Basic Information | |
---|---|
Family ID | F023584 |
Family Type | Metagenome |
Number of Sequences | 209 |
Average Sequence Length | 47 residues |
Representative Sequence | MEKNTQQTAQQKPAPKRPNETGSISVEGFVKIFDPKTKETFVEKRA |
Number of Associated Samples | 136 |
Number of Associated Scaffolds | 209 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 78.26 % |
% of genes near scaffold ends (potentially truncated) | 11.96 % |
% of genes from short scaffolds (< 2000 bps) | 69.86 % |
Associated GOLD sequencing projects | 119 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.28 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (47.368 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (27.751 % of family members) |
Environment Ontology (ENVO) | Unclassified (63.636 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (72.727 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 18.92% Coil/Unstructured: 81.08% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.28 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 209 Family Scaffolds |
---|---|---|
PF00149 | Metallophos | 1.44 |
PF13186 | SPASM | 0.96 |
PF04055 | Radical_SAM | 0.96 |
PF04965 | GPW_gp25 | 0.48 |
PF13460 | NAD_binding_10 | 0.48 |
PF00501 | AMP-binding | 0.48 |
PF07460 | NUMOD3 | 0.48 |
PF13394 | Fer4_14 | 0.48 |
PF12708 | Pectate_lyase_3 | 0.48 |
PF01370 | Epimerase | 0.48 |
PF13353 | Fer4_12 | 0.48 |
PF02839 | CBM_5_12 | 0.48 |
PF02739 | 5_3_exonuc_N | 0.48 |
PF01503 | PRA-PH | 0.48 |
COG ID | Name | Functional Category | % Frequency in 209 Family Scaffolds |
---|---|---|---|
COG0258 | 5'-3' exonuclease Xni/ExoIX (flap endonuclease) | Replication, recombination and repair [L] | 0.48 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 52.63 % |
Unclassified | root | N/A | 47.37 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000115|DelMOSum2011_c10002144 | Not Available | 12669 | Open in IMG/M |
3300000553|TBL_comb47_HYPODRAFT_10023165 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4814 | Open in IMG/M |
3300001839|RCM40_1013194 | Not Available | 570 | Open in IMG/M |
3300001851|RCM31_10081832 | All Organisms → Viruses → Predicted Viral | 1564 | Open in IMG/M |
3300001851|RCM31_10138302 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 528 | Open in IMG/M |
3300002092|JGI24218J26658_1018726 | Not Available | 968 | Open in IMG/M |
3300002098|JGI24219J26650_1022570 | Not Available | 832 | Open in IMG/M |
3300002138|M3t6FKB1_1658067 | Not Available | 5366 | Open in IMG/M |
3300002835|B570J40625_100091546 | All Organisms → Viruses → Predicted Viral | 3830 | Open in IMG/M |
3300002835|B570J40625_101553732 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 542 | Open in IMG/M |
3300002835|B570J40625_101607479 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 531 | Open in IMG/M |
3300003375|JGI26470J50227_1001080 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10053 | Open in IMG/M |
3300003490|JGI25926J51410_1002175 | All Organisms → Viruses → Predicted Viral | 3944 | Open in IMG/M |
3300004481|Ga0069718_13445048 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 703 | Open in IMG/M |
3300004481|Ga0069718_14076717 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 777 | Open in IMG/M |
3300004481|Ga0069718_15092320 | Not Available | 681 | Open in IMG/M |
3300004686|Ga0065173_1082093 | Not Available | 580 | Open in IMG/M |
3300004772|Ga0007791_10208229 | Not Available | 557 | Open in IMG/M |
3300004774|Ga0007794_10102596 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 853 | Open in IMG/M |
3300004804|Ga0007796_10050643 | Not Available | 1369 | Open in IMG/M |
3300004804|Ga0007796_10252358 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 511 | Open in IMG/M |
3300005584|Ga0049082_10064464 | Not Available | 1286 | Open in IMG/M |
3300005662|Ga0078894_10039919 | Not Available | 3923 | Open in IMG/M |
3300005662|Ga0078894_10626444 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 956 | Open in IMG/M |
3300005662|Ga0078894_11520577 | Not Available | 555 | Open in IMG/M |
3300006030|Ga0075470_10145354 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 694 | Open in IMG/M |
3300006030|Ga0075470_10192443 | Not Available | 586 | Open in IMG/M |
3300006071|Ga0007876_1006033 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3619 | Open in IMG/M |
3300006071|Ga0007876_1039445 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1294 | Open in IMG/M |
3300006109|Ga0007870_1011839 | Not Available | 1807 | Open in IMG/M |
3300006121|Ga0007824_1080518 | Not Available | 616 | Open in IMG/M |
3300006127|Ga0007805_1020156 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1567 | Open in IMG/M |
3300006484|Ga0070744_10242471 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 510 | Open in IMG/M |
3300006641|Ga0075471_10113329 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1450 | Open in IMG/M |
3300006805|Ga0075464_10525195 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 725 | Open in IMG/M |
3300007516|Ga0105050_10001356 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 36928 | Open in IMG/M |
3300007540|Ga0099847_1017588 | Not Available | 2340 | Open in IMG/M |
3300008055|Ga0108970_11291290 | Not Available | 15315 | Open in IMG/M |
3300008267|Ga0114364_1026454 | Not Available | 2326 | Open in IMG/M |
3300008267|Ga0114364_1086962 | Not Available | 1007 | Open in IMG/M |
3300008448|Ga0114876_1124482 | Not Available | 982 | Open in IMG/M |
3300009009|Ga0105105_10921490 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 537 | Open in IMG/M |
3300009068|Ga0114973_10125456 | All Organisms → Viruses → Predicted Viral | 1442 | Open in IMG/M |
3300009068|Ga0114973_10190308 | Not Available | 1125 | Open in IMG/M |
3300009068|Ga0114973_10407365 | Not Available | 711 | Open in IMG/M |
3300009068|Ga0114973_10686150 | Not Available | 521 | Open in IMG/M |
3300009074|Ga0115549_1090904 | Not Available | 1030 | Open in IMG/M |
3300009082|Ga0105099_10949292 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 545 | Open in IMG/M |
3300009085|Ga0105103_10641103 | Not Available | 607 | Open in IMG/M |
3300009151|Ga0114962_10000131 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 63273 | Open in IMG/M |
3300009151|Ga0114962_10013868 | Not Available | 5846 | Open in IMG/M |
3300009151|Ga0114962_10057185 | Not Available | 2545 | Open in IMG/M |
3300009151|Ga0114962_10496704 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 646 | Open in IMG/M |
3300009154|Ga0114963_10061541 | Not Available | 2368 | Open in IMG/M |
3300009155|Ga0114968_10020572 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4540 | Open in IMG/M |
3300009155|Ga0114968_10128625 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1521 | Open in IMG/M |
3300009155|Ga0114968_10204595 | Not Available | 1142 | Open in IMG/M |
3300009158|Ga0114977_10093879 | All Organisms → Viruses → Predicted Viral | 1826 | Open in IMG/M |
3300009159|Ga0114978_10003680 | Not Available | 12511 | Open in IMG/M |
3300009159|Ga0114978_10158784 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1452 | Open in IMG/M |
3300009159|Ga0114978_10223416 | Not Available | 1181 | Open in IMG/M |
3300009161|Ga0114966_10533905 | Not Available | 663 | Open in IMG/M |
3300009163|Ga0114970_10214089 | Not Available | 1128 | Open in IMG/M |
3300009163|Ga0114970_10235183 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1065 | Open in IMG/M |
3300009164|Ga0114975_10066729 | All Organisms → Viruses → Predicted Viral | 2101 | Open in IMG/M |
3300009164|Ga0114975_10130500 | Not Available | 1445 | Open in IMG/M |
3300009164|Ga0114975_10276591 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 934 | Open in IMG/M |
3300009165|Ga0105102_10352092 | Not Available | 773 | Open in IMG/M |
3300009169|Ga0105097_10247364 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 982 | Open in IMG/M |
3300009169|Ga0105097_10570411 | Not Available | 636 | Open in IMG/M |
3300009181|Ga0114969_10314895 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 919 | Open in IMG/M |
3300009182|Ga0114959_10372979 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 702 | Open in IMG/M |
3300009183|Ga0114974_10287766 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 971 | Open in IMG/M |
3300009184|Ga0114976_10065619 | Not Available | 2113 | Open in IMG/M |
3300009187|Ga0114972_10452733 | Not Available | 733 | Open in IMG/M |
3300009502|Ga0114951_10012336 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6443 | Open in IMG/M |
3300009684|Ga0114958_10147295 | Not Available | 1193 | Open in IMG/M |
3300009684|Ga0114958_10441736 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 627 | Open in IMG/M |
3300010160|Ga0114967_10113029 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1558 | Open in IMG/M |
3300010354|Ga0129333_10026028 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5541 | Open in IMG/M |
3300010354|Ga0129333_11711811 | Not Available | 511 | Open in IMG/M |
3300010885|Ga0133913_10243848 | Not Available | 4773 | Open in IMG/M |
3300010885|Ga0133913_10297588 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4278 | Open in IMG/M |
3300010885|Ga0133913_10524808 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3118 | Open in IMG/M |
3300010885|Ga0133913_10622132 | Not Available | 2833 | Open in IMG/M |
3300010885|Ga0133913_11224819 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1923 | Open in IMG/M |
3300010885|Ga0133913_11395196 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1782 | Open in IMG/M |
3300010885|Ga0133913_11450808 | All Organisms → Viruses → Predicted Viral | 1742 | Open in IMG/M |
3300010885|Ga0133913_11993373 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1442 | Open in IMG/M |
3300010885|Ga0133913_12801355 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1174 | Open in IMG/M |
3300011010|Ga0139557_1000363 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 11066 | Open in IMG/M |
3300011011|Ga0139556_1012438 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1225 | Open in IMG/M |
3300011113|Ga0151517_1133 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 32018 | Open in IMG/M |
3300012346|Ga0157141_1007535 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1626 | Open in IMG/M |
3300012352|Ga0157138_1011772 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1435 | Open in IMG/M |
3300012667|Ga0157208_10057652 | Not Available | 530 | Open in IMG/M |
3300012667|Ga0157208_10058643 | Not Available | 526 | Open in IMG/M |
3300013004|Ga0164293_10075279 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2647 | Open in IMG/M |
3300013004|Ga0164293_10321685 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1065 | Open in IMG/M |
3300013005|Ga0164292_10158539 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1647 | Open in IMG/M |
3300013006|Ga0164294_10000803 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 29827 | Open in IMG/M |
3300013006|Ga0164294_10123402 | Not Available | 1897 | Open in IMG/M |
3300013006|Ga0164294_10147572 | Not Available | 1704 | Open in IMG/M |
3300013093|Ga0164296_1000707 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 38508 | Open in IMG/M |
3300013093|Ga0164296_1075780 | Not Available | 1481 | Open in IMG/M |
3300013093|Ga0164296_1103237 | Not Available | 1194 | Open in IMG/M |
3300013093|Ga0164296_1276431 | Not Available | 632 | Open in IMG/M |
3300013094|Ga0164297_10150849 | Not Available | 930 | Open in IMG/M |
3300013094|Ga0164297_10171091 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 858 | Open in IMG/M |
3300013286|Ga0136641_1000423 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 18232 | Open in IMG/M |
3300014962|Ga0134315_1020121 | Not Available | 1034 | Open in IMG/M |
3300017716|Ga0181350_1058641 | Not Available | 1008 | Open in IMG/M |
3300017747|Ga0181352_1072591 | Not Available | 971 | Open in IMG/M |
3300017754|Ga0181344_1110351 | Not Available | 796 | Open in IMG/M |
3300017754|Ga0181344_1171215 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 615 | Open in IMG/M |
3300017754|Ga0181344_1175039 | Not Available | 607 | Open in IMG/M |
3300017754|Ga0181344_1208123 | Not Available | 547 | Open in IMG/M |
3300017754|Ga0181344_1231622 | Not Available | 514 | Open in IMG/M |
3300017754|Ga0181344_1234853 | Not Available | 510 | Open in IMG/M |
3300018417|Ga0181558_10203280 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1134 | Open in IMG/M |
3300018420|Ga0181563_10365886 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 829 | Open in IMG/M |
3300018790|Ga0187842_1015332 | Not Available | 2600 | Open in IMG/M |
3300018868|Ga0187844_10042879 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2171 | Open in IMG/M |
3300018876|Ga0181564_10605338 | Not Available | 581 | Open in IMG/M |
3300019093|Ga0187843_10150803 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1009 | Open in IMG/M |
3300019093|Ga0187843_10284094 | Not Available | 681 | Open in IMG/M |
3300019784|Ga0181359_1001334 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6541 | Open in IMG/M |
3300019784|Ga0181359_1197735 | Not Available | 650 | Open in IMG/M |
3300020141|Ga0211732_1306470 | Not Available | 707 | Open in IMG/M |
3300020151|Ga0211736_10393548 | All Organisms → Viruses → Predicted Viral | 1050 | Open in IMG/M |
3300020159|Ga0211734_11040463 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1202 | Open in IMG/M |
3300020160|Ga0211733_10974114 | All Organisms → Viruses → Predicted Viral | 2384 | Open in IMG/M |
3300020161|Ga0211726_10299681 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 500 | Open in IMG/M |
3300020162|Ga0211735_11370264 | Not Available | 859 | Open in IMG/M |
3300020166|Ga0206128_1000945 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 31169 | Open in IMG/M |
3300020175|Ga0206124_10150686 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 937 | Open in IMG/M |
3300020185|Ga0206131_10096452 | All Organisms → Viruses → Predicted Viral | 1717 | Open in IMG/M |
3300020205|Ga0211731_11289334 | Not Available | 786 | Open in IMG/M |
3300021354|Ga0194047_10001671 | Not Available | 13329 | Open in IMG/M |
3300021519|Ga0194048_10074527 | Not Available | 1331 | Open in IMG/M |
3300021519|Ga0194048_10343650 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 532 | Open in IMG/M |
3300021961|Ga0222714_10000049 | Not Available | 142995 | Open in IMG/M |
3300021961|Ga0222714_10408016 | Not Available | 716 | Open in IMG/M |
3300022555|Ga0212088_10853392 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 517 | Open in IMG/M |
3300022591|Ga0236341_1009898 | Not Available | 3436 | Open in IMG/M |
3300022602|Ga0248169_101008 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 41483 | Open in IMG/M |
3300022602|Ga0248169_101545 | Not Available | 31615 | Open in IMG/M |
3300022602|Ga0248169_105832 | Not Available | 11928 | Open in IMG/M |
3300022602|Ga0248169_122982 | Not Available | 3663 | Open in IMG/M |
3300023174|Ga0214921_10000016 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 349716 | Open in IMG/M |
3300023174|Ga0214921_10000312 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 95736 | Open in IMG/M |
3300023184|Ga0214919_10001516 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 37772 | Open in IMG/M |
3300024262|Ga0210003_1020128 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4080 | Open in IMG/M |
3300025358|Ga0208504_1020840 | Not Available | 883 | Open in IMG/M |
3300025407|Ga0208378_1022202 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1159 | Open in IMG/M |
3300025418|Ga0208253_1035135 | Not Available | 912 | Open in IMG/M |
3300025450|Ga0208744_1068812 | Not Available | 694 | Open in IMG/M |
3300025578|Ga0208864_1120454 | Not Available | 599 | Open in IMG/M |
3300025585|Ga0208546_1119647 | Not Available | 578 | Open in IMG/M |
3300025635|Ga0208147_1000477 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 14129 | Open in IMG/M |
3300025872|Ga0208783_10131257 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1076 | Open in IMG/M |
3300027708|Ga0209188_1029468 | Not Available | 2644 | Open in IMG/M |
3300027708|Ga0209188_1306274 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 527 | Open in IMG/M |
3300027721|Ga0209492_1045309 | Not Available | 1547 | Open in IMG/M |
(restricted) 3300027730|Ga0247833_1142072 | Not Available | 976 | Open in IMG/M |
3300027733|Ga0209297_1069160 | All Organisms → Viruses → Predicted Viral | 1560 | Open in IMG/M |
3300027734|Ga0209087_1031263 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2543 | Open in IMG/M |
3300027734|Ga0209087_1105785 | Not Available | 1186 | Open in IMG/M |
3300027736|Ga0209190_1011805 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5170 | Open in IMG/M |
3300027736|Ga0209190_1099031 | Not Available | 1347 | Open in IMG/M |
3300027741|Ga0209085_1016331 | Not Available | 3625 | Open in IMG/M |
3300027741|Ga0209085_1260319 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 676 | Open in IMG/M |
3300027746|Ga0209597_1055014 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1951 | Open in IMG/M |
3300027747|Ga0209189_1087520 | Not Available | 1419 | Open in IMG/M |
3300027747|Ga0209189_1124615 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1126 | Open in IMG/M |
3300027759|Ga0209296_1000297 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 42495 | Open in IMG/M |
3300027759|Ga0209296_1024693 | Not Available | 3379 | Open in IMG/M |
3300027805|Ga0209229_10372308 | Not Available | 623 | Open in IMG/M |
3300027808|Ga0209354_10245512 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 720 | Open in IMG/M |
3300027896|Ga0209777_10006512 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 13143 | Open in IMG/M |
3300027896|Ga0209777_10587208 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 808 | Open in IMG/M |
3300027896|Ga0209777_10915320 | Not Available | 606 | Open in IMG/M |
3300027900|Ga0209253_10588965 | Not Available | 817 | Open in IMG/M |
3300027963|Ga0209400_1044761 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2340 | Open in IMG/M |
3300027963|Ga0209400_1045295 | Not Available | 2320 | Open in IMG/M |
3300027963|Ga0209400_1166093 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 946 | Open in IMG/M |
3300027969|Ga0209191_1300875 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 594 | Open in IMG/M |
3300027976|Ga0209702_10000543 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 79569 | Open in IMG/M |
3300031669|Ga0307375_10859443 | Not Available | 507 | Open in IMG/M |
3300031759|Ga0316219_1022636 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2970 | Open in IMG/M |
3300031857|Ga0315909_10329147 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1127 | Open in IMG/M |
3300031857|Ga0315909_10371765 | Not Available | 1036 | Open in IMG/M |
3300031857|Ga0315909_10962784 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 520 | Open in IMG/M |
3300031951|Ga0315904_10303349 | Not Available | 1495 | Open in IMG/M |
3300031951|Ga0315904_11179150 | Not Available | 590 | Open in IMG/M |
3300032562|Ga0316226_1047668 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2239 | Open in IMG/M |
3300032605|Ga0316232_1064140 | Not Available | 1769 | Open in IMG/M |
3300033521|Ga0316616_104922085 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 503 | Open in IMG/M |
3300034020|Ga0335002_0387478 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 781 | Open in IMG/M |
3300034082|Ga0335020_0069641 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1820 | Open in IMG/M |
3300034082|Ga0335020_0460316 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 607 | Open in IMG/M |
3300034102|Ga0335029_0199213 | Not Available | 1331 | Open in IMG/M |
3300034102|Ga0335029_0638576 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 589 | Open in IMG/M |
3300034117|Ga0335033_0580732 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 524 | Open in IMG/M |
3300034121|Ga0335058_0105115 | Not Available | 1651 | Open in IMG/M |
3300034272|Ga0335049_0777209 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 570 | Open in IMG/M |
3300034284|Ga0335013_0862409 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 501 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 27.75% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 13.88% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 8.13% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 7.66% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 7.18% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 3.83% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 3.35% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 2.39% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 1.91% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 1.91% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 1.91% |
Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 1.44% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 1.44% |
Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 1.44% |
Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 1.44% |
Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 1.44% |
Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 1.44% |
Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic | 0.96% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 0.96% |
Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 0.96% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.96% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.96% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 0.48% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.48% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.48% |
Freshwater Lake Hypolimnion | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake Hypolimnion | 0.48% |
Surface Water | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Surface Water | 0.48% |
Freshwater | Environmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater | 0.48% |
Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.48% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.48% |
Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 0.48% |
Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 0.48% |
Marine | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Marine | 0.48% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.48% |
Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.48% |
Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 0.48% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
3300000553 | Trout Bog Lake May 28 2007 Hypolimnion (Trout Bog Lake Combined Assembly 47 Hypolimnion Samples, Aug 2012 Assem) | Environmental | Open in IMG/M |
3300001839 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM40, ROCA_DNA238_2.0um_Ob_C_3b | Environmental | Open in IMG/M |
3300001851 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM31, ROCA_DNA206_0.2um_MCP-S_C_3b | Environmental | Open in IMG/M |
3300002092 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-B6 metagenome | Environmental | Open in IMG/M |
3300002098 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-B7 metagenome | Environmental | Open in IMG/M |
3300002138 | M3t6FKB1 (102f) | Environmental | Open in IMG/M |
3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
3300003375 | Freshwater actinobacteria microbial communities from Trout Bog Lake, Wisconsin, USA - enrichment TB-E6 | Environmental | Open in IMG/M |
3300003490 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN | Environmental | Open in IMG/M |
3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
3300004686 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE10Oct08 (version 2) | Environmental | Open in IMG/M |
3300004772 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA0.5M | Environmental | Open in IMG/M |
3300004774 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA5M | Environmental | Open in IMG/M |
3300004804 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA0M | Environmental | Open in IMG/M |
3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
3300006030 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA | Environmental | Open in IMG/M |
3300006071 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH24Aug09 | Environmental | Open in IMG/M |
3300006109 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH04Jul08 | Environmental | Open in IMG/M |
3300006121 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE05Oct08 | Environmental | Open in IMG/M |
3300006127 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE24Aug09 | Environmental | Open in IMG/M |
3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
3300007516 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 | Environmental | Open in IMG/M |
3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
3300009009 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
3300009074 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100430 | Environmental | Open in IMG/M |
3300009082 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
3300009182 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG | Environmental | Open in IMG/M |
3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
3300009187 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG | Environmental | Open in IMG/M |
3300009502 | Freshwater microbial communities from Finland to study Microbial Dark Matter (Phase II) - AM7a DNA metaG | Environmental | Open in IMG/M |
3300009684 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG | Environmental | Open in IMG/M |
3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
3300011010 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface Ice | Environmental | Open in IMG/M |
3300011011 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Top - Depth 1m | Environmental | Open in IMG/M |
3300011113 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015Sep | Environmental | Open in IMG/M |
3300012346 | Freshwater microbial communities from Emily Creek, Ontario, Canada - S29 | Environmental | Open in IMG/M |
3300012352 | Freshwater microbial communities from Baxter Creek, Ontario, Canada - S37 | Environmental | Open in IMG/M |
3300012667 | Freshwater microbial communities from Maskinonge River, Ontario, Canada - S15 | Environmental | Open in IMG/M |
3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
3300013006 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaG | Environmental | Open in IMG/M |
3300013093 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES057 metaG | Environmental | Open in IMG/M |
3300013094 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES058 metaG | Environmental | Open in IMG/M |
3300013286 | Freshwater microbial communities from Elizabeth Lake, Yosemite National Park, California, USA - 13020-23Y | Environmental | Open in IMG/M |
3300014962 | Surface water microbial communities from Bangladesh - BaraHaldiaSW0309 | Environmental | Open in IMG/M |
3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
3300018417 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011507BT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300018420 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300018790 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - SP09_SKY_41 | Environmental | Open in IMG/M |
3300018868 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - SP09_SKY_50 | Environmental | Open in IMG/M |
3300018876 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011513CT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300019093 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - SP09_SKY_43 | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
3300020166 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160426_1 | Environmental | Open in IMG/M |
3300020175 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160321_2 | Environmental | Open in IMG/M |
3300020185 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160517_1 | Environmental | Open in IMG/M |
3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
3300021354 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L221-5m | Environmental | Open in IMG/M |
3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
3300022555 | Alinen_combined assembly | Environmental | Open in IMG/M |
3300022591 | Freshwater microbial communities from thermokarst lake SAS2a, Kuujjuarapick, Canada - Sample Summer S2 | Environmental | Open in IMG/M |
3300022602 | Freshwater microbial communities from Trout Bog Lake, Vilas County, Wisconsin, United States - 30JULY2014 epilimnion | Environmental | Open in IMG/M |
3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
3300024262 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025358 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH05Oct08 (SPAdes) | Environmental | Open in IMG/M |
3300025407 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE24Aug09 (SPAdes) | Environmental | Open in IMG/M |
3300025418 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE10Oct08 (SPAdes) | Environmental | Open in IMG/M |
3300025450 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH24Aug09 (SPAdes) | Environmental | Open in IMG/M |
3300025578 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA0.5M (SPAdes) | Environmental | Open in IMG/M |
3300025585 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025635 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025872 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300027708 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027721 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes) | Environmental | Open in IMG/M |
3300027730 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_8m | Environmental | Open in IMG/M |
3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027741 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027746 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027747 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
3300027896 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes) | Environmental | Open in IMG/M |
3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027976 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 (SPAdes) | Environmental | Open in IMG/M |
3300031669 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-1 | Environmental | Open in IMG/M |
3300031759 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18003P | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
3300032562 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18017 | Environmental | Open in IMG/M |
3300032605 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18025_13 | Environmental | Open in IMG/M |
3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
3300034020 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2015-rr0055 | Environmental | Open in IMG/M |
3300034082 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088 | Environmental | Open in IMG/M |
3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
3300034117 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jun2014-rr0124 | Environmental | Open in IMG/M |
3300034121 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19May2015-rr0174 | Environmental | Open in IMG/M |
3300034272 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156 | Environmental | Open in IMG/M |
3300034284 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
DelMOSum2011_100021446 | 3300000115 | Marine | MNQNTTPQQPVAPAKPPQETGTISVEGHIRIFDPKTKEVIVEKRA* |
TBL_comb47_HYPODRAFT_100231657 | 3300000553 | Freshwater | MEKNTQQTAQQKPAPKRPNETGSISVEGFVKIFDPKTKETFVEKRA* |
RCM40_10131942 | 3300001839 | Marine Plankton | MTQNTQQKPVVPAPKRPNDTGSISVEGHVRIFDPKTKETFVEKRA* |
RCM31_100818322 | 3300001851 | Marine Plankton | MTQNTQQKPAQPAPKKPNETGSISVEGFVRIFDPKTKETFVEKRA* |
RCM31_101383022 | 3300001851 | Marine Plankton | MTQNTQQKPAQPAPKRPNDTGSITVEGHVRIFDPKTKETYVEKRA* |
JGI24218J26658_10187262 | 3300002092 | Lentic | MTENKQPTQTQTSTKRPNETGSIKVEGFVRIHDPKTKEVFVEKRA* |
JGI24219J26650_10225702 | 3300002098 | Lentic | MENNVKQPAQPRPTTAKPKRPNETGAIAVEGFVKIFDPKTKETFVEKRA* |
M3t6FKB1_16580672 | 3300002138 | Marine | MIQNTTPQQPVTPAKKPQETGTISVEGHIRIFDPKTKEVIVEKRA* |
B570J40625_1000915462 | 3300002835 | Freshwater | MNQSTQPQQPVAPAKKPNETGSISVEGHIRIFDPKTKEVIVEKRA* |
B570J40625_1015537322 | 3300002835 | Freshwater | MTQKDQQKTPLPQNNNAKRPNETGSISVEGFVKIFDPATKETFVEKRA* |
B570J40625_1016074792 | 3300002835 | Freshwater | MNQSARPQQPPTPAKKPNETGSISVEGHIRIFDPKTKEVIVEKRA* |
JGI26470J50227_10010802 | 3300003375 | Freshwater | MTQNNIPKQSQPAAPTPKRPNERGTISVEGFVKIFDPKTKEKFVEKRA* |
JGI25926J51410_10021752 | 3300003490 | Freshwater Lake | MTQNTKSPQPTVPAKKPNETGSISVEGHVRIFDPKTKEVLVEKRA* |
Ga0069718_134450482 | 3300004481 | Sediment | MTQNTQQQPAKPAPKRPNDTGSISVEGHVRIFDPKTKETFVEKRA* |
Ga0069718_140767172 | 3300004481 | Sediment | MTQNTTQNQPETKPAVKRPNETGSISVEGFVRIFDPNTKEKFVEK |
Ga0069718_150923202 | 3300004481 | Sediment | MTQNTQTNQPQKPAPRPANDTGSISVEGFVKIFDPNTKEKFVEKRA* |
Ga0065173_10820932 | 3300004686 | Freshwater | MTQNKQTTQTQTPAKRPNETGSVRVEGFVKIYDPKTKEVFVEKRA* |
Ga0007791_102082291 | 3300004772 | Freshwater | MTENKQPTQTQTSTKRPNETGSIQVEGFVRIHDPKTKEVFVEKRA* |
Ga0007794_101025962 | 3300004774 | Freshwater | MEKNTQQPVQHKPAATKPKRPNETSAIAVEGFVRIFDPKTKETFVEKRA* |
Ga0007796_100506432 | 3300004804 | Freshwater | MNQPITTPLPQKPAPKPANDTGSISVEGFIRIFDPNTKEKFVEKRA* |
Ga0007796_102523582 | 3300004804 | Freshwater | MEKNAQQPTQNKPVARPKRPNETGAISVEGFVKIFDPKTKETFVEKRA* |
Ga0049082_100644642 | 3300005584 | Freshwater Lentic | MNQNARPQQPPTPAKKPNETGSISVEGHIRIFDPKTKEVIVEKRA* |
Ga0078894_100399193 | 3300005662 | Freshwater Lake | MEQTSQNKQPPQTPAPKKPNETGSISVEGFVKIHDPKSKEVFVEKRA* |
Ga0078894_106264442 | 3300005662 | Freshwater Lake | MTQDTKLPKPAAPAKKPNEKGSISVEGHVRIFDPKTKEVLVEKRA* |
Ga0078894_115205771 | 3300005662 | Freshwater Lake | MNQKKDTSTTANAQPVAQAPRRPNETGSISVEGFVRIHDPKSKEVFVEKRA* |
Ga0075470_101453542 | 3300006030 | Aqueous | MEQTSQNKQPPQTPAPKRPNETGSISVEGFVKIHDPKSKEVFVEKRA* |
Ga0075470_101924432 | 3300006030 | Aqueous | MTQNTTQQPVQPAPKKPNETGSISVEGFVKIFDPKTKETFVEKRA* |
Ga0007876_10060332 | 3300006071 | Freshwater | MTENKQPTQTQASTKRPNETGSIRVEGFVRIHDPKTKEVFVEKRA* |
Ga0007876_10394452 | 3300006071 | Freshwater | MTENKQTNNTPQPPKKPNETGSIRVEGFVKIHDPKTKEIFVEKRA* |
Ga0007870_10118392 | 3300006109 | Freshwater | MENNKQPVPQVKPATPPKRPNETGSVRVEGFLKIFDPNTQEKFVEKRA* |
Ga0007824_10805182 | 3300006121 | Freshwater | MTQNKQTTQTQTPAKRPNETGSVRVEGFVKIYDPKTKEVFVEK |
Ga0007805_10201561 | 3300006127 | Freshwater | MTQNKQTTQTQTPAKRPNETGSVRVEGFVKIYDPKTKE |
Ga0070744_102424711 | 3300006484 | Estuarine | MTQNTTQQQPAVPAKKPNETGSISVEGHIRIFDPKTKEVI |
Ga0075471_101133292 | 3300006641 | Aqueous | MSQNNDQNKTAEPTPEPAPKRPNETGSISVEGFVRIFDPKSKEVYVEKRA* |
Ga0075464_105251952 | 3300006805 | Aqueous | MTQNTTPIQPASPAKKPNETGSISVEGHIRIFDPATKEVLVEKRA* |
Ga0105050_1000135612 | 3300007516 | Freshwater | MNQNTTPQQPAVPAKKPQETGTISVEGHIRIFDPKTKEVIVEKRA* |
Ga0099847_10175883 | 3300007540 | Aqueous | MTQSTTPQQPVAPATKPQETGTISVEGHIRIFDPKTKEVIVEKRA* |
Ga0108970_112912903 | 3300008055 | Estuary | MEKTAQQPAQNKPAAPKPKRPNETSAISVEGFVKIFDPNTKETFVEKRA* |
Ga0114364_10264542 | 3300008267 | Freshwater, Plankton | MQKTTQQPVTPQPVAKRPNETGSISVEGFVKIFDPKSKEVFVEKRA* |
Ga0114364_10869622 | 3300008267 | Freshwater, Plankton | MTQNAIPQQPTAPAKKPQETGTISVEGHIRIFDPKTKEVIVEKRA* |
Ga0114876_11244822 | 3300008448 | Freshwater Lake | MNQKKDTPMTANAQPVAQAPRRPNETGSISVEGFVRIHDPKSKEVFVEKRA* |
Ga0105105_109214902 | 3300009009 | Freshwater Sediment | MTQNTTQKQPAPTQPASKKPNETGSISVEGFVRIFDPATKEVFVEKRA* |
Ga0114973_101254562 | 3300009068 | Freshwater Lake | MTQNAIPQQPAAPAKKPQETGTISVEGHIRIFDPKTKEVIVEKRA* |
Ga0114973_101903083 | 3300009068 | Freshwater Lake | MEKNTQQPAQTKPVATKPKRPNETSAISVEGFVKIFDPNTKEKFVEKRA* |
Ga0114973_104073652 | 3300009068 | Freshwater Lake | MEKNTQQPAQHKPAATKPKRPNETSAIAVEGFVKIFDPKTKETFVEKRA* |
Ga0114973_106861502 | 3300009068 | Freshwater Lake | MKKNAQQPAQQKPAAPKPKRPNETGAVSVEGFVKIFDPNTKEKFVEKRA* |
Ga0115549_10909042 | 3300009074 | Pelagic Marine | MTQSTTPQQPVAPAKKPQETGTISVEGHIRIFDPKTKEVIVEKRA* |
Ga0105099_109492921 | 3300009082 | Freshwater Sediment | MNQQINTTLPQKPAPKPANDTGSISVEGFIRIFDPNTKEKFVEKRA* |
Ga0105103_106411031 | 3300009085 | Freshwater Sediment | MTENTTQKQQAPQQPASKKPNDTGSISVEGFVRIFDPETKEVFVEKRA* |
Ga0114962_1000013195 | 3300009151 | Freshwater Lake | MEKNTQQSAQQKPTATKPKRPNETSAISVEGFVKIFDPKTKETFVEKRA* |
Ga0114962_100138682 | 3300009151 | Freshwater Lake | MTQNTTPTQQPANTPAQKKPNETGSISVEGHVRIFDPKTKEVYVEKRA* |
Ga0114962_100571852 | 3300009151 | Freshwater Lake | MTQNTAQSAPNTTPVAKRPNETGSISVEGFVKIFDPNTKEKFVEKRA* |
Ga0114962_104967042 | 3300009151 | Freshwater Lake | MNQPINTNQPQKPAPKPANDTGSISVEGFIRIFDPNTKEKFVEKRA* |
Ga0114963_100615412 | 3300009154 | Freshwater Lake | MEKNAQQPAQKKPAAPKPKRPNETGAVSVEGFVKIFDPNTKEKFVEKRA* |
Ga0114968_100205724 | 3300009155 | Freshwater Lake | MNQSTQPQQPAQPAKKPNETGSISVEGHIRIFDPTTKEVIVEKRA* |
Ga0114968_101286252 | 3300009155 | Freshwater Lake | MEKNTQQSAQHKPAATKPKRPNETSAISVEGFVKIFDPKTKETFVEKRA* |
Ga0114968_102045951 | 3300009155 | Freshwater Lake | MEKNTQQPAQTKPVATKPKRPKRPNETGAVSVEGFVKIFDPNTKEKFVEKRA* |
Ga0114977_100938792 | 3300009158 | Freshwater Lake | MNQSARPQQPPTPAKKPTETGSISVEGHIRIFDPKTKEVIVEKRA* |
Ga0114978_100036803 | 3300009159 | Freshwater Lake | MNQSTRPPQPAAPAKKPNETGSISVEGHIRIFDPKTKEVIVEKRA* |
Ga0114978_101587842 | 3300009159 | Freshwater Lake | MEKNTQQPAQTKPVAKPKRPNETGAISVEGFVKIFDPKTKETFVEKRA* |
Ga0114978_102234163 | 3300009159 | Freshwater Lake | MEKNTQQSAQQKPPATKPKRPNETSAIAVEGFVKIFDPKTKETFVEKRA* |
Ga0114966_105339052 | 3300009161 | Freshwater Lake | MEKNTQQSAQHKPPAPKPKRPNETSAISVEGFVKIFDPKTKEIFVEKRA* |
Ga0114970_102140892 | 3300009163 | Freshwater Lake | MEQKSQNKQPPQKPAPKKPNETGSISVEGFVKIYDPKSKEVFVEKRA* |
Ga0114970_102351832 | 3300009163 | Freshwater Lake | MTQNTIPAQQPANTPAQKKPNETGSISVEGHVRIFDPKTKEVYVEKRA* |
Ga0114975_100667292 | 3300009164 | Freshwater Lake | MNQSARPQQPPTPAKKPTETGSISVEGHIRIFDPKTKEVIVEKR |
Ga0114975_101305001 | 3300009164 | Freshwater Lake | MEKNTQQPAQIKPVAKPKRPNETGAISVEGFLKIFDPKTKETFVEKRA* |
Ga0114975_102765912 | 3300009164 | Freshwater Lake | MEKITQQPAQHKPAAPKPKRPNETSAISVEGFVKIFDPNTKETFVEKRA* |
Ga0105102_103520922 | 3300009165 | Freshwater Sediment | MTQNTTQTQPVPQQPAPKKPNDTGSISVEGFVRIFDPETKEVFVEKRA* |
Ga0105097_102473642 | 3300009169 | Freshwater Sediment | MTQNTTQYQPGTQQPAPKKPNDTGSISVEGFVRIFDPETKEVFVEKRA* |
Ga0105097_105704111 | 3300009169 | Freshwater Sediment | QNTTQTQPVPQQPAPKKPNDTGSISVEGFVRIFDPETKEVFVEKRA* |
Ga0114969_103148952 | 3300009181 | Freshwater Lake | MNQPITTPLSQKPAAKPANDTGSISVEGFIRIFDPNTKEKFVEKRA* |
Ga0114959_100410382 | 3300009182 | Freshwater Lake | MTDNTKQPTPAPKRPNETGSISVEGFVKIFDPKTKQVYVEKRA* |
Ga0114959_103729792 | 3300009182 | Freshwater Lake | MEKNAQQPAKPAAAKPKRPNETSAISVEGFVKIFDPKTKETFVEKRA* |
Ga0114974_102877662 | 3300009183 | Freshwater Lake | MEKTTQQPAKPQTQSAAKRPNETGSISVEGFVKIFDPKSKEVFVEKRA* |
Ga0114976_100656193 | 3300009184 | Freshwater Lake | MEKNAQQPAQQKPAAPKPKRPNETGAVSVEGFVKIFDPNTKEKFVEKRA* |
Ga0114972_104527332 | 3300009187 | Freshwater Lake | MEKNTQQPAQHKPATPKPKRPNETGAIAVEGFVKIFDPKTKETFVEKRA* |
Ga0114951_1001233610 | 3300009502 | Freshwater | MEKNVQQPTKVNPSARPKRPNETSAISVEGFVKIFDPKTKETFVEKRA* |
Ga0114958_101472953 | 3300009684 | Freshwater Lake | MEKNAQQPAQKKPAAPKPKRPNETGAVSVQGFVKIFDPNTKEKFVEKRA* |
Ga0114958_104417362 | 3300009684 | Freshwater Lake | MEKNTQRPAQNKPVAPKPKRPNETGAVSVEGFVKIFDPNTKKKFVEKR |
Ga0114967_101130292 | 3300010160 | Freshwater Lake | MEKNTQQPAQIKPVATKPKPKRPNETGAVSVEGFVKIFDPNTKEKFVEKRA* |
Ga0129333_100260282 | 3300010354 | Freshwater To Marine Saline Gradient | MEQKNQIKQPLQTTAPAPKRPNDTGSISVEGFIRIHDPKTKEVFVEKRA* |
Ga0129333_117118111 | 3300010354 | Freshwater To Marine Saline Gradient | MEKTTQQPVKPQTQSANKRPNETGSISVEGFVKIFDPKSKEVFVEKRA* |
Ga0133913_102438482 | 3300010885 | Freshwater Lake | MNQPINTTLPQTPAPRPANDTGSISVEGFIRIFDPNTKEKFVEKRA* |
Ga0133913_102975882 | 3300010885 | Freshwater Lake | MEKTNQQPATPKPTAPAQRPNEAGVVRVEGFVRIFDPNTKETLVEKRA* |
Ga0133913_105248082 | 3300010885 | Freshwater Lake | MTENKQPTQTQTSTKRPNETGSIRVEGFVRIHDPKTQEVFVEKRA* |
Ga0133913_106221322 | 3300010885 | Freshwater Lake | MTQTTTTNQPQQPQAALKRPNDTGSISVEGFVRIFDPNTKEKFVEKRA* |
Ga0133913_112248191 | 3300010885 | Freshwater Lake | MKKNTQQPVQNKPVATKPKRPNETSAISVEGFVKIFDPNTKEKFVEKRA* |
Ga0133913_113951962 | 3300010885 | Freshwater Lake | MEKTTQQPVKPQTQSAAKRPNETGSISVEGFVKIFDPKSKEVFVEKRA* |
Ga0133913_114508082 | 3300010885 | Freshwater Lake | MEKNTQRPAQNKPVAPKPKRPNETGAVSVEGFVKIFDPNTKKKFVEKRA* |
Ga0133913_119933732 | 3300010885 | Freshwater Lake | MTQNTQPIQPQTPAPKPANDTGSISVEGFVRIFDPNTKEKFVEKRA* |
Ga0133913_128013551 | 3300010885 | Freshwater Lake | MEKTTQHPAMPRTQSAAKRPNETGSISVEGFVKIFDPKSKEVFVEKRA |
Ga0139557_10003632 | 3300011010 | Freshwater | MTQNAIPQQPAALAKKPQETRTITVVGHIRIFDPKTKEVIVEKRA* |
Ga0139556_10124382 | 3300011011 | Freshwater | MTQNAIPQQPAALAKKPQETGTISVEGHVRIFDPKTKEVIVEKRA* |
Ga0151517_113314 | 3300011113 | Freshwater | MEKTTQQPVKTQTQSANKRPNETGSISVEGFVKIFDPKSKEVFVEKRA* |
Ga0157141_10075352 | 3300012346 | Freshwater | MNQNNQHNNMGQPAPSPAPKKPNETGSISVEGFVKIYDPNTQEKFVEKRA* |
Ga0157138_10117722 | 3300012352 | Freshwater | MTQKASQNQPVQQPAPKKPNDTGSISVEGFVRIFDPKTKEVFVEKRA* |
Ga0157208_100576522 | 3300012667 | Freshwater | MTQDTKLTKPAVPAKKPNETGSISVEGHVRIFDPKTKEVLVEKRA* |
Ga0157208_100586432 | 3300012667 | Freshwater | MTDNTKQPQPNSAVTAPKRPNETGSISVEGFIKIFDPKTQETFVEKRA* |
Ga0164293_100752794 | 3300013004 | Freshwater | MKQNSTQQQPTTPAANKRPNDTGAISVEGHVKIFDPKTKEIFVEKRA* |
Ga0164293_103216852 | 3300013004 | Freshwater | MQNNTAPTTPATATPVEKKPNENGSIRVEGFVKIFDPNSKETFVEKRA* |
Ga0164292_101585392 | 3300013005 | Freshwater | MTQNAIPQQTAAPAKKPQETGTISVEGHIRIFDPKTKEVIVEKRA* |
Ga0164294_1000080314 | 3300013006 | Freshwater | MTQNTTQQQPAAPAKKPNETGSISVEGHIRIFDPKTKEVIVEKRA* |
Ga0164294_101234022 | 3300013006 | Freshwater | MNQSTRPQQPAPPAKKPNETGSISVEGHIRIFDPKTKEVLVEKRA* |
Ga0164294_101475722 | 3300013006 | Freshwater | MNQPITTPLPQKPAAKPANDTGSISVEGFIRIFDPNTKEKFVEKRA* |
Ga0164296_100070715 | 3300013093 | Freshwater | MTQNKQTTQTQAPAKRPNETGSVRVEGFVKIHDPKTKEVFVEKRA* |
Ga0164296_10757803 | 3300013093 | Freshwater | MIENKQPTQPPAKRPNETGSIRVEGFVKIHDPKTKEVFVEKRA* |
Ga0164296_11032372 | 3300013093 | Freshwater | MIENKQPTQTPAKRPNETGSIRVEGFVKIHDPKTKEVFVEKRA* |
Ga0164296_12764312 | 3300013093 | Freshwater | MTETKQTNQNQPLPKRPNETGSIRVEGFVKIHDPKTKEVFVEKRA* |
Ga0164297_101508491 | 3300013094 | Freshwater | KQTNNPPQTLKKPNETGSIRVEGFVKIHDPNTKETFVEKRA* |
Ga0164297_101710912 | 3300013094 | Freshwater | MEKNVQQPTQVNPDVRPKRPNETSAISVEGFVKIFDPKTKETFVEKRA* |
Ga0136641_10004232 | 3300013286 | Freshwater | MNQNTTTNQPQQPQAAQKRPNDTGSISVEGFVRIFDPNTKEKFVEKRA* |
Ga0134315_10201212 | 3300014962 | Surface Water | MTQNTTQQQPKPQEKKPNDAGLISVEGHVRIFDPKTKEVFVEKRA* |
Ga0181350_10586412 | 3300017716 | Freshwater Lake | MMQNTQTNQPQQPAPKPANDTGSISVEGFVKIFDPNTKEKFVEKRA |
Ga0181352_10725912 | 3300017747 | Freshwater Lake | MEKTTQQPVKPQTQSANKRPNETGSISVEGFVKIFDPKSKEVFVEKRA |
Ga0181344_11103512 | 3300017754 | Freshwater Lake | MEQTTQQSVKPQTQSVAKRPNETGSISVEGFVKIFDPKSKEVFVEKRA |
Ga0181344_11712152 | 3300017754 | Freshwater Lake | MTQDTKLPKPAAPAKKPNETGSISVEGHVRIFDPKTKEVLVEKRA |
Ga0181344_11750392 | 3300017754 | Freshwater Lake | MEQKSQNKQPPQKPAPKKPNETGSISVEGFVKIYDPKSKEVFVEKRA |
Ga0181344_12081232 | 3300017754 | Freshwater Lake | MEQTSQNKQPLQTPAPKKPNETGSISVEGFVKIHDPKSKEVFVEKRA |
Ga0181344_12316222 | 3300017754 | Freshwater Lake | MSNNTKQPTPTPKRPNETGSISVEGFIKIFDPKTKQVIVEKRA |
Ga0181344_12348532 | 3300017754 | Freshwater Lake | MEKNTQQSVQHKPVAIKPKRPNETSAISVEGFVKIFDPKTKETFVEKRA |
Ga0181558_102032802 | 3300018417 | Salt Marsh | MTQNTTPQQPVTPVNKPQETGSISVEGHIRIFDPKTKEVIVEKRA |
Ga0181563_103658862 | 3300018420 | Salt Marsh | MTQNTKPQQPAQPAKKPQETGTISVEGHIRIFDPKTKEVIVEKRA |
Ga0187842_10153322 | 3300018790 | Freshwater | MEKNTQQPAQPKFAAPKPKRPNETSAISVEGFVKIFDPKTKEIFVEKRA |
Ga0187844_100428792 | 3300018868 | Freshwater | MNQPITTPLSQKPAAKPANDTGSISVEGFIRIFDPNTKEKFV |
Ga0181564_106053382 | 3300018876 | Salt Marsh | MTQSTKPQQPAQPAKKPQETGTISVEGHIRIFDPKTKEVIVEKRA |
Ga0187843_101508031 | 3300019093 | Freshwater | MEKNTQQSAQHKPPAPKPKRPNETSAISVEGFVKIFDPKTKEIFVEKRA |
Ga0187843_102840941 | 3300019093 | Freshwater | MEKNTQQPAQPKSAATKPKRPNETSAISVEGFVKIFDPKTKETFVEKRA |
Ga0181359_10013346 | 3300019784 | Freshwater Lake | MTQNTKSPQPTVPAKKPNETGSISVEGHVRIFDPKTKEVLVEKRA |
Ga0181359_11977352 | 3300019784 | Freshwater Lake | MNQNARPQQPPTPAKKPNETGSISVEGHIRIFDPKTKEVIVEKRA |
Ga0211732_13064702 | 3300020141 | Freshwater | MNQSTRPQQPVPPAKKPNETGSISVEGHIRIFDPKTKEVLVEKRA |
Ga0211736_103935482 | 3300020151 | Freshwater | MNQSTRPPQPPAPAKKPNETGSISVEGHIRIFDPKTKEVIVEKRA |
Ga0211734_110404632 | 3300020159 | Freshwater | MNQSTRPPQPAAPAKKPNETGSISVEGHIRIFDPKTKEVIVEKRA |
Ga0211733_109741142 | 3300020160 | Freshwater | MNQTTRPQPPAPAKNPNETGSISVEGHIRIFDPKTKEVIVEKRA |
Ga0211726_102996812 | 3300020161 | Freshwater | MEKINQQPAKPQTQSAHKRPNETGSISVEGFVRIFDPKTQEIFVEKRA |
Ga0211726_110033602 | 3300020161 | Freshwater | MNEDANVKQQQPDPKQPQKRPNETGSIHVEGFVRIFDPNTQEKFVEQRA |
Ga0211735_113702642 | 3300020162 | Freshwater | MNQPITTPLPQKPADKPANDTGSISVEGFIRIFDPNTKEKFVEKRA |
Ga0206128_100094532 | 3300020166 | Seawater | MNQNTTPQQPVAPAKPPQETGTISVEGHIRIFDPKTKEVIVEKRA |
Ga0206124_101506862 | 3300020175 | Seawater | MNQNTTPQQPVAPAKTPQETGTISVEGHIRIFDPKTKEVIVEKRA |
Ga0206131_100964522 | 3300020185 | Seawater | MTQSTTPQQPVAPATKPQETGTISVEGHIRIFDPKTKEVIVEKRA |
Ga0211731_112893341 | 3300020205 | Freshwater | SMNQSTQPQQPVAPAKKPNETGSISVEGHIRIFDPKTKEVIVEKRA |
Ga0194047_100016712 | 3300021354 | Anoxic Zone Freshwater | MTQNTTPTQQPANTPAQKKPNETGSISVEGHVRIFDPKTKEVYVEKRA |
Ga0194048_100745273 | 3300021519 | Anoxic Zone Freshwater | MTENKQPTQTQASTKRPNETGSIRVEGFVQIYDPKTKEVFVEKRA |
Ga0194048_103436502 | 3300021519 | Anoxic Zone Freshwater | MEQTSQNKQPAQTPAPKRPNETGSISVEGFVKIYDPKSKEVFVEKRA |
Ga0222714_1000004914 | 3300021961 | Estuarine Water | MTQNTKPQQPVVPAKKPQENGTFSVEGHIRIFDPKTKEVIVEKRA |
Ga0222714_104080162 | 3300021961 | Estuarine Water | MEQTNQNKQPLQTPAPKRPNETGSISVEGFVKIYDPKSKEVFVEKRA |
Ga0212088_108533922 | 3300022555 | Freshwater Lake Hypolimnion | MEKNVQQPTKVNPSARPKRPNETSAISVEGFVKIFDPKTKETFVEKRA |
Ga0236341_10098982 | 3300022591 | Freshwater | MEKNVQQPTQVNPGNRPKRPNETSAISVEGFVKIFDPKTKETFVEKRA |
Ga0248169_10100813 | 3300022602 | Freshwater | MTQNNIPKQSQPAAPAPKRPNERGTISVEGFVKIFDPKTKEKFVEKRA |
Ga0248169_1015453 | 3300022602 | Freshwater | MTQNKQTTQTQAPAKRPNETGSVRVEGFVKIHDPKTKEVFVEKRA |
Ga0248169_1058323 | 3300022602 | Freshwater | MIENKQPTQTPAKRPNETGSIRVEGFVKIHDPKTKEVFVEKRA |
Ga0248169_1229822 | 3300022602 | Freshwater | MTENKQTNNPPQTPKKPNETGSIRVEGFVKIHDPNTKETFVEKRA |
Ga0214921_10000016197 | 3300023174 | Freshwater | MEKTAQQPAQNKPAAPKPKRPNETSAISVEGFVKIFDPNTKETFVEKRA |
Ga0214921_10000312115 | 3300023174 | Freshwater | MMQTNTQPKTPEPKPGSKRPNETGSISVEGFVKIFDPKTREIFVEKRA |
Ga0214919_100015162 | 3300023184 | Freshwater | MEKNAQQPVQLKPTAPKPKRPNETSAIAVEGFVKIFDPKTKETFVEKRA |
Ga0210003_10201284 | 3300024262 | Deep Subsurface | MTQSTTPQQPVAPAKKPQETGTISVEGHIRIFDPKTKEVIVEKRA |
Ga0208504_10208402 | 3300025358 | Freshwater | MENNKQPVPQVKPATPPKRPNETGSVRVEGFLKIFDPNTQEKFVEKRA |
Ga0208378_10222022 | 3300025407 | Freshwater | MTQNKQTTQTQTPAKRPNETGSVRVEGFVKIYDPKTKEV |
Ga0208253_10351352 | 3300025418 | Freshwater | MTQNKQTTQTQTPAKRPNETGSVRVEGFVKIYDPKTKEVFVEKRA |
Ga0208744_10688122 | 3300025450 | Freshwater | MTENKQTNNTPQPPKKPNETGSIRVEGFVKIHDPKTKEIFVEKRA |
Ga0208864_11204542 | 3300025578 | Freshwater | MTENKQPTQTQTSTKRPNETGSIQVEGFVRIHDPKTKEVFVEKRA |
Ga0208546_11196472 | 3300025585 | Aqueous | MTQNTTQQPVQPAPKKPNETGSISVEGFVKIFDPKTKETFVEKRA |
Ga0208147_10004772 | 3300025635 | Aqueous | MSQNNDQNKTAEPTPEPAPKRPNETGSISVEGFVRIFDPKSKEVYVEKRA |
Ga0208783_101312572 | 3300025872 | Aqueous | MSQNNDQNKTAEPTPEPAPKRPNETGSISVEGFVRIFDPKSKEVYVEK |
Ga0209188_10294683 | 3300027708 | Freshwater Lake | MEKNTQQPAQTKPVATKPKRPNETSAISVEGFVKIFDPNTKEKFVEKRA |
Ga0209188_13062742 | 3300027708 | Freshwater Lake | MTDNTKQPTPAPKRPNETGSISVEGFVKIFDPKTKQVYVEKRA |
Ga0209492_10453093 | 3300027721 | Freshwater Sediment | MTENTTQKQQAPQQPASKKPNDTGSISVEGFVRIFDPETKEVFVEKRA |
(restricted) Ga0247833_11420722 | 3300027730 | Freshwater | MNQSTRPQQPAPPAKKPNETGSISVEGHIRIFDPKTKEVLVEKRA |
Ga0209297_10691602 | 3300027733 | Freshwater Lake | MNQSARPQQPPTPAKKPTETGSISVEGHIRIFDPKTKEVIVEKRA |
Ga0209087_10312631 | 3300027734 | Freshwater Lake | MEKNTQQPAQIKPVAKPKRPNETGAISVEGFLKIFDPKTKETFVEKRA |
Ga0209087_11057852 | 3300027734 | Freshwater Lake | MEKNTQQPAQTKPVAKPKRPNETGAISVEGFVKIFDPKTKETFVEKRA |
Ga0209190_10118052 | 3300027736 | Freshwater Lake | MEKNTQQPAQHKPAATKPKRPNETSAIAVEGFVKIFDPKTKETFVEKRA |
Ga0209190_10990313 | 3300027736 | Freshwater Lake | MTQNAIPQQPAAPAKKPQETGTISVEGHIRIFDPKTKEVIVEKRA |
Ga0209085_10163312 | 3300027741 | Freshwater Lake | MEKNTQQSAQQKPTATKPKRPNETSAISVEGFVKIFDPKTKETFVEKRA |
Ga0209085_12603191 | 3300027741 | Freshwater Lake | MEKNAQQPAQKKPAAPKPKRPNETGAVSVEGFVKIFDPNTKEKFVEKRA |
Ga0209597_10550142 | 3300027746 | Freshwater Lake | MTQNTIPAQQPANTPAQKKPNETGSISVEGHVRIFDPKTKEVYVEKRA |
Ga0209189_10875203 | 3300027747 | Freshwater Lake | MEKNTQQPAQIKPVATKPKPKRPNETGAVSVEGFVKIFDPNTKEKFVEKRA |
Ga0209189_11246152 | 3300027747 | Freshwater Lake | MTQNTAQSAPNTTPVAKRPNETGSISVEGFVKIFDPNTKEKFVEKRA |
Ga0209296_100029710 | 3300027759 | Freshwater Lake | MEKNTQQSAQQKPPATKPKRPNETSAIAVEGFVKIFDPKTKETFVEKRA |
Ga0209296_10246934 | 3300027759 | Freshwater Lake | MEKITQQPAQHKPAAPKPKRPNETSAISVEGFVKIFDPNTKETFVEKRA |
Ga0209229_103723082 | 3300027805 | Freshwater And Sediment | MTQKNTQNQPMAQPNKKKPNENGVINVEGFVKIFDPKSKEVYVEKRA |
Ga0209354_102455122 | 3300027808 | Freshwater Lake | MNQSARPQQPPTPAKKPNETGSISVEGHIRIFDPKTKEVIVEKRA |
Ga0209777_100065122 | 3300027896 | Freshwater Lake Sediment | MTQNNIPKQSQPAAPTPKRPNERGTISVEGFVKIFDPKTKEKFVEKRA |
Ga0209777_105872082 | 3300027896 | Freshwater Lake Sediment | MEKNAQQPTQVKPVAGPKRPNETGAVSVEGFVKIFDPKTKETFVEKRA |
Ga0209777_109153202 | 3300027896 | Freshwater Lake Sediment | QPINTNQPQKTAPKPANDTGSISVEGFIRIFDPNTKEKFVEKRA |
Ga0209253_105889651 | 3300027900 | Freshwater Lake Sediment | MTQKDQQKPTNTTPSAPKRPNETGSISVEGFVKIFDPKTQETFVEKRA |
Ga0209400_10447612 | 3300027963 | Freshwater Lake | MNQSTQPQQPAQPAKKPNETGSISVEGHIRIFDPTTKEVIVEKRA |
Ga0209400_10452953 | 3300027963 | Freshwater Lake | MEKNTQQPAQTKPVATKPKRPKRPNETGAVSVEGFVKIFDPNTKEKFVEKRA |
Ga0209400_11660932 | 3300027963 | Freshwater Lake | MEKNTQQSAQHKPAATKPKRPNETSAISVEGFVKIFDPKTKETFVEKRA |
Ga0209191_13008751 | 3300027969 | Freshwater Lake | MEKNTQQPAQIKPVAKPKRPNETGAISVEGFLKIFDPKTKETFVEKRAXFNQAWQKLKGL |
Ga0209702_1000054313 | 3300027976 | Freshwater | MNQNTTPQQPAVPAKKPQETGTISVEGHIRIFDPKTKEVIVEKRA |
Ga0307375_108594432 | 3300031669 | Soil | TTPQQPVAPATKPQETGTISVEGHIRIFDPKTKEVIVEKRA |
Ga0316219_10226362 | 3300031759 | Freshwater | MIQNTNNQPTKPVVVPAPKRPNDTGSISVQGHIRIFDPQTQTTFVEKSA |
Ga0315909_103291472 | 3300031857 | Freshwater | MTQKDQQKTPLPQNNNAKRPNETGSISVEGFVKIFDPATKETFVEKRA |
Ga0315909_103717652 | 3300031857 | Freshwater | MQKMNQQPATPQAQSAPKRPNETGSISVEGFVRIFDPKTKEIFVEKRA |
Ga0315909_109627842 | 3300031857 | Freshwater | MEKTTQQPVNQQTGAKRPNETGSISVEGFVKIFDPKSKEVFVEKRAXFSLAFVKFKVSSK |
Ga0315904_103033493 | 3300031951 | Freshwater | MEKTTQQPVTQQTSAKRPNETGSISVEGFVRIFDPKTQEIFVEKRA |
Ga0315904_111791501 | 3300031951 | Freshwater | MEKTTQQPLNQQTGAKRPNETGSISVEGFVKIFDPKSKEVFVEKRA |
Ga0316226_10476682 | 3300032562 | Freshwater | MEKNVQQPTQVNPDVRPKRPNETSAISVEGFVKIFDPKTKETFVEKRA |
Ga0316232_10641403 | 3300032605 | Freshwater | MTENKQTNNPPQTLKKPNETGSIRVEGFVKIHDPNTKETFVEKRA |
Ga0316616_1049220852 | 3300033521 | Soil | MTQNTQQQPVNPAPKRPNDTGSISVEGHVRIFDPKTKETFVEKRA |
Ga0335002_0387478_1_135 | 3300034020 | Freshwater | MNQPITTPLPQKPAAKPANDTGSISVEGFIRIFDPNTKEKFVEKR |
Ga0335020_0069641_658_792 | 3300034082 | Freshwater | MTQNTQTNQPQKPKPANDTGSISVEGFVKIFDPNTKEKFVEKRA |
Ga0335020_0460316_3_152 | 3300034082 | Freshwater | MNENATTNQTQIPQNPALKRPNETGSITVEGFVRIFDPNTKEKFVEKRA |
Ga0335029_0199213_1_132 | 3300034102 | Freshwater | QSTQPQQPVAPAKKPNETGSISVEGHIRIFDPKTKEVIVEKRA |
Ga0335029_0638576_1_108 | 3300034102 | Freshwater | MTQNAIPQQTAAPAKKPQETGTISVEGHIRIFDPKT |
Ga0335033_0580732_2_133 | 3300034117 | Freshwater | MNQSTQPQQPVAPAKKPNETGSISVEGHIRIFDPKTKEVIVEKR |
Ga0335058_0105115_1525_1650 | 3300034121 | Freshwater | TTPLPQKPAAKPANDTGSISVEGFIRIFDPNTKEKFVEKRA |
Ga0335049_0777209_449_568 | 3300034272 | Freshwater | MNQSTQPQQPVAPAKKPNETGSISVEGHIRIFDPKTKEVI |
Ga0335013_0862409_329_466 | 3300034284 | Freshwater | MTQNAIPQQTAAPAKKPQETGTISVEGHIRIFDPKTKEVIVEKRA |
⦗Top⦘ |