_101800551	3300014486	Root	MFKSNDTNENGGFDLITFGNNKKGKVKGLGKIAISNDMSISNVLL
Ga0182004_101837482	3300014486	Root	MFKSIDTSQNGGFDSITFGNYKNGKVKGFVKIAISNDMSIGAS*
Ga0182004_101966312	3300014486	Root	MFNSINPNVDNVVDSITFGDNGKGKVKGLGKIAISN
Ga0182004_102050301	3300014486	Root	MFKSINTNENGGFDSITFGNNKKGKVKGLGKIAISNDMSISNVLLV
Ga0182004_102086062	3300014486	Root	MFKSIYTSQNGGFDSITFGNNKKGKVKGLGKIAISNDMSISNVLLV
Ga0182004_102116361	3300014486	Root	MTGDSRMFNSINPNDDNGVDSITFGDNGKGKVKGLGKIAI
Ga0182004_102211431	3300014486	Root	MFKSIDTSQNGGFDSITFDNNKKGKVKGLGKIAISNDMSI*
Ga0182004_102319991	3300014486	Root	MTGDSRIFNSIKSNDDNGVDSITFGDNGKGKVKGLGKIAISNDFRSSTL*
Ga0182004_102377921	3300014486	Root	MTDDSRMFNSINPNDDNGVDSITFGDNAKARSKGLVKLLYPMT*
Ga0182004_102387451	3300014486	Root	MFKSIDTSQNGGFDSITFGNNKKGKVKGLGKIAISNDMSISNVL
Ga0182004_102504541	3300014486	Root	MTEESCMFKSIDTNQNGGFDSITFGNNKKGKVKGLGKIAISND
Ga0182004_102565311	3300014486	Root	MFKSIDTNQNGGFDSITFGNNKKGKVKGLGKIDMSISNVLLVESLDFNLLSIAQLFDAR*
Ga0182004_102896771	3300014486	Root	MTGEPCMSKSIDTNQNGGFDSITFGNNKKGKVKGLGKIAISNDMSI*
Ga0182004_102922522	3300014486	Root	MFDSINDNVSGIDSITFGNNKKGKVIGNGKIAISN
Ga0182004_102946812	3300014486	Root	MTGDSSMFNSINPNDDHGVDSITFGDNGKGKVKGLGKIAISNDLSIS
Ga0182004_103007222	3300014486	Root	MFKSIDTNQNGGFDSVTFGNNKKGKVKGLGKIAISN
Ga0157377_113017962	3300014745	Miscanthus Rhizosphere	MTGDARMFNSINTNGNDGYDSITFGDNGKGKVKWLGKIAISN
Ga0157377_115304521	3300014745	Miscanthus Rhizosphere	MIGDARMFNSINTNDSNGYDSITFGDNGKGKVKGLGKIVISNDMSISNVL
Ga0182122_10650071	3300015267	Miscanthus Phyllosphere	MTDDSRMFNSINENYSNMIDSIIFGDNGKGKVKGRGKIAISNDLSISNVLLV
Ga0182154_10555591	3300015268	Miscanthus Phyllosphere	MTDDSRMFNSINENESNGVDSITFGDNGKGKVKGLGKIAISNDLSI
Ga0182113_10555842	3300015269	Miscanthus Phyllosphere	MTGDPRMFNSINENKSNGIDSITFGDNGKGKVKNLGKIAISNDL
Ga0182113_10838042	3300015269	Miscanthus Phyllosphere	VLDSGCTQHMTGDPRMFNSINENKSNGIDSITFGD
Ga0182113_10839982	3300015269	Miscanthus Phyllosphere	MTGDARMFNSINTNGNDGYDSITFGDNGKGKVKGLG*
Ga0182170_10315391	3300015276	Miscanthus Phyllosphere	MTSDSRMFDSIKSNDNNEFDSITFGDNGKCRVKGL
Ga0182128_10142031	3300015277	Miscanthus Phyllosphere	MTNDPRMFNSINENKSNRIDSIIFGDNGKGKVKRLGKIVISNDISIYNVLLVESLNF
Ga0182174_10717721	3300015279	Miscanthus Phyllosphere	MTGDARMFNSINTNGNDGYDSIIFGDNGKGKVKGLGKVEI
Ga0182160_10334511	3300015281	Miscanthus Phyllosphere	MTGDARMFNSININGNDGYDSITFGDNSKGKVKGLSKITISNDM
Ga0182160_10553092	3300015281	Miscanthus Phyllosphere	VFDSECTQHMTGDSKMFNSIKPNDSGIDSITFGNNK
Ga0182124_10419982	3300015282	Miscanthus Phyllosphere	MIGDARMFNSINTNGSDGYDSITFGDNGKGKVKGLDKIAISNDMS
Ga0182124_10438212	3300015282	Miscanthus Phyllosphere	MTDDLRMFNSIHENKSNGIDSITFGDNGKGKVKGLGKIA
Ga0182156_10661781	3300015283	Miscanthus Phyllosphere	MTGDARMLNSINTNSNDGYDSIIFGENGKDKVKGLGKIAIS
Ga0182156_10747231	3300015283	Miscanthus Phyllosphere	VLNSGCTQYITGDPRIFNSINENNSNEIDSITFGDN
Ga0182186_10269502	3300015285	Miscanthus Phyllosphere	VPDSGCTQHMTGDSRMFNSINTNDSNGVVSITFGDNGKG
Ga0182186_10546101	3300015285	Miscanthus Phyllosphere	MTGDARMFNSINTNGNDGYDSITFGDNSKGKVKWLGKIAISNDMSKS
Ga0182186_10748891	3300015285	Miscanthus Phyllosphere	MFNSINTNGNDGYDSITFGENGKGKVKGLGKIEISNDMSISNVLL
Ga0182186_10799681	3300015285	Miscanthus Phyllosphere	MTGDSRMFNSINANDDNGIDSITFGDNGKVKVKGLGKIAISN
Ga0182176_10341383	3300015286	Miscanthus Phyllosphere	VLDSGCTKHMTSDSRIFNSINENDRNGIDSITFSDNGKSKVK
Ga0182176_10529592	3300015286	Miscanthus Phyllosphere	MTGDARMFNSIKSSGNNDYDSITFGDNSKGKVKGLGKIAISSDLAYQMSC*
Ga0182171_10591662	3300015287	Miscanthus Phyllosphere	MTGDARMFNSINTSDSNGTGSITFGDNDKGKVKWLSKIAISNDLSISNVLLVESLNF
Ga0182173_10261372	3300015288	Miscanthus Phyllosphere	VLDSECTQHMTGDSRMCNSINENKSNGIDSITFGDNGK
Ga0182173_10469371	3300015288	Miscanthus Phyllosphere	MTGDSRMFNSIKSNDHLGVDSITFGDIGKGKVKGLGKIAISNDLSISNVLL
Ga0182173_10695662	3300015288	Miscanthus Phyllosphere	MIGDPRMFNSINENKSNVIDSITFSDNGKGKVKELGKITISSDLSISNVL
Ga0182173_10726591	3300015288	Miscanthus Phyllosphere	MTGDARMFNSINTNDSNGYDSITFGDNGKGKVKGLGKIAIS
Ga0182173_10749061	3300015288	Miscanthus Phyllosphere	MTDDPRMFNSINENKSSGIDSITFADNGKGKVKGL
Ga0182138_10216591	3300015289	Miscanthus Phyllosphere	MTGDARMFNSINTNDSNGYDSITFGDNDKGKVKGPGKIEYPMT*
Ga0182125_10733572	3300015291	Miscanthus Phyllosphere	MTGDARIFDSINTNGNDGYDSITFGDNGKGKVKGLGKIVISNDLSISNALLV*
Ga0182125_10795771	3300015291	Miscanthus Phyllosphere	MTGDARMFNSINTNGNDGYDSITFGDNGKGKVKGLGKIAI
Ga0182125_10799061	3300015291	Miscanthus Phyllosphere	MNDDSRMFNSINENKSNRFDSITFGDNGKGKVKGL
Ga0182141_10499501	3300015292	Miscanthus Phyllosphere	MTGDARMFNSINSSGNDGYDSITFGDNGKGKVKGLGKIAISNDLSI
Ga0182141_10577181	3300015292	Miscanthus Phyllosphere	MTGDSRMFNSIKSYDNNEFDSITFGDNGKGKVKGLAKIAISNGMSI
Ga0182126_10459751	3300015294	Miscanthus Phyllosphere	MTSDARMFNSINTNGNDSYDSITFGDNGKGKVKGLAKIAISNDMSISN
Ga0182126_10845961	3300015294	Miscanthus Phyllosphere	MTDDARMFNSINTSGNDGFDSITFGDNGKGKVKGLGKIA
Ga0182175_10765831	3300015295	Miscanthus Phyllosphere	MTSDAKIFNSINNNGNDGYDSITFGDNGKGKVKGLGKIAI
Ga0182175_10792191	3300015295	Miscanthus Phyllosphere	MTGDARMFNSINSSDNDDYDSTTFGDNGKGKVKGLDKIAISNDLSISNVL
Ga0182175_10799782	3300015295	Miscanthus Phyllosphere	MTSDSRMFDSIKSNDNNEFDSITFGDNGKGKVKALGKIAISNDLS
Ga0182175_10805512	3300015295	Miscanthus Phyllosphere	MTGDARMFNSINTNDSNGYDSITFGDNGKGKVKGLGKIAISNDLS
Ga0182157_10262441	3300015296	Miscanthus Phyllosphere	KAGGRHWVFDSGCTQHMTGDSRMFNSINENESNGIDSITFGDNGKG*
Ga0182157_10470221	3300015296	Miscanthus Phyllosphere	MTGDARMFNSINTNDSNGYDSITFGDNGKDKVKGLGKIAISNDLSISNV
Ga0182157_10626981	3300015296	Miscanthus Phyllosphere	MTEDARIFNSINSSGNNDYDSITFGDNSKDKVKWLGKIAISNDLS
Ga0182157_10761841	3300015296	Miscanthus Phyllosphere	MTGDSRIFNSINANDSNGVDSITFDDNGNGKVKGLGKIAISNDFSISMCY*
Ga0182106_10829431	3300015298	Miscanthus Phyllosphere	MTGGARMFNSINTNGNDCYDNITFGDNGKGKVKGLDKIAISNDMTFSMCCLLRA*
Ga0182107_10528572	3300015299	Miscanthus Phyllosphere	MTGNVRMFNSINTNDNDSYDSITFGDNGKDKVKGLGKIVISNDMS
Ga0182107_10786832	3300015299	Miscanthus Phyllosphere	MTGDSRMFNSINTSGNNEFDSITFGDNGKGKVKGLSKIAISNNM
Ga0182107_11047831	3300015299	Miscanthus Phyllosphere	MTGDSRMFNSINTDDSNGYDSIIFSDNGKGKVKGL
Ga0182108_10088801	3300015300	Miscanthus Phyllosphere	MTGDARMFNSINTNGNDGYDCITFGDNNKGNVKGLDKITISNDMSI
Ga0182108_10419353	3300015300	Miscanthus Phyllosphere	MTDDARMFNSINTNGNDGYDSITFGDNGKGKVKGLGK
Ga0182108_10885141	3300015300	Miscanthus Phyllosphere	MTGDARMFNSFNSNDSNGYDSITFGDNGEGKVKGLG
Ga0182108_11001552	3300015300	Miscanthus Phyllosphere	MQHMTGDARMFNSININGNDGYDCIIFGDNGKGEVKGLGKIAISMT
Ga0182123_10252973	3300015303	Miscanthus Phyllosphere	MTGDARMFNSININGNDGYDSITFGDNGKGKVKGLGKIAISNDMSISN
Ga0182123_10805231	3300015303	Miscanthus Phyllosphere	MTGDARMFNSINTNGNDGYDSITFGDNGKGKVKGLGK
Ga0182112_10028812	3300015304	Miscanthus Phyllosphere	MFNSIDTSSKGDYENITFDDNGKGKVKGLGKIAISNDMSISNVLLVE
Ga0182112_11019771	3300015304	Miscanthus Phyllosphere	MTDDARMFNSINTNDSNGYDSITFGDNGKGKVKGLGKIGISNNMT
Ga0182158_10218781	3300015305	Miscanthus Phyllosphere	MTGDRRMFNSIDSSDSDEFESIIFGDNDKGKVKGLEKIIIFNDMSISKVCVYD*
Ga0182158_10963092	3300015305	Miscanthus Phyllosphere	MTGDHKMFNSLDTDGCDDFDSITFGDNGKGQVKGLGKIAISNDLSISNVLLV
Ga0182142_10973432	3300015308	Miscanthus Phyllosphere	MTGDSRMFNSINENKSNGIDSITFGDNSKGKVKGLGKIAIFNDLSISNV
Ga0182164_10156471	3300015313	Switchgrass Phyllosphere	MFSSITDDDRTEYDDVMFGDNSKGKVKGSGKIAISNDLSISNVLLVESLKFNLLSV
Ga0182140_10710912	3300015314	Miscanthus Phyllosphere	MTSDARMFNSINTNDNDGYDSITFGDNVKGKVKGLGKIAIS
Ga0182140_10958981	3300015314	Miscanthus Phyllosphere	MIGDARMFNTINTNGNNCYDSITFGDNGKGKVKGLGKIAIYNDMSISNMLLVE
Ga0182140_10977202	3300015314	Miscanthus Phyllosphere	MISDSRMFNSINSNDDNGIDSITFGDNSKGKVKGLGKIAISNDEHF*
Ga0182127_10943431	3300015321	Miscanthus Phyllosphere	MTGDSRMFNSINTSGNNEFDSITFGDNGKGKVKEL
Ga0182110_10518051	3300015322	Miscanthus Phyllosphere	MTSDSRMFNSINSNDDNGIDSITFGDNGKGKVKWLGK
Ga0182110_10854241	3300015322	Miscanthus Phyllosphere	MTGDARMFNSINTNDNDSYNSIIFGDNDKGKVKGLGKI
Ga0182129_10541232	3300015323	Miscanthus Phyllosphere	MTGDPRMFNSINENKSNGIDSITFGDNGKGKVKGLG
Ga0182129_10666881	3300015323	Miscanthus Phyllosphere	MTSHSKMFNSINKNESIGIDSITFGDNGKGKVKGLGK
Ga0182129_10749192	3300015323	Miscanthus Phyllosphere	VLDSGCTQHLIGDSRIFNSINTSDSNGIDSIAFGDNSKGKVKGFGKITIS
Ga0182129_10831581	3300015323	Miscanthus Phyllosphere	MIGDARMFNSINTNGNDGYDSITFGDNGKGKVKGLG
Ga0182129_10976481	3300015323	Miscanthus Phyllosphere	MTGDPRMFNSINESKSNGIDSITFGDNGKGKVKGLGKI
Ga0182131_10815122	3300015331	Switchgrass Phyllosphere	MFSSITDDDRTEYDDVMFGDNSKGKVKGSGKIAISNDLSISNVLLVESLKFNLLSVAQL
Ga0182187_11007161	3300015341	Miscanthus Phyllosphere	MTGDSRMFNSINTSDSNGVDSITFGDNGKGKVKGLGKIV
Ga0182187_11530671	3300015341	Miscanthus Phyllosphere	MTGDSRIFNSINANDSNEIDSITFGDNGKGKVKDLG
Ga0182187_11886112	3300015341	Miscanthus Phyllosphere	VLDNGCTQHMTDDSRMFNSINESKGNGIDSITFGD
Ga0182109_10289833	3300015342	Miscanthus Phyllosphere	MFNSIDTSGKGDYENITFDDNGKGKVKGLGKIAISNDMSISNVLLV
Ga0182109_11116691	3300015342	Miscanthus Phyllosphere	MTGDPRMFNSINENKSNGIDSIIFGDNGKGNVKGL
Ga0182109_11367561	3300015342	Miscanthus Phyllosphere	MFNSIDSSDSDEFESIIFGDNGKGKVKGLGKIIIFNDMSISKVCVYD*
Ga0182109_11407041	3300015342	Miscanthus Phyllosphere	MTSDARMFNSINANDSNDYDSTTFGDNSKDKVKGLGKIAISNDEHNH
Ga0182109_11789181	3300015342	Miscanthus Phyllosphere	MTGDARMFNSINTNGNDGYDSIIFGDNGKDKVKGLGKIAIS
Ga0182155_10960951	3300015343	Miscanthus Phyllosphere	MTGDARMFNSINTNGNDDYDSITFGDNGKGKVKGL
Ga0182155_11096971	3300015343	Miscanthus Phyllosphere	MAGDARMFNSINTNDSNGFDSITFGDNGKGKVKGL
Ga0182155_11954632	3300015343	Miscanthus Phyllosphere	MTSDARMFNSINTNGNDGYDSITFSDNGKGKVKGLGKIAISNDMS
Ga0182155_12270431	3300015343	Miscanthus Phyllosphere	VLDSGCTQHMTSDSRMFNSINENESNGIDSITFGDNGK
Ga0182189_10990761	3300015344	Miscanthus Phyllosphere	MTGDSRMFNSIKSSDSDGVQSITFGDNSKGKVKGLVKLLYPMI*
Ga0182189_11188851	3300015344	Miscanthus Phyllosphere	MTSDARMFNSINTNANDGYDSIIFGDNGKGKVKGLGKIAISNDMSI
Ga0182189_12022911	3300015344	Miscanthus Phyllosphere	MLDSGCTQHMTGDSRMFNSINENDSNGIDSITFSDNS
Ga0182139_11056771	3300015346	Miscanthus Phyllosphere	MTSDSRVFNSINTNDSNGVDSITFGDNGKGKVKGLGKIAISNDLSI
Ga0182139_11702601	3300015346	Miscanthus Phyllosphere	MTGNARMFDSINTNDNNGYDSITFGDNGKGKVKGLGKIAISND
Ga0182139_11972961	3300015346	Miscanthus Phyllosphere	MTGDSRMFNSINTSGNNEFDSITFGDNGKGKVKGLGKITISNDMSI
Ga0182177_10654411	3300015347	Miscanthus Phyllosphere	MAEGMHWVLDSGCTQHMTIDQRMFNSIDTSAKDYYESIAFGDNGKGMVNSL
Ga0182177_11294762	3300015347	Miscanthus Phyllosphere	MTGDSRIFNSIKSNDNNEFDSITFGDNGKGKVKGLGKIAIS
Ga0182177_11853991	3300015347	Miscanthus Phyllosphere	MIGDARMFNSINTNGNDGYDSITFSDNGKGKVKCLSKIVISNDLSIFNVLLV
Ga0182177_12039901	3300015347	Miscanthus Phyllosphere	MFNSINTNDGNGVDSITFGDNGKGKVKGLGKIAISNDLSISN
Ga0182177_12171091	3300015347	Miscanthus Phyllosphere	MTGDLRMFNSINENKSNGIDSITFGDNGKGKVKGLGKITISNNMS
Ga0182177_12290441	3300015347	Miscanthus Phyllosphere	RMFNSIIINGNDGYDSITFGDNGKGKVKELGKIAISNDLSISNMYR*
Ga0182177_12290442	3300015347	Miscanthus Phyllosphere	MISDPRMFNSINENKSNEINSITFGDNGKGKVKGLGKIAISNDLSIANVLVDTKIW*
Ga0182161_12232221	3300015351	Miscanthus Phyllosphere	MTGDSRMFNSINTNDSNSYDSITFGDNDKDNVKGLGKIAIS
Ga0182161_12461821	3300015351	Miscanthus Phyllosphere	LGAFYSGCMQHMTGDSRMFNSINENDSNGVDSITF
Ga0182161_12573831	3300015351	Miscanthus Phyllosphere	MTGDVRMFNSINTNGNDGYDSITFGDNGKGKVKGLGKIAISNDM
Ga0182159_11263301	3300015355	Miscanthus Phyllosphere	MTNDARMFNSINTNDNDGYDSITFGDNGKCKVKGLGKIAISN
Ga0182159_11793961	3300015355	Miscanthus Phyllosphere	MTSDARMFNSINTNGNDEYDSITFGGNGKGKVKGLCKIAISNDMS
Ga0182159_12791881	3300015355	Miscanthus Phyllosphere	MTGDTRMFNLINTNGNDGYDSIIFGDNGKGKVKGLGKITISNDM
Ga0182159_13326471	3300015355	Miscanthus Phyllosphere	MTGDARMFNSINTNDNDGYDSITFGDNGKGKVKGLGKIA
Ga0182145_11501852	3300015361	Miscanthus Phyllosphere	MTGDSRMFNSINSNDDNGIDSITFGDNGKGKVKGLEGLVMLE*
Ga0182145_11531501	3300015361	Miscanthus Phyllosphere	MTGDLRMFNSINTNDSNGYDSITFGDNGKGKVKGLGKIAISNMSDYLA
Ga0182145_11898901	3300015361	Miscanthus Phyllosphere	MTGDSRMFNSINENKSNGFDSITFGDNRKGKVKGLGKIAISNDL
Ga0182204_11026972	3300017409	Miscanthus Phyllosphere	MIDDARMFNSINTNVNDGYDSITFGDNNKGKVKGLGKIAIS
Ga0182207_10351612	3300017410	Miscanthus Phyllosphere	MTSDARMFNSINTDGNDGYDSIIFGDNGKGKIKGLGKVTISNDM
Ga0182207_11553251	3300017410	Miscanthus Phyllosphere	VLDSGCTQHMTSDARIFNSINTSGNNEFDSITFGDNGKGKVKGLGKIAISNDMSISNV
Ga0182207_11570541	3300017410	Miscanthus Phyllosphere	MTDDARMFNSINTNANDGYDSIIFCDNGKGNVKGLGNIAISMT
Ga0182207_11777141	3300017410	Miscanthus Phyllosphere	MTGAARIVNSININGNDGYNSITFVDNGKGKVKGRGKIA
Ga0182208_11230942	3300017411	Miscanthus Phyllosphere	LVLDSGYTQHITGDARMFNSINTNGNDGYDSITFGDNGKGKVKGLGKIV
Ga0182222_10864112	3300017413	Miscanthus Phyllosphere	VLDSGCTQHMTGDLRMFNLINTNDSNGVDSIPFGDNGKGKVEGLGKIAISNDLSIY
Ga0182202_10842241	3300017415	Miscanthus Phyllosphere	GAVRMFNSINTNASNGYDSITFGDNGKVKVKGLSKIAISNDLSISNVLLVESLNFNLLSI
Ga0182230_10618242	3300017417	Miscanthus Phyllosphere	VLDSGCTQHMTGDSRMFNSIKSSDSDGVQSITFGDNSKGKVKGLVKLLYPMI
Ga0182230_10621812	3300017417	Miscanthus Phyllosphere	MFNSINTNSNGVDSITFGDNGKGKVKGFGTIAISNDLSISNVLLVESLNF
Ga0182228_10544321	3300017420	Miscanthus Phyllosphere	MHWVLDSGCTQHMTGDLRMFNSINANESIEIDSITFGDNGKGKVKDL
Ga0182228_10934241	3300017420	Miscanthus Phyllosphere	MTGDVRMFNSINTNDNDGYDSITFGDNGKGKVKGLGKIAISNDMS
Ga0182228_11123152	3300017420	Miscanthus Phyllosphere	VLDSGCTQHMTGDLRMFNSINSNDDNGIDSITFGDNG
Ga0182219_10680512	3300017424	Miscanthus Phyllosphere	MTGDARMFNSINTNDSNGYDSITFGDNGKGKVKGLGKIAISNDMS
Ga0182219_10857432	3300017424	Miscanthus Phyllosphere	MTGDARMFNSINTNGNDGYDSITFGDNGKGKVKGLGKIAIS
Ga0182224_10170491	3300017425	Miscanthus Phyllosphere	MTDDPRMFNLINENKSNGIDSITFGDNGKGKVKGLSKITISNV
Ga0182224_11209332	3300017425	Miscanthus Phyllosphere	MTSDARMFNSINTSGNDGYDSITFGNNGKGKVNGLGKIA
Ga0182224_11240362	3300017425	Miscanthus Phyllosphere	VHDSGCTQHMTGDSRIFNSINENKSNVIDSITFGDNGKG
Ga0182224_11579023	3300017425	Miscanthus Phyllosphere	MTGDARMFNSINTNDNDGYDSITFGDNGKGKVKGLGKIAI
Ga0182190_10153273	3300017427	Miscanthus Phyllosphere	MTGDARIFNSINTNDSNGYDSITFGDNGKCKVKGLGKIAISNDLSISNVLLVE
Ga0182190_10842771	3300017427	Miscanthus Phyllosphere	MTGDARMFNSINTNGNDGYDSIIFGDNGKCKVKGLGK
Ga0182190_10963642	3300017427	Miscanthus Phyllosphere	MTGDLRMFNSINTNGNDGYDSITFGDNGKVKVKGLGKIAISN
Ga0182190_10967101	3300017427	Miscanthus Phyllosphere	VLDSGCTKHMTGDSRMFNSINTSGNNEFDSITFGDNGKGKVKGLGKIAISN
Ga0182190_11176271	3300017427	Miscanthus Phyllosphere	MTGDARMFNSINTNDSNGYDSITFGDNGKGKVKGLGKIAISNDLSISNVLL
Ga0182190_11610961	3300017427	Miscanthus Phyllosphere	VLDSGCTQHMTDDSRMFNSINENDSNRIDSIIFGDNDKDK
Ga0182192_10562161	3300017430	Miscanthus Phyllosphere	VLDSGFTQHMTDDSRMFNSINSNDDNGIDSITFDDNSKGKVKGIRKIAISNY
Ga0182192_10894701	3300017430	Miscanthus Phyllosphere	MLDSGCTQHMTGDARIFNSINTSGNDGFDSITFGDNGKGKVKGLGKIAISNDM
Ga0182192_11187941	3300017430	Miscanthus Phyllosphere	MIGDARMFNSINTNDINGYDSITFDDNGKGKVKGLGKIAISNDMSISNVLL
Ga0182192_11423722	3300017430	Miscanthus Phyllosphere	VLHSQCTQYITGDSRMFNSINTNDSNGVDSITFDDNGKGKVKGLNKIAIY
Ga0182192_11570081	3300017430	Miscanthus Phyllosphere	VLDSGCTQHMTSDSRMINSVNENESNGIHSIIFGDNGKGKVKSLGKIAIS
Ga0182192_11668101	3300017430	Miscanthus Phyllosphere	VLDSGCTQHMTSDARIFNSINTSGNNEFDSITFGDNGKGKVKGLGK
Ga0182209_10579592	3300017436	Miscanthus Phyllosphere	MTCDSRMFNLINENESNRIDIITFGDNGKGKVKDLGKIAISNDL
Ga0182209_11479791	3300017436	Miscanthus Phyllosphere	MTGDARMFNSINTNDSNGYDSITFGDNGKGKVKELGKIAISNNMSIS
Ga0182209_11557231	3300017436	Miscanthus Phyllosphere	MTGDVRMFNSINTNGNDGYDSITFGDNGKGKVNGLG
Ga0182221_10909712	3300017442	Miscanthus Phyllosphere	MTDNARMFNSINTNGNNGYESIIFGDNGKGKVKWLGKIVISNDMS
Ga0182221_11397691	3300017442	Miscanthus Phyllosphere	MTGDLRMFNSINENKSNVIDSITFGDNSKVNVKGLGKIAISNDWSI
Ga0182221_11513091	3300017442	Miscanthus Phyllosphere	MTSDARMFNSINTNGNDSYDSITFGDNGKGKVKGLGKIAISN
Ga0182221_11554592	3300017442	Miscanthus Phyllosphere	MTGDARMFISINTNGNDGYVSITFGDNGKGKGKGLDKIEIAN
Ga0182233_10771281	3300017680	Miscanthus Phyllosphere	MFNSINANESNGIESIIFGDNGKSKVKGLGKIAISNDLNISNVLL
Ga0182233_10970941	3300017680	Miscanthus Phyllosphere	VLDSGCIQHMTGDSRIFNSINANESNGIDSITCDDNGKGKVKGLGKITISND
Ga0182226_10848702	3300017681	Miscanthus Phyllosphere	MTGDAKIFNSINTNGNDGYDSITFRDNGKGKVKGLGKI
Ga0182226_10981502	3300017681	Miscanthus Phyllosphere	VLDSGCTQHMTGDPRMFSSINENKSNGIDSITFGDNGKDKVKGLGKIAISNDLS
Ga0182229_10695852	3300017682	Miscanthus Phyllosphere	VLDSGCTQHMTSDPRMFNLINENKSNVIDSITFGDNGKGKVK
Ga0182229_11065401	3300017682	Miscanthus Phyllosphere	MTGDAIMFNSINTNGNDGYDSITFGDNGKGKVKGLGKIAISNDM
Ga0182218_10685831	3300017683	Miscanthus Phyllosphere	VLDSGCTQHITSDPRMFNSINENYSNEIDSITFGDNGKGKVKGLG
Ga0182218_11259642	3300017683	Miscanthus Phyllosphere	MTGDARIFNSINTNDSNGYDSTAFGDNGKGKVKGLGKICNIQ
Ga0182218_11388281	3300017683	Miscanthus Phyllosphere	VLDSGCTQHMIRESSMFNSINTSGNNEFNSITFGDNGRGKVKGLGRIAISNDLSISIVLLVE
Ga0182218_11473182	3300017683	Miscanthus Phyllosphere	MTNDARMFDSINTNDNDGYDSITFIDNGKGKVKGLGKIAISNDMSISKVLL
Ga0182225_10209091	3300017684	Miscanthus Phyllosphere	MTDDARILNSINTNGNNGYDSITFGDNVKGKVKGLGKIAISNDMSIFNVF
Ga0182225_10760791	3300017684	Miscanthus Phyllosphere	MTGDARMFNSINTNGNDGYDSITFSDNGKGKVKGLGKIAISNDMSISNVLL
Ga0182227_10857991	3300017685	Miscanthus Phyllosphere	MTGDARMFNSINTNGNDGYDSITFGDNGKGKVKWLGKIAISNDMSISN
Ga0182227_10871761	3300017685	Miscanthus Phyllosphere	MTDDVRMFNSINTNDSNGYDSITFGDNGKGKVKGLGK
Ga0182227_10920381	3300017685	Miscanthus Phyllosphere	VLDSGCTQHMTGDSRMFNSINTSGNNEFDSITFGDNVKGKVKGLGKIIISNDM
Ga0182205_10730292	3300017686	Miscanthus Phyllosphere	MTSDLRMFNSINTNGNDGYDSITFGDNGKGKVKGLGKIAISND
Ga0182205_11142622	3300017686	Miscanthus Phyllosphere	VLDSGCTQHMTGDSRMFNSINESKSNGIDSITFGDNGKGKVKGLG
Ga0182231_10593692	3300017689	Miscanthus Phyllosphere	VLDSGCTQHMTGDSRMFNSINENESNGIDSITFGDNGKGKVKGL
Ga0182231_11032091	3300017689	Miscanthus Phyllosphere	MTSDARMFKSINTNGNDGYDSITFGDNGKGKVKGRGKIAISN
Ga0182223_10300861	3300017690	Miscanthus Phyllosphere	VLDSGCTQHMTGDSRMFNSINTSGNNEFDSITFGDNGKGKVKGLGKITISNDMSI
Ga0182223_10387821	3300017690	Miscanthus Phyllosphere	MLDSGCTQHMTSDARMFNSINTSGNDGFDSITFGDNGKCKVKGFGKI
Ga0182223_10985071	3300017690	Miscanthus Phyllosphere	VLDSGCTQHMTGDPRMFNSINENKSNGIDSITFGDNGK
Ga0182232_10590001	3300021060	Phyllosphere	VLNSGCTQHMAGDSRIFNSINTSDRNGVDSITFGDNSKDKVKGLGKIAISNDLC
Ga0256702_105047452	3300023300	Food Waste	VLDSGCTQHMTGDMRMFTEMNEEGCSTYDSITFGDNRKGKVKGLAKIAISNYH
Ga0207659_112482401	3300025926	Miscanthus Rhizosphere	VLDSGCTQHMTGDPRMFNSINESKSNGIDSITFGDNGKGKVKG
Ga0207702_123952121	3300026078	Corn Rhizosphere	VLDSGCTQHMTDDPRMFNSINESKSNGIDSITFGDNGKGKVKGLG
Ga0207683_101249251	3300026121	Miscanthus Rhizosphere	MTGDARMFNSINTNGNDGYDSITFGDNGKGKVKGLGKIPISNDMSIS
Ga0268308_10027611	3300028151	Phyllosphere	MTGDARKFKSIDSHDEDGNVITFGDNSKGKVKGLGKIAI
Ga0307416_1030685791	3300032002	Rhizosphere	VLDSGCTQHMTCDMRMFTEMNEEGWSTYDSITFGDNRKGKIKGLGKIAISND

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.39
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.39
Powered by PDBe Molstar

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	98.56%
Environmental	Environmental	0.96%
Engineered	Engineered	0.48%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	98.56%
Terrestrial	Environmental → Terrestrial	0.96%
Bioreactor	Engineered → Bioreactor	0.48%

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	79.90%
Roots	Host-Associated → Plants → Roots	12.92%
Rhizosphere	Host-Associated → Plants → Rhizosphere	4.31%
Rhizoplane	Host-Associated → Plants → Rhizoplane	1.44%
Soil	Environmental → Terrestrial → Soil	0.96%
Aerobic	Engineered → Bioreactor → Aerobic	0.48%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	79.90%
Unclassified	Host-Associated → Plants → Roots → Unclassified	12.92%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	3.35%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	0.96%
Soil	Host-Associated → Plants → Rhizosphere → Soil	0.96%
Unclassified	Environmental → Terrestrial → Soil → Unclassified	0.48%
Loam	Environmental → Terrestrial → Soil → Loam	0.48%
Soil	Host-Associated → Plants → Rhizoplane → Soil	0.48%
Unclassified	Engineered → Bioreactor → Aerobic → Unclassified	0.48%

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F023512

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300003319	Sugarcane bulk soil Sample L2	Environmental	Open in IMG/M
3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Host-Associated	Open in IMG/M
3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Environmental	Open in IMG/M
3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Host-Associated	Open in IMG/M
3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Host-Associated	Open in IMG/M
3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Host-Associated	Open in IMG/M
3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Host-Associated	Open in IMG/M
3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Host-Associated	Open in IMG/M
3300014486	Endophyte microbial communities from Sorghum bicolor roots, Mead, Nebraska, USA - 072115-40_1 MetaG	Host-Associated	Open in IMG/M
3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Host-Associated	Open in IMG/M
3300015267	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015268	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015269	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015276	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015277	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015279	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015281	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015282	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015283	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015285	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015286	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015287	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015288	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015289	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015291	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015292	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015294	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015295	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015296	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015298	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015299	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015300	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015303	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015304	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015305	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015308	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015313	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015314	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015321	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015322	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015323	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015331	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015341	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015342	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015343	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015344	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015346	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015347	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015351	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015355	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015361	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300017409	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017410	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017411	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017413	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017415	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017417	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017420	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017424	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017425	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017427	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017430	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017436	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017442	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017680	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017681	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017682	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017683	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017684	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017685	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017686	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017689	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017690	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300021060	Phyllosphere microbial comminities from miscanthus, Michigan, USA - G6R3_NF_07NOV2016_LD2 MG	Host-Associated	Open in IMG/M
3300023300	Food waste microbial community from Durham, Ontario, Canada. Combined Assembly of Gp0238881, Gp0242100	Engineered	Open in IMG/M
3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300028151	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_05JUN2017_LD1	Host-Associated	Open in IMG/M
3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Host-Associated	Open in IMG/M

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign