Basic Information | |
---|---|
Family ID | F023626 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 209 |
Average Sequence Length | 47 residues |
Representative Sequence | MTLALVGVAAVVFSILLGVVHTVSERRQQRRIQQQWEERERSLNRKP |
Number of Associated Samples | 177 |
Number of Associated Scaffolds | 209 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 38.94 % |
% of genes near scaffold ends (potentially truncated) | 26.32 % |
% of genes from short scaffolds (< 2000 bps) | 68.42 % |
Associated GOLD sequencing projects | 167 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.51 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (83.254 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (11.962 % of family members) |
Environment Ontology (ENVO) | Unclassified (27.751 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (34.928 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 57.33% β-sheet: 0.00% Coil/Unstructured: 42.67% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 209 Family Scaffolds |
---|---|---|
PF00378 | ECH_1 | 27.75 |
PF02515 | CoA_transf_3 | 20.10 |
PF00072 | Response_reg | 9.57 |
PF14026 | DUF4242 | 3.35 |
PF01242 | PTPS | 2.87 |
PF13579 | Glyco_trans_4_4 | 2.39 |
PF02518 | HATPase_c | 2.39 |
PF16113 | ECH_2 | 1.91 |
PF09587 | PGA_cap | 1.44 |
PF00149 | Metallophos | 0.96 |
PF00589 | Phage_integrase | 0.96 |
PF04392 | ABC_sub_bind | 0.48 |
PF02275 | CBAH | 0.48 |
PF02754 | CCG | 0.48 |
PF01227 | GTP_cyclohydroI | 0.48 |
PF02630 | SCO1-SenC | 0.48 |
PF01521 | Fe-S_biosyn | 0.48 |
PF06305 | LapA_dom | 0.48 |
PF04016 | DUF364 | 0.48 |
PF12007 | DUF3501 | 0.48 |
PF13531 | SBP_bac_11 | 0.48 |
PF06181 | Urate_ox_N | 0.48 |
PF14361 | RsbRD_N | 0.48 |
PF02597 | ThiS | 0.48 |
PF13365 | Trypsin_2 | 0.48 |
PF13534 | Fer4_17 | 0.48 |
COG ID | Name | Functional Category | % Frequency in 209 Family Scaffolds |
---|---|---|---|
COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 20.10 |
COG0720 | 6-pyruvoyl-tetrahydropterin synthase | Coenzyme transport and metabolism [H] | 2.87 |
COG1977 | Molybdopterin synthase sulfur carrier subunit MoaD | Coenzyme transport and metabolism [H] | 0.48 |
COG1999 | Cytochrome oxidase Cu insertion factor, SCO1/SenC/PrrC family | Posttranslational modification, protein turnover, chaperones [O] | 0.48 |
COG2014 | Uncharacterized conserved protein, contains DUF4213 and DUF364 domains | Function unknown [S] | 0.48 |
COG2048 | Heterodisulfide reductase, subunit B | Energy production and conversion [C] | 0.48 |
COG2104 | Sulfur carrier protein ThiS (thiamine biosynthesis) | Coenzyme transport and metabolism [H] | 0.48 |
COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.48 |
COG3049 | Penicillin V acylase or related amidase, Ntn superfamily | Cell wall/membrane/envelope biogenesis [M] | 0.48 |
COG3748 | Uncharacterized membrane protein | Function unknown [S] | 0.48 |
COG3771 | Lipopolysaccharide assembly protein YciS/LapA, DUF1049 family | Cell wall/membrane/envelope biogenesis [M] | 0.48 |
COG4841 | Uncharacterized conserved protein YneR, related to HesB/YadR/YfhF family | Function unknown [S] | 0.48 |
COG4927 | Predicted choloylglycine hydrolase | General function prediction only [R] | 0.48 |
COG0247 | Fe-S cluster-containing oxidoreductase, includes glycolate oxidase subunit GlcF | Energy production and conversion [C] | 0.48 |
COG0316 | Fe-S cluster assembly iron-binding protein IscA | Posttranslational modification, protein turnover, chaperones [O] | 0.48 |
COG1225 | Peroxiredoxin | Posttranslational modification, protein turnover, chaperones [O] | 0.48 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 83.25 % |
Unclassified | root | N/A | 16.75 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2067725003|GPWSG_F5G3JLY01CIP7W | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 509 | Open in IMG/M |
2170459017|G14TP7Y01DC1PC | Not Available | 688 | Open in IMG/M |
3300000443|F12B_10536241 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 788 | Open in IMG/M |
3300000891|JGI10214J12806_13294506 | Not Available | 502 | Open in IMG/M |
3300002122|C687J26623_10013226 | All Organisms → cellular organisms → Bacteria | 2103 | Open in IMG/M |
3300002245|JGIcombinedJ26739_101617930 | Not Available | 545 | Open in IMG/M |
3300003319|soilL2_10086216 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae → unclassified Gemmataceae → Gemmataceae bacterium | 1663 | Open in IMG/M |
3300003347|JGI26128J50194_1002794 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1148 | Open in IMG/M |
3300003911|JGI25405J52794_10016232 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1469 | Open in IMG/M |
3300004013|Ga0055465_10213250 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
3300004020|Ga0055440_10077881 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
3300004052|Ga0055490_10006976 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium | 2279 | Open in IMG/M |
3300004114|Ga0062593_100803087 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 936 | Open in IMG/M |
3300004479|Ga0062595_100916122 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
3300005183|Ga0068993_10002455 | All Organisms → cellular organisms → Bacteria | 3336 | Open in IMG/M |
3300005204|Ga0068997_10010446 | All Organisms → cellular organisms → Bacteria | 1340 | Open in IMG/M |
3300005294|Ga0065705_10322891 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1007 | Open in IMG/M |
3300005295|Ga0065707_10755949 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
3300005328|Ga0070676_10017421 | All Organisms → cellular organisms → Bacteria | 3977 | Open in IMG/M |
3300005332|Ga0066388_100204516 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 2597 | Open in IMG/M |
3300005332|Ga0066388_100523880 | All Organisms → cellular organisms → Bacteria | 1818 | Open in IMG/M |
3300005333|Ga0070677_10031367 | All Organisms → cellular organisms → Bacteria | 2031 | Open in IMG/M |
3300005338|Ga0068868_100041679 | All Organisms → cellular organisms → Bacteria | 3578 | Open in IMG/M |
3300005341|Ga0070691_10050853 | All Organisms → cellular organisms → Bacteria | 1978 | Open in IMG/M |
3300005406|Ga0070703_10070918 | All Organisms → cellular organisms → Bacteria | 1164 | Open in IMG/M |
3300005434|Ga0070709_10210799 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1381 | Open in IMG/M |
3300005439|Ga0070711_100737106 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
3300005440|Ga0070705_100060698 | All Organisms → cellular organisms → Bacteria | 2243 | Open in IMG/M |
3300005440|Ga0070705_100399039 | All Organisms → cellular organisms → Bacteria | 1018 | Open in IMG/M |
3300005440|Ga0070705_101884250 | Not Available | 508 | Open in IMG/M |
3300005444|Ga0070694_100827511 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 761 | Open in IMG/M |
3300005445|Ga0070708_100004134 | All Organisms → cellular organisms → Bacteria | 11389 | Open in IMG/M |
3300005445|Ga0070708_100072437 | All Organisms → cellular organisms → Bacteria | 3104 | Open in IMG/M |
3300005471|Ga0070698_100084148 | All Organisms → cellular organisms → Bacteria | 3169 | Open in IMG/M |
3300005471|Ga0070698_100353340 | All Organisms → cellular organisms → Bacteria | 1401 | Open in IMG/M |
3300005529|Ga0070741_10000270 | All Organisms → cellular organisms → Bacteria | 197268 | Open in IMG/M |
3300005530|Ga0070679_100442683 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1244 | Open in IMG/M |
3300005543|Ga0070672_100007971 | All Organisms → cellular organisms → Bacteria | 7237 | Open in IMG/M |
3300005546|Ga0070696_100854409 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
3300005546|Ga0070696_101662280 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
3300005713|Ga0066905_100057769 | All Organisms → cellular organisms → Bacteria | 2419 | Open in IMG/M |
3300005876|Ga0075300_1000101 | All Organisms → cellular organisms → Bacteria | 3465 | Open in IMG/M |
3300005878|Ga0075297_1000496 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2283 | Open in IMG/M |
3300006041|Ga0075023_100103920 | Not Available | 987 | Open in IMG/M |
3300006237|Ga0097621_101179949 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 721 | Open in IMG/M |
3300006755|Ga0079222_10430700 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 933 | Open in IMG/M |
3300006804|Ga0079221_10410975 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 843 | Open in IMG/M |
3300006806|Ga0079220_10127018 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1369 | Open in IMG/M |
3300006806|Ga0079220_10507913 | Not Available | 826 | Open in IMG/M |
3300006845|Ga0075421_102071028 | Not Available | 604 | Open in IMG/M |
3300006852|Ga0075433_10006725 | All Organisms → cellular organisms → Bacteria | 9106 | Open in IMG/M |
3300006852|Ga0075433_11550988 | Not Available | 572 | Open in IMG/M |
3300006854|Ga0075425_100316883 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1795 | Open in IMG/M |
3300006914|Ga0075436_100428225 | All Organisms → cellular organisms → Bacteria | 961 | Open in IMG/M |
3300006954|Ga0079219_10228633 | Not Available | 1084 | Open in IMG/M |
3300007255|Ga0099791_10527708 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
3300007265|Ga0099794_10420514 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
3300009038|Ga0099829_10000476 | All Organisms → cellular organisms → Bacteria | 21355 | Open in IMG/M |
3300009038|Ga0099829_10867713 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 749 | Open in IMG/M |
3300009053|Ga0105095_10475143 | Not Available | 692 | Open in IMG/M |
3300009088|Ga0099830_10017873 | All Organisms → cellular organisms → Bacteria | 4548 | Open in IMG/M |
3300009088|Ga0099830_10542840 | All Organisms → cellular organisms → Bacteria | 951 | Open in IMG/M |
3300009089|Ga0099828_11841083 | Not Available | 531 | Open in IMG/M |
3300009089|Ga0099828_11917030 | Not Available | 520 | Open in IMG/M |
3300009090|Ga0099827_10340473 | All Organisms → cellular organisms → Bacteria | 1274 | Open in IMG/M |
3300009147|Ga0114129_10059805 | All Organisms → cellular organisms → Bacteria | 5327 | Open in IMG/M |
3300009148|Ga0105243_12203632 | Not Available | 588 | Open in IMG/M |
3300009805|Ga0105079_1043656 | Not Available | 517 | Open in IMG/M |
3300009812|Ga0105067_1012218 | All Organisms → cellular organisms → Bacteria | 1111 | Open in IMG/M |
3300009820|Ga0105085_1009312 | All Organisms → cellular organisms → Bacteria | 1684 | Open in IMG/M |
3300010359|Ga0126376_11297512 | Not Available | 748 | Open in IMG/M |
3300010360|Ga0126372_10091464 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 2254 | Open in IMG/M |
3300010391|Ga0136847_11341002 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
3300011395|Ga0137315_1018482 | All Organisms → cellular organisms → Bacteria | 895 | Open in IMG/M |
3300011406|Ga0137454_1007101 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1209 | Open in IMG/M |
3300011419|Ga0137446_1007163 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2015 | Open in IMG/M |
3300011424|Ga0137439_1145618 | Not Available | 549 | Open in IMG/M |
3300011425|Ga0137441_1054488 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 911 | Open in IMG/M |
3300012040|Ga0137461_1116930 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
3300012096|Ga0137389_10031077 | All Organisms → cellular organisms → Bacteria | 3875 | Open in IMG/M |
3300012134|Ga0137330_1009888 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1063 | Open in IMG/M |
3300012205|Ga0137362_10032278 | All Organisms → cellular organisms → Bacteria | 4162 | Open in IMG/M |
3300012208|Ga0137376_10356463 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1270 | Open in IMG/M |
3300012210|Ga0137378_10569785 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1041 | Open in IMG/M |
3300012360|Ga0137375_10163769 | All Organisms → cellular organisms → Bacteria | 2155 | Open in IMG/M |
3300012582|Ga0137358_10652135 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
3300012685|Ga0137397_10070518 | All Organisms → cellular organisms → Bacteria | 2528 | Open in IMG/M |
3300012898|Ga0157293_10019917 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1232 | Open in IMG/M |
3300012925|Ga0137419_10048401 | All Organisms → cellular organisms → Bacteria | 2728 | Open in IMG/M |
3300012927|Ga0137416_10193518 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1627 | Open in IMG/M |
3300012931|Ga0153915_10072554 | All Organisms → cellular organisms → Bacteria | 3587 | Open in IMG/M |
3300012931|Ga0153915_10194208 | All Organisms → cellular organisms → Bacteria | 2224 | Open in IMG/M |
3300012944|Ga0137410_10021502 | All Organisms → cellular organisms → Bacteria | 4446 | Open in IMG/M |
3300012960|Ga0164301_10024095 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2784 | Open in IMG/M |
3300012960|Ga0164301_11008357 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 655 | Open in IMG/M |
3300014877|Ga0180074_1006274 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2106 | Open in IMG/M |
3300014881|Ga0180094_1083098 | Not Available | 721 | Open in IMG/M |
3300015170|Ga0120098_1008155 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1094 | Open in IMG/M |
3300015371|Ga0132258_12951199 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1180 | Open in IMG/M |
3300015373|Ga0132257_104629942 | Not Available | 501 | Open in IMG/M |
3300017792|Ga0163161_11472122 | Not Available | 597 | Open in IMG/M |
3300017930|Ga0187825_10016602 | All Organisms → cellular organisms → Bacteria | 2460 | Open in IMG/M |
3300017936|Ga0187821_10110218 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1020 | Open in IMG/M |
3300017939|Ga0187775_10192627 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 752 | Open in IMG/M |
3300017966|Ga0187776_10015972 | All Organisms → cellular organisms → Bacteria | 4075 | Open in IMG/M |
3300017997|Ga0184610_1002642 | All Organisms → cellular organisms → Bacteria | 4071 | Open in IMG/M |
3300017997|Ga0184610_1037505 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1387 | Open in IMG/M |
3300018000|Ga0184604_10000480 | All Organisms → cellular organisms → Bacteria | 4444 | Open in IMG/M |
3300018027|Ga0184605_10107480 | All Organisms → cellular organisms → Bacteria | 1235 | Open in IMG/M |
3300018031|Ga0184634_10065507 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1534 | Open in IMG/M |
3300018031|Ga0184634_10157312 | Not Available | 1022 | Open in IMG/M |
3300018053|Ga0184626_10006885 | All Organisms → cellular organisms → Bacteria | 4367 | Open in IMG/M |
3300018061|Ga0184619_10029771 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2294 | Open in IMG/M |
3300018063|Ga0184637_10049243 | All Organisms → cellular organisms → Bacteria | 2569 | Open in IMG/M |
3300018079|Ga0184627_10353896 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
3300018084|Ga0184629_10439487 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 684 | Open in IMG/M |
3300018422|Ga0190265_10087901 | All Organisms → cellular organisms → Bacteria | 2869 | Open in IMG/M |
3300018422|Ga0190265_10104599 | All Organisms → cellular organisms → Bacteria | 2664 | Open in IMG/M |
3300018429|Ga0190272_10054108 | All Organisms → cellular organisms → Bacteria | 2342 | Open in IMG/M |
3300019249|Ga0184648_1393557 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
3300019255|Ga0184643_1496695 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1066 | Open in IMG/M |
3300019458|Ga0187892_10001910 | All Organisms → cellular organisms → Bacteria | 44865 | Open in IMG/M |
3300019458|Ga0187892_10008123 | All Organisms → cellular organisms → Bacteria | 14534 | Open in IMG/M |
3300019881|Ga0193707_1175313 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 573 | Open in IMG/M |
3300019882|Ga0193713_1090727 | All Organisms → cellular organisms → Bacteria | 856 | Open in IMG/M |
3300020021|Ga0193726_1057187 | All Organisms → cellular organisms → Bacteria | 1844 | Open in IMG/M |
3300020579|Ga0210407_10632913 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 832 | Open in IMG/M |
3300020579|Ga0210407_10841075 | All Organisms → cellular organisms → Bacteria → FCB group → Fibrobacteres → unclassified Fibrobacterota → Fibrobacterota bacterium | 706 | Open in IMG/M |
3300021086|Ga0179596_10143042 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1131 | Open in IMG/M |
3300021170|Ga0210400_10020483 | All Organisms → cellular organisms → Bacteria | 5172 | Open in IMG/M |
3300021478|Ga0210402_11492571 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 603 | Open in IMG/M |
3300021478|Ga0210402_11800271 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
3300022892|Ga0247753_1045212 | Not Available | 555 | Open in IMG/M |
3300023057|Ga0247797_1068431 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 528 | Open in IMG/M |
3300025535|Ga0207423_1008482 | All Organisms → cellular organisms → Bacteria | 1565 | Open in IMG/M |
3300025567|Ga0210076_1067616 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
3300025580|Ga0210138_1022571 | Not Available | 1339 | Open in IMG/M |
3300025885|Ga0207653_10390058 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 546 | Open in IMG/M |
3300025906|Ga0207699_10143436 | Not Available | 1572 | Open in IMG/M |
3300025910|Ga0207684_10024166 | All Organisms → cellular organisms → Bacteria | 5184 | Open in IMG/M |
3300025910|Ga0207684_10025180 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 5071 | Open in IMG/M |
3300025910|Ga0207684_10060451 | All Organisms → cellular organisms → Bacteria | 3218 | Open in IMG/M |
3300025910|Ga0207684_10480875 | Not Available | 1065 | Open in IMG/M |
3300025924|Ga0207694_11432025 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 584 | Open in IMG/M |
3300025955|Ga0210071_1019014 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 839 | Open in IMG/M |
3300026001|Ga0208000_103329 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 893 | Open in IMG/M |
3300026285|Ga0209438_1009789 | All Organisms → cellular organisms → Bacteria | 3232 | Open in IMG/M |
3300026304|Ga0209240_1024174 | All Organisms → cellular organisms → Bacteria | 2326 | Open in IMG/M |
3300026345|Ga0257148_1005137 | Not Available | 922 | Open in IMG/M |
3300026360|Ga0257173_1010848 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1039 | Open in IMG/M |
3300026377|Ga0257171_1010044 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1539 | Open in IMG/M |
3300026446|Ga0257178_1000758 | All Organisms → cellular organisms → Bacteria | 2324 | Open in IMG/M |
3300026499|Ga0257181_1000803 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2541 | Open in IMG/M |
3300026514|Ga0257168_1128566 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 564 | Open in IMG/M |
3300026515|Ga0257158_1021095 | Not Available | 1095 | Open in IMG/M |
3300026535|Ga0256867_10149341 | All Organisms → cellular organisms → Bacteria | 876 | Open in IMG/M |
3300026818|Ga0207634_105271 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 527 | Open in IMG/M |
3300027187|Ga0209869_1047507 | Not Available | 506 | Open in IMG/M |
3300027252|Ga0209973_1016259 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 947 | Open in IMG/M |
3300027484|Ga0207458_1006589 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 607 | Open in IMG/M |
3300027645|Ga0209117_1002249 | All Organisms → cellular organisms → Bacteria | 6725 | Open in IMG/M |
3300027650|Ga0256866_1046440 | Not Available | 1147 | Open in IMG/M |
3300027651|Ga0209217_1023301 | Not Available | 1973 | Open in IMG/M |
3300027787|Ga0209074_10113080 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 933 | Open in IMG/M |
3300027815|Ga0209726_10350952 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
3300027862|Ga0209701_10176758 | All Organisms → cellular organisms → Bacteria | 1287 | Open in IMG/M |
3300027873|Ga0209814_10110222 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1171 | Open in IMG/M |
3300027894|Ga0209068_10154827 | Not Available | 1242 | Open in IMG/M |
3300027903|Ga0209488_10760620 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 690 | Open in IMG/M |
3300027903|Ga0209488_10820737 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
3300027915|Ga0209069_10078095 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1579 | Open in IMG/M |
3300027954|Ga0209859_1048519 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
3300028047|Ga0209526_10038919 | All Organisms → cellular organisms → Bacteria | 3345 | Open in IMG/M |
3300028380|Ga0268265_10034920 | All Organisms → cellular organisms → Bacteria | 3669 | Open in IMG/M |
3300028536|Ga0137415_10012442 | All Organisms → cellular organisms → Bacteria | 8432 | Open in IMG/M |
3300028536|Ga0137415_10423018 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1137 | Open in IMG/M |
3300028673|Ga0257175_1026186 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 993 | Open in IMG/M |
3300028784|Ga0307282_10213180 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 924 | Open in IMG/M |
3300028784|Ga0307282_10532176 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
3300028792|Ga0307504_10150070 | Not Available | 790 | Open in IMG/M |
3300028799|Ga0307284_10468888 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 516 | Open in IMG/M |
3300028812|Ga0247825_10479841 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 884 | Open in IMG/M |
3300028828|Ga0307312_10231900 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1191 | Open in IMG/M |
3300030620|Ga0302046_10136877 | All Organisms → cellular organisms → Bacteria | 2008 | Open in IMG/M |
3300031229|Ga0299913_10083382 | All Organisms → cellular organisms → Bacteria | 3104 | Open in IMG/M |
3300031538|Ga0310888_11055480 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 512 | Open in IMG/M |
3300031740|Ga0307468_100494922 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 967 | Open in IMG/M |
3300031740|Ga0307468_101581519 | Not Available | 611 | Open in IMG/M |
3300031820|Ga0307473_10045340 | All Organisms → cellular organisms → Bacteria | 2040 | Open in IMG/M |
3300031820|Ga0307473_10644144 | Not Available | 737 | Open in IMG/M |
3300031949|Ga0214473_10092731 | All Organisms → cellular organisms → Bacteria | 3526 | Open in IMG/M |
3300031962|Ga0307479_10079969 | All Organisms → cellular organisms → Bacteria | 3163 | Open in IMG/M |
3300032174|Ga0307470_10174949 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1343 | Open in IMG/M |
3300032174|Ga0307470_10492246 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
3300032174|Ga0307470_11091849 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
3300032180|Ga0307471_100915530 | All Organisms → cellular organisms → Bacteria | 1044 | Open in IMG/M |
3300032180|Ga0307471_102265963 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
3300032770|Ga0335085_10000666 | All Organisms → cellular organisms → Bacteria | 90701 | Open in IMG/M |
3300032893|Ga0335069_10824463 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1043 | Open in IMG/M |
3300032954|Ga0335083_10002847 | All Organisms → cellular organisms → Bacteria | 22636 | Open in IMG/M |
3300033233|Ga0334722_10475576 | All Organisms → cellular organisms → Bacteria | 898 | Open in IMG/M |
3300033432|Ga0326729_1000861 | All Organisms → cellular organisms → Bacteria | 6742 | Open in IMG/M |
3300033433|Ga0326726_10001152 | All Organisms → cellular organisms → Bacteria | 24559 | Open in IMG/M |
3300033433|Ga0326726_10471129 | All Organisms → cellular organisms → Bacteria | 1199 | Open in IMG/M |
3300033513|Ga0316628_101954906 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 779 | Open in IMG/M |
3300034817|Ga0373948_0015373 | All Organisms → cellular organisms → Bacteria | 1405 | Open in IMG/M |
3300034817|Ga0373948_0134542 | Not Available | 607 | Open in IMG/M |
3300034818|Ga0373950_0151175 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 531 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.96% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 9.57% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.13% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.22% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 5.26% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.78% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 4.31% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 4.31% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.35% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.87% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 2.39% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.91% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.91% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.91% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.44% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.44% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.44% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.44% |
Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 1.44% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.44% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.96% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.96% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.96% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.96% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.96% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.96% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.96% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.96% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.96% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.96% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.96% |
Bio-Ooze | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Bio-Ooze | 0.96% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.96% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.96% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.48% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.48% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 0.48% |
Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.48% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.48% |
Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.48% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.48% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.48% |
Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.48% |
Fossill | Environmental → Terrestrial → Soil → Fossil → Unclassified → Fossill | 0.48% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.48% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.48% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.48% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.48% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.48% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.48% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.48% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.48% |
Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.48% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2067725003 | Soil microbial communities from Great Prairies - Wisconsin, Switchgrass soil | Environmental | Open in IMG/M |
2170459017 | Litter degradation ZMR4 | Engineered | Open in IMG/M |
3300000443 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.2B clc assemly | Environmental | Open in IMG/M |
3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
3300002122 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_2 | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300003319 | Sugarcane bulk soil Sample L2 | Environmental | Open in IMG/M |
3300003347 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM | Host-Associated | Open in IMG/M |
3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
3300004013 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D2 | Environmental | Open in IMG/M |
3300004020 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleC_D2 | Environmental | Open in IMG/M |
3300004052 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D2 | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300005183 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1 | Environmental | Open in IMG/M |
3300005204 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D2 | Environmental | Open in IMG/M |
3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Host-Associated | Open in IMG/M |
3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005876 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_401 | Environmental | Open in IMG/M |
3300005878 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_104 | Environmental | Open in IMG/M |
3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009053 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009805 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_0_10 | Environmental | Open in IMG/M |
3300009812 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_50_60 | Environmental | Open in IMG/M |
3300009820 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_50_60 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
3300011395 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT200_2 | Environmental | Open in IMG/M |
3300011406 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT539_2 | Environmental | Open in IMG/M |
3300011419 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT357_2 | Environmental | Open in IMG/M |
3300011424 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT200_2 | Environmental | Open in IMG/M |
3300011425 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT244_2 | Environmental | Open in IMG/M |
3300012040 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT746_2 | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012134 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT142_2 | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012898 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1 | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300014877 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT366_16_10D | Environmental | Open in IMG/M |
3300014881 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_1Da | Environmental | Open in IMG/M |
3300015170 | Fossil microbial communities from human bone sample from Teposcolula Yucundaa, Mexico - TP48 | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
3300017939 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG | Environmental | Open in IMG/M |
3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
3300018000 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex | Environmental | Open in IMG/M |
3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
3300018079 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1 | Environmental | Open in IMG/M |
3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
3300019249 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019255 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019458 | Bio-ooze microbial communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-3 metaG | Environmental | Open in IMG/M |
3300019881 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2 | Environmental | Open in IMG/M |
3300019882 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2 | Environmental | Open in IMG/M |
3300020021 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1 | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300022892 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S169-409R-5 | Environmental | Open in IMG/M |
3300023057 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S136-409B-6 | Environmental | Open in IMG/M |
3300025535 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D1 (SPAdes) | Environmental | Open in IMG/M |
3300025567 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025580 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1 (SPAdes) | Environmental | Open in IMG/M |
3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025955 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D2 (SPAdes) | Environmental | Open in IMG/M |
3300026001 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_104 (SPAdes) | Environmental | Open in IMG/M |
3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
3300026345 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-14-A | Environmental | Open in IMG/M |
3300026360 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-B | Environmental | Open in IMG/M |
3300026377 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-B | Environmental | Open in IMG/M |
3300026446 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-B | Environmental | Open in IMG/M |
3300026499 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-B | Environmental | Open in IMG/M |
3300026514 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-B | Environmental | Open in IMG/M |
3300026515 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-A | Environmental | Open in IMG/M |
3300026535 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (HiSeq) | Environmental | Open in IMG/M |
3300026818 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G05A2-11 (SPAdes) | Environmental | Open in IMG/M |
3300027187 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_50_60 (SPAdes) | Environmental | Open in IMG/M |
3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) | Host-Associated | Open in IMG/M |
3300027484 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G09.2A1-12 (SPAdes) | Environmental | Open in IMG/M |
3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027650 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 HiSeq | Environmental | Open in IMG/M |
3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
3300027815 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m (SPAdes) | Environmental | Open in IMG/M |
3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
3300027954 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_50_60 (SPAdes) | Environmental | Open in IMG/M |
3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300028673 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-B | Environmental | Open in IMG/M |
3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
3300028812 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48 | Environmental | Open in IMG/M |
3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
3300030620 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111 | Environmental | Open in IMG/M |
3300031229 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 | Environmental | Open in IMG/M |
3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
3300033432 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF6AY SIP fraction | Environmental | Open in IMG/M |
3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Host-Associated | Open in IMG/M |
3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
GPWSG_02954620 | 2067725003 | Soil | MTFALVGIAAVVFSILFGVVHTVSERRQQRRMQAQWEERERALNRKP |
4ZMR_03986820 | 2170459017 | Switchgrass, Maize And Mischanthus Litter | MTAILLGAGVVVFGILYGVVHTVSQRRQQRRVREQWEERERSLNRKP |
F12B_105362412 | 3300000443 | Soil | MTLALLVVAGVTFSLLFGLIHKMSERRTKRRLQQQWEERERALNRRA* |
JGI10214J12806_132945062 | 3300000891 | Soil | MTLALVGIAAVVFTVLAGTVHTVWNKRQQRRTREQWEERERLLNRKP* |
C687J26623_100132261 | 3300002122 | Soil | MTWALVGIAAVVFAVLAGAVHTVWERRRQRRAREQWEERERL |
JGIcombinedJ26739_1016179301 | 3300002245 | Forest Soil | PPVPPVTLALFGIAAVVFSVLLGVVHTVSERRQQRRIQQQWEERERSLNRKP* |
soilL2_100862163 | 3300003319 | Sugarcane Root And Bulk Soil | MTVTLALVGIAAVVFTLLFGLVHTVSERRQQRRMQQQWEERERSLNRKP* |
JGI26128J50194_10027942 | 3300003347 | Arabidopsis Thaliana Rhizosphere | MTLALLVVAGVTFSLLFGLVHKVSERRTKRRLQQQWEERERALNRRA* |
JGI25405J52794_100162322 | 3300003911 | Tabebuia Heterophylla Rhizosphere | MLALLCVAAVTFSLLFGLVHKVSERRSKRRLQQQWEERERALNRRA* |
Ga0055465_102132502 | 3300004013 | Natural And Restored Wetlands | VTLALVGLAAVVFTALVGVVHTITERRRLRRTQQQWEERERLLNRKP* |
Ga0055440_100778812 | 3300004020 | Natural And Restored Wetlands | MTLALVGLAAVVFTALVGVVHTVTERRRRRRTQQQWEERERLLN |
Ga0055490_100069762 | 3300004052 | Natural And Restored Wetlands | MTLAALLGIATVVFSLLFGAVYNISERRTRRRLQEQWEERERSLNRQS* |
Ga0062593_1008030872 | 3300004114 | Soil | MTFALVGIAAVVFSILFGVVHTVSERRQQRRMQAQWEERERALNRKP* |
Ga0062595_1009161222 | 3300004479 | Soil | MTLALIALAVVVFTALVGVVHTVTERRRVRRTQQQWEERERLLNRQR* |
Ga0068993_100024556 | 3300005183 | Natural And Restored Wetlands | MTLALVGLAAVLFTALVGVFHTVTERRRVRRTQQQWEERERLLNRKR* |
Ga0068997_100104462 | 3300005204 | Natural And Restored Wetlands | MTLALVGLAAVVFTALVGVFHTVTERRRVRRARQQWEERERLLDRKP* |
Ga0065705_103228913 | 3300005294 | Switchgrass Rhizosphere | MTLALVGIAVVVFTALVATVQAVTERRRLRRTQQQWEERERLLNRQR* |
Ga0065707_107559491 | 3300005295 | Switchgrass Rhizosphere | MTLALVGLAAVVFTALVGVVHTVTERRRIRRTQQQWEERERLLNRKR* |
Ga0070676_100174216 | 3300005328 | Miscanthus Rhizosphere | MTFALVGIAAVVFSILFGVVHTVSERSQQRRMQAQWEQRERSLNRK |
Ga0066388_1002045165 | 3300005332 | Tropical Forest Soil | MTLALFAAAAAVVFTIMYGVVHTVTERLQQRRFRRQWEERERSLNRRP* |
Ga0066388_1005238802 | 3300005332 | Tropical Forest Soil | MILALVAAGGIVFAILYGVVHTVTERSQQRRLQQQWEERERSLNRRA* |
Ga0070677_100313674 | 3300005333 | Miscanthus Rhizosphere | MTFALVGIAAVVFSILFCVVHTVSERRQQRRMQAQWEERERALNRKP* |
Ga0068868_1000416797 | 3300005338 | Miscanthus Rhizosphere | MTFALVGIAAVVFSILFGVVHTVSERSQQRRMQAQWEQRERSLNRKP* |
Ga0070691_100508533 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLALFGVAAVVFTVLAAVVHTVSERRQQRRIQQQWEERERSLNRKP* |
Ga0070667_1001969761 | 3300005367 | Switchgrass Rhizosphere | HELDRPVSPPMTFALVGIAAVVFSILFGVVHTVSERRQQRRMQAQWEERERALNRKP* |
Ga0070703_100709183 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLALFGVAAVVFSILLGVVHTVSERRQQRRIQQQWEERERSLNRKP* |
Ga0070709_102107992 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLAIFGIAAVVFSVLLGVVHTVSERRQQRRIQQQWEERERSLNRKP* |
Ga0070711_1007371061 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | VPPVTLALLGIAAVVFSVLLGVVHIVSERRQQRRIQQQWQERERSLNRKP* |
Ga0070705_1000606981 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLALFLALFGLAAVVFTILLGVVHTVSERRQQRRIQQQWEKRERSLNRKP* |
Ga0070705_1003990392 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLAIFGIAAVVFSVLLGVVHTVSERRQQRRIQQQWEERER |
Ga0070705_1018842502 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MMFALFGVAAVVFSILLGVVHTVSERRQQRRIQRQWEERERSLNRKP* |
Ga0070694_1008275112 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MMLALFGVAAVVFSILLGVVHTVSERRQQRRIQQQWEERERSLNRKP* |
Ga0070708_1000041349 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MTAILLGAGVVVFGILYGVVHTVSQRRQQRRVREQWEERERSLNRKP* |
Ga0070708_1000724374 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLTLALFGVAAVVFSILLGVVHIVSERRQQRRIQQQWEQRERSLNRKP* |
Ga0070698_1000841482 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLTLALFGVAAVVFSILLDVVHIVSERRQQRRIQQQWEQRERSLNRKP* |
Ga0070698_1003533401 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MMLALFGVAAVVFSILLGVVHTVSERRQQRRIQRQWEERERSLNRKP* |
Ga0070741_10000270182 | 3300005529 | Surface Soil | MTLILALFGIAAVVFSVLVGVVQTVSTRRQQRHMKRQWEERERLLDRRSVGDPPE* |
Ga0070679_1004426833 | 3300005530 | Corn Rhizosphere | NDLQTAEIAPMTLALVGIAAVVFTVLAGTVHTVWNKRQQRRTREQWEERERLLNRKP* |
Ga0070672_10000797111 | 3300005543 | Miscanthus Rhizosphere | MMFALVGIAAVVFSILFGVVHTVSERRQQRRMQAQWEERERALNRKP* |
Ga0070696_1008544091 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | PTLPPMTLALFGVAAVVFSILLGVVHTVSERRQQRRIQQQWEERERSLNRKP* |
Ga0070696_1016622802 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLALIALAVVVFTALVGVVHTVTERRRVRRTQQQWEERER |
Ga0066905_1000577693 | 3300005713 | Tropical Forest Soil | MTLALLVVAAVTFSLLFGLVHKVSERRTKRRLQQQWEERERALNRRA* |
Ga0075300_10001015 | 3300005876 | Rice Paddy Soil | VTLALFGVAAVVFTVLAAVVHTVSERRQQRRIQQQWEERERSLNRKP* |
Ga0075297_10004963 | 3300005878 | Rice Paddy Soil | MKLALLAIAAVVFSVLLGVVHTVTERRQQRRIQEQWEARERSLNREP* |
Ga0075023_1001039203 | 3300006041 | Watersheds | MTLALVGVAAVVFSILLGVVHTVSERRQQRRIQQQWEERERSLNRKP* |
Ga0097621_1011799493 | 3300006237 | Miscanthus Rhizosphere | MTLALFGVAAVVFSILLGVVHTVSERRQQRRIQQQWEQRERSLNRKP* |
Ga0079222_104307001 | 3300006755 | Agricultural Soil | MMLAVFGIAAAVVFSVLLGVVHVVSERQQQRRVQRQWEERERSLNRKP* |
Ga0079221_104109752 | 3300006804 | Agricultural Soil | MTFALVGIAAMVFSILFGVVHTVSERRQQRRMQAQWEERERALNRKP* |
Ga0079220_101270182 | 3300006806 | Agricultural Soil | VTVALALVGFAAVVFTLLFGLVHTVSERRQQRRMQEQWEERERSLNRKP* |
Ga0079220_105079131 | 3300006806 | Agricultural Soil | VVFSVLLGVVHVVSERQQQRRVQRQWEERERSLNRKP* |
Ga0075421_1020710281 | 3300006845 | Populus Rhizosphere | MTLALVAVAAVVFTALVGIVHTVQERRRVRRTREQWEERERLLNRKP* |
Ga0075433_100067253 | 3300006852 | Populus Rhizosphere | MMLAIFGIAAAVVFSVLLGVVHVVSERQQQRRVQRQWEERERSLNRKP* |
Ga0075433_115509882 | 3300006852 | Populus Rhizosphere | VTLALFGIAAVVFSVLLGVVHTVSERRQQRRIQQQWEERERSLNRKP* |
Ga0075425_1003168832 | 3300006854 | Populus Rhizosphere | MTFALVGIAAVVFSILFGVVHTVSERRQQRRMQAQWEERERSLNRKP* |
Ga0075436_1004282253 | 3300006914 | Populus Rhizosphere | VPPVTLALFGIAAVVFSVLLGVVHTVSERRQQRRIQQQWEERERSLNRKP* |
Ga0079219_102286332 | 3300006954 | Agricultural Soil | VPPMMLAVFGIAAAVVFSVLLGVVHVVSERQQQRRVQRQWEERERSLNRKP* |
Ga0099791_105277081 | 3300007255 | Vadose Zone Soil | MTLALVGLAVVVFTALVGVVHTVTERRRIRRTQQQWEERERLLNRKR* |
Ga0099794_104205142 | 3300007265 | Vadose Zone Soil | MTLALVGLAAVVFTALVGVVHTVTERRRVRRTQQQWEERERLLNRKR* |
Ga0099829_1000047610 | 3300009038 | Vadose Zone Soil | MTLALVGLAAVVFTALVGVVHTVMERRRLRRTQEQWEERERLLNREP* |
Ga0099829_108677133 | 3300009038 | Vadose Zone Soil | MTLTLALFGVAAVVFSILLGVVHTVSERRQQRRIQQQWEQRERSLNRKP* |
Ga0105095_104751431 | 3300009053 | Freshwater Sediment | MTLALIGLAAVVFTALVGVVHTVTERRRLRRTQEQWEERERLLNRPR* |
Ga0099830_100178736 | 3300009088 | Vadose Zone Soil | MTLALVGLAAVVFTALVGVVHTVTERRRLRRTQEQWEERERLLNREP* |
Ga0099830_105428401 | 3300009088 | Vadose Zone Soil | MTIALLGAGVVVFGILFGAVHTVSERRQQRRVREQWEERERSLNRKP* |
Ga0099828_118410831 | 3300009089 | Vadose Zone Soil | MTLALVGLAAVVFTALVGVVHTVTERRHLRRTQEQWEERERLLNREP* |
Ga0099828_119170301 | 3300009089 | Vadose Zone Soil | MTIALLGAGVVVFGILFGAVHTVSERRQQRRVREQ* |
Ga0099827_103404733 | 3300009090 | Vadose Zone Soil | AGVVVFGILYGVVHTVSERREQRRAREQWEKRERLLNRKP* |
Ga0114129_100598058 | 3300009147 | Populus Rhizosphere | MTLALVGLAAVVFTALVGVVHTVTEWRRIRRTQQQWEERERLLNRKR* |
Ga0105243_122036323 | 3300009148 | Miscanthus Rhizosphere | VGIAAVVFSILFGVVHTVSERRQQRRMQAQWEERERALNRKP* |
Ga0105079_10436561 | 3300009805 | Groundwater Sand | VTLALVGLAAVVFTALVGVIHTVTERRRLRRTQQQWEERERLLNRKPQVSRKP* |
Ga0105067_10122184 | 3300009812 | Groundwater Sand | MTAILLGAGVVVFGILYGVVHTVSERRQQRRVRQQCESRERSLNREP* |
Ga0105085_10093123 | 3300009820 | Groundwater Sand | MTIALLGAGVVVFGILFGVVHTVSAWRQQHRVRQQWEERERSLNREP* |
Ga0126376_112975121 | 3300010359 | Tropical Forest Soil | ALFAAGAIVFAILYGVVTTVTERRHQRSLQRQWEERERSLDRRR* |
Ga0126372_100914645 | 3300010360 | Tropical Forest Soil | VFAILYGVVHTVTERSQQRRLQQQWEERERSLNRRA* |
Ga0136847_113410022 | 3300010391 | Freshwater Sediment | LTLALVGLAAVVFTALVGVVHTVTERRRLRRTQQQWEDRERMLNRKP* |
Ga0137315_10184821 | 3300011395 | Soil | MTLTLIGLAAVVFTALVGVVHTVTERRRLRRTQQQWEERERLLNRPR* |
Ga0137454_10071012 | 3300011406 | Soil | MNLAPMTLALVGLAAVVFTALVGVVHTVTERRRLRRTQEQWEERERRLNREP* |
Ga0137446_10071632 | 3300011419 | Soil | MTLALVGLAAVVFTALVGVVHTVTERRRVRRTQEQWEERERLLNREP* |
Ga0137439_11456181 | 3300011424 | Soil | MTLALVGLAAVVFTALVGVVHTVTERRRLRRTQQQWEERERLLNRPR* |
Ga0137441_10544882 | 3300011425 | Soil | MTLALVGLAAVVFTALVGVVHTVTERRRLRRTQQQWEERERLLNRQQ* |
Ga0137461_11169302 | 3300012040 | Soil | MTLALVGLAAVVFTTLVGVVHTVTERRRLRRTQQQWEERERLLNRPR* |
Ga0137389_100310772 | 3300012096 | Vadose Zone Soil | MTLTLALFGVAAVVFSILLGVVHTVSERRQQRRIQRQWEERERSLNRKP* |
Ga0137330_10098881 | 3300012134 | Soil | MTLALVGLAAVVFTTLVGVVHTVTERRRRRRTQQQWEERE |
Ga0137362_100322782 | 3300012205 | Vadose Zone Soil | MMLAFFGIAAVVFSILLGVVHTVSERRQQRRIQQQWEERERSLNRKP* |
Ga0137376_103564632 | 3300012208 | Vadose Zone Soil | MTLALFGVAAVVFSILLGVVHTVSERRQQRRSQQQWEARERSLNR |
Ga0137378_105697851 | 3300012210 | Vadose Zone Soil | MTLTLALFGVAAVVFSILLGVVHIVSERRQQRRIQQQWEQ |
Ga0137375_101637693 | 3300012360 | Vadose Zone Soil | MTLALVGLAAVVFTALVGVVHTITEQRRLRRTQEQWEERERLLNRKP* |
Ga0137358_106521352 | 3300012582 | Vadose Zone Soil | MTLALVGLAAVVFTALVGVVHTITERRRVRRTQQQWEERERLLNRKP* |
Ga0137397_100705186 | 3300012685 | Vadose Zone Soil | MTLALVALAVVVFAVLVGVVHTVSERRRVRRTQQQWEERERLLNRQR* |
Ga0157293_100199171 | 3300012898 | Soil | MTLALLVVAGVTFSLLFGLVHKVSERRTKRRLQQQWE |
Ga0137419_100484013 | 3300012925 | Vadose Zone Soil | MTLALVGLAAVVFTALVGVVHTITERRRVRRSQQQWEERERLLNRKP* |
Ga0137416_101935182 | 3300012927 | Vadose Zone Soil | MMLALFGIAAVVFSILLGVVHTVSERRQQRRIQRQWEERERSLNRKP* |
Ga0153915_100725544 | 3300012931 | Freshwater Wetlands | VTLALFGVAAVVFTILAAVVHTISERRQQRRAQQQWEERERSLNRKP* |
Ga0153915_101942083 | 3300012931 | Freshwater Wetlands | MTLALFGVAAVVFTVLAAVVHTVSERRQQRRIQRQWEERERALNRKP* |
Ga0137410_100215023 | 3300012944 | Vadose Zone Soil | MTLALVGLAAVVFTALVGVVHTVTERRRIRRTQQQWEERERLLNRKP* |
Ga0164301_100240956 | 3300012960 | Soil | VGIAAVVFSILFGVVHTVSERSQQRRMQAQWEQRERSLNRKP* |
Ga0164301_110083572 | 3300012960 | Soil | MTLALFGVAAVVFSILLGVVHTVSERRQQRRIQRQWEERERSLNRKP* |
Ga0180074_10062742 | 3300014877 | Soil | MTLALVGLAAVVFTALVGVVHTVTERRRLRRTQEQWEERERLLNREL* |
Ga0180094_10830981 | 3300014881 | Soil | MTLALVGLAAVVFTTLVGVVHTVTERRRLRRTQEQWEERERLLNREP* |
Ga0120098_10081552 | 3300015170 | Fossill | MTLALVGLAAVVFTALVGVVHTVTERRRLRRTQEQWEERERLLNRKSLGP* |
Ga0132258_129511992 | 3300015371 | Arabidopsis Rhizosphere | MTLALFGVGAVVFTVLAAVVHTVSERRQQRRIQRQWEERERSLNRKP* |
Ga0132257_1046299421 | 3300015373 | Arabidopsis Rhizosphere | PMTFALVGIAAVVFSILFGVVHTVSERSQQRRMQAQWEQRERSLNRKP* |
Ga0163161_114721221 | 3300017792 | Switchgrass Rhizosphere | ELDRPVSPPMTFALVGIAAVVFSILFGVVHTVSERRQQRRMQAQWEERERALNRKP |
Ga0187825_100166023 | 3300017930 | Freshwater Sediment | MTLALCGVAAVVFTVLAAVVHTVSERRQQRRIQRQWEERERSLNRKP |
Ga0187821_101102182 | 3300017936 | Freshwater Sediment | MTLALFGVAAVVFTVLAAVVHTVSERRQQRRIQQQWEERERALNRKP |
Ga0187775_101926272 | 3300017939 | Tropical Peatland | MTIALLGIAAAVFSILFGVIHTVSERRSKQRLQRQW |
Ga0187776_100159723 | 3300017966 | Tropical Peatland | MTIALLGIAAAVFSILFGVIHTVSERRSKQRLQRQWEERERALNRQS |
Ga0184610_10026424 | 3300017997 | Groundwater Sediment | MTLALVGLAAVVFTALVGVVHTVTERRRLRRTQEQWEERERLLNREP |
Ga0184610_10375051 | 3300017997 | Groundwater Sediment | MTLALVGLAAVVFTALVGVVHTVTERRRIRRTQQQWEERERLLNRKR |
Ga0184604_100004803 | 3300018000 | Groundwater Sediment | MTLALVGLAAVVFTALVGVVHTVTERRRVRRTQQQWEERERLLNRKP |
Ga0184605_101074802 | 3300018027 | Groundwater Sediment | MTLALVGLAAVVFTALVGVVHTVTERRRIRRTQQQWEERERLLNRKW |
Ga0184634_100655072 | 3300018031 | Groundwater Sediment | MTLALVGLAAVVFTALVGVVHAVSERRRLRRTQEQWEERERLLNRKP |
Ga0184634_101573121 | 3300018031 | Groundwater Sediment | AAALAPMTLALVGLAAVVFTALVGVVHTVTERRRLRRTQEQWEERERLLNREP |
Ga0184626_100068851 | 3300018053 | Groundwater Sediment | MTLALVGLAAVVFTALVGVVHTVTARRRLRRTQEQWEERERLLNREP |
Ga0184619_100297712 | 3300018061 | Groundwater Sediment | LVGLAAVVFTALVGVVHTVTERRRVRRTQQQWEERERLLNRKP |
Ga0184637_100492431 | 3300018063 | Groundwater Sediment | MTLALVGLAAVVFSALVGVVHTVTERRRLRRTQEQWEERERLLNREP |
Ga0184627_103538962 | 3300018079 | Groundwater Sediment | MTIALFGAGVVVFGILFGVVHTVSERRQQRRVRQQWEERERSL |
Ga0184629_104394872 | 3300018084 | Groundwater Sediment | MTLALVGLAAVVFTALVGVVHTVTERRRVRRTQEQWEERERLLNREP |
Ga0190265_100879013 | 3300018422 | Soil | MTFALVALAVVIFTGLAVVVHLVTERRRVRRTQEQWEERERLLNRKP |
Ga0190265_101045992 | 3300018422 | Soil | MTLALVGLAAVVFTALVGVVHSVTERRRLRRTQEQWEERERLLNRKSLGP |
Ga0190272_100541085 | 3300018429 | Soil | MTLALVGLAAVVFTALVGVVHTVTERRRLRRTQEQWEERERRLNREP |
Ga0184648_13935571 | 3300019249 | Groundwater Sediment | LAPMTLTLIGLAVVVFTALVGVVHTVTERRRLRRSQEQWEERERLLNRES |
Ga0184643_14966951 | 3300019255 | Groundwater Sediment | MTLALVGLAPVVFTALVGVVHTVTERRRVRRTQQQWEERERLLNRKP |
Ga0187892_1000191018 | 3300019458 | Bio-Ooze | MTAILLGAGVVVFGILCGVVHTVSERHQQRRVRQQWEERERSLNRKP |
Ga0187892_1000812311 | 3300019458 | Bio-Ooze | MTLALVGLAAVVFTALVGIVHTVQERRRVRRSQEQWEERERLLDREP |
Ga0193707_11753132 | 3300019881 | Soil | MTLALFGVAAVVFSILLGVVHTVSERRQQRHIQEQWEARERSLNRKP |
Ga0193713_10907272 | 3300019882 | Soil | LTLALVGLAVVVFTALVGVVHTVTERRRVRRTQQQWEERERLLNRKP |
Ga0193726_10571871 | 3300020021 | Soil | PTLPPMTLALFGVAAVVFSILLGVVHTVSERRQQRHIQEQWEARERSLNRKP |
Ga0210407_106329131 | 3300020579 | Soil | VTLALFGIAAVVFSVLLGVVHIVSERRQQRRIQQQWQERERSLNRKP |
Ga0210407_108410751 | 3300020579 | Soil | TLALLGIAAVVFSVLLGVVHIVSERRQQRRIQQQWQERERSLNRKP |
Ga0179596_101430422 | 3300021086 | Vadose Zone Soil | MTLTLALFGVAAVVFSILLGVVHTVSERRQQRRIQRQWEERERSLNRKP |
Ga0210400_100204832 | 3300021170 | Soil | VPPVTLALFGIAAVVFSVLLGVVHIVSERRQQRRIQQQWQERERSLNRKP |
Ga0210402_114925711 | 3300021478 | Soil | VVFSVLLGVVHIVSERRQQRRIQQQWQERERSLNRKP |
Ga0210402_118002711 | 3300021478 | Soil | VPPVTLALLGIAAVVFSVLLGVVHIVSERRQQRRIQQQWQERERSLNRKP |
Ga0247753_10452121 | 3300022892 | Soil | VVAGVTFSLLFGLVHKVSERRTKRRLQQQWEERERALNRRA |
Ga0247797_10684312 | 3300023057 | Soil | MTLALLVVAGVTFSLLFGLVHKVSERRTKRRLQQQWEERERALNRRA |
Ga0207423_10084822 | 3300025535 | Natural And Restored Wetlands | MTLALVGLAVVLFTALVGVFHTVTERRRVRRTQQQWEERERLLNRKR |
Ga0210076_10676162 | 3300025567 | Natural And Restored Wetlands | VTLALVGLAAVVFTALVGVVHTITERRRLRRTQQQWEERERLLNRKP |
Ga0210138_10225711 | 3300025580 | Natural And Restored Wetlands | HAADLAPMTLALVGLAAVLFTALVGVFHTVTERRRVRRTQQQWEERERLLNRKR |
Ga0207653_103900582 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLTLALFGVAAVVFSILLGVVHTVSERRQQRRIQQQWEERERS |
Ga0207699_101434364 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | GPTLARMTLTLALFGVAAVVFSILLGVVHIVSERRQQRRIQQQWEQRERSLNRKP |
Ga0207684_100241662 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLALFGVAAVVFSILLGVVHTVSERRQQRRIQQQWEERERSLNRKP |
Ga0207684_100251809 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLAIFGIAAVVFSVLLGVVHTVSERRQQRRIQRQWEERERSLNRK |
Ga0207684_100604513 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLTLALFGVAAVVFSILLGVVHIVSERRQQRRIQQQWEQRERSLNRKP |
Ga0207684_104808751 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MMLALFGVAAVVFSILLGVVHTVSERRQQRRIQRQWEERERSLNRKP |
Ga0207694_114320252 | 3300025924 | Corn Rhizosphere | MTFALVGIAAVVFSILFGVVHTVSERRQQRRMQAQWEERARALNRKP |
Ga0210071_10190142 | 3300025955 | Natural And Restored Wetlands | MTLALVGLAAVVFTALVGVFHTVTERRRVRRARQQWEERERLLDRKP |
Ga0208000_1033292 | 3300026001 | Rice Paddy Soil | MKLALLAIAAVVFSVLLGVVHTVTERRQQRRIQEQWEARERSLNREP |
Ga0209438_10097893 | 3300026285 | Grasslands Soil | MMLALFGVAAVVFSILLGVVHTISERRQQRRIQRQWEERERSLNRKP |
Ga0209240_10241741 | 3300026304 | Grasslands Soil | MTLTLALFGVAAVVFSILLGVVHTVSERRQQRRIQQQWEQRERSLNRKP |
Ga0257148_10051371 | 3300026345 | Soil | PTLPPMMLALFGVAAVVFSILLGVVHTVSERRQQRRIQRQWEERERSLNRKP |
Ga0257173_10108482 | 3300026360 | Soil | MTLALVGLAAVVFTALVGVVHTVTERRHLRRTQEQWEERERLLNREP |
Ga0257171_10100443 | 3300026377 | Soil | MMLALFGVAAVVFSILLGVVHTVSERRQQRRIQRQWEE |
Ga0257178_10007581 | 3300026446 | Soil | MMLALFGVAAVVFSILLGVVHTVSERRQQRRIQRQWEERE |
Ga0257181_10008033 | 3300026499 | Soil | MTLALVGLAAVVFTALVGVVHTVMERRRLRRTQEQWEERERLLNREP |
Ga0257168_11285662 | 3300026514 | Soil | MMLALFGVAAVVFSILLGVVHTVSERRQQRRIQQQWEERERSLNRKP |
Ga0257158_10210951 | 3300026515 | Soil | FSILLGVVHTVSERRQQRRIQQQWEARERSLNRKP |
Ga0256867_101493412 | 3300026535 | Soil | MTLALVGLAAVVFTALAGVVHIVTERRRLRRTQQQWEERERLLNREP |
Ga0207634_1052712 | 3300026818 | Soil | MTLALLVVAGVTFSLLFGLVHKVSERRTKRRLQQQWEERERALNR |
Ga0209869_10475071 | 3300027187 | Groundwater Sand | MTIALLGAGVVVFGILFGVVHTVSERRQQHRVRQQWEERERSLNREP |
Ga0209973_10162592 | 3300027252 | Arabidopsis Thaliana Rhizosphere | MTLALLVVAGVTFSLLFGLVHKVSERRTKRRLQQQWEERERALNRR |
Ga0207458_10065891 | 3300027484 | Soil | MTLALLVVAGVTFSLLFGLVHKVSERRTKRRLQQQWEERER |
Ga0209117_10022494 | 3300027645 | Forest Soil | MTLALFGVAAVVFSILLGVVHTVSERRQQRRIQQQWEARERSLNRKP |
Ga0256866_10464404 | 3300027650 | Soil | MTLALVGLAAVVFTAFAGVVHIVTERRRLRRTQQQWEERERLLNREP |
Ga0209217_10233011 | 3300027651 | Forest Soil | VTLALFGIAAVVFSVLLGVVHTVSERRQQRRIQQQWEERERSLNRKP |
Ga0209074_101130802 | 3300027787 | Agricultural Soil | MMLAVFGIAAAVVFSVLLGVVHVVSERQQQRRVQRQWEERERSLNRKP |
Ga0209726_103509522 | 3300027815 | Groundwater | MTLALIGLAAVVFTALVGVVHTVTERRRVRRSQEQWEERERLLDREP |
Ga0209701_101767582 | 3300027862 | Vadose Zone Soil | MTIALLGAGVVVFGILFGAVHTVSERRQQRRVREQWEERERSLNLK |
Ga0209814_101102222 | 3300027873 | Populus Rhizosphere | MMLAIFGIAAAVVFSVLLGVVHVVSERQQQRRVQRQWEERERSLNRKP |
Ga0209068_101548271 | 3300027894 | Watersheds | MTLALVGVAAVVFSILLGVVHTVSERRQQRRIQQQWEERERSLNRKP |
Ga0209488_107606201 | 3300027903 | Vadose Zone Soil | MTLALFGVAAVVFSILLGVVHTVSERRQQRRSQQQ |
Ga0209488_108207372 | 3300027903 | Vadose Zone Soil | MTLALVGLAAVVFTALVGVVHTVMERRRLRRTQEQWEERERLLN |
Ga0209069_100780951 | 3300027915 | Watersheds | MTALLFGAGVVVFGILYGVVHTVSERRQQRRVREQWEERERSLNRKP |
Ga0209859_10485191 | 3300027954 | Groundwater Sand | MTIAFLGASLVVFGILVGVVHTVSERRQQRRVRQQWEQR |
Ga0209526_100389192 | 3300028047 | Forest Soil | MTLALFGVAAVVFSILLGVVHTVSERRQQRRIQQQWDARERSLNRKP |
Ga0268265_100349202 | 3300028380 | Switchgrass Rhizosphere | MTLALIALAVVVFTALVGVVHTVTERRRVRRTQQQWEERERLLNRQR |
Ga0137415_100124422 | 3300028536 | Vadose Zone Soil | MTLALVGLAAVVFTALVGVVHTITERRRVRRTQQQWEERERLLNRKP |
Ga0137415_104230182 | 3300028536 | Vadose Zone Soil | MMLALFGIAAVVFSILLGVVHTVSERRQQRRIQRQWEERERSLNRKP |
Ga0257175_10261862 | 3300028673 | Soil | MMLALFGVAAVVFSILLGVVHTVSERRQQRRIQQQWEQRERSLNRKP |
Ga0307282_102131802 | 3300028784 | Soil | ADLLPMTLALVGLAAVVFTALVGVVHTVTERRRVRRTQQQWEERERLLNRKP |
Ga0307282_105321761 | 3300028784 | Soil | MTLALVGLAAVVFTALVGVVHTVTERRRVRRTQQQWEERE |
Ga0307504_101500703 | 3300028792 | Soil | MTLALFGVAAVVFSILLGVVHTVSERRQQRRIQRQWEARERSLNRKP |
Ga0307284_104688881 | 3300028799 | Soil | MTLALFGVAAVVFSILLGVVHTVSERRQQRRIQEQWEARERSLNRKP |
Ga0247825_104798412 | 3300028812 | Soil | MTLALVGIAVVVFTALVATVQAVTERRRLRRTQQQWEERERLLNRQR |
Ga0307312_102319002 | 3300028828 | Soil | VPLTLALVGLAAVVFTALVGVVHTVTERRRLRRTQEQWEERERLLNREP |
Ga0302046_101368774 | 3300030620 | Soil | MTLALVGLAAVVFTALVGIVHTLTERRRLRRTQQQWEERERLLNREP |
Ga0299913_100833825 | 3300031229 | Soil | MTLALVGLAAVVFTTLAGVVHIVTERRRLRRTQQQWEERERLLNREP |
Ga0310888_110554801 | 3300031538 | Soil | VTLALFGVAAVVFTVLAAVVHTVSERRQQRRIQQQWEERERSLNRKP |
Ga0307468_1004949222 | 3300031740 | Hardwood Forest Soil | MTLALLVVAGVTFSLLFALVHKVSERRTKRRLQQQWEERERALNRRA |
Ga0307468_1015815191 | 3300031740 | Hardwood Forest Soil | IHEHPSPTLPPMMFALFGVAAVVFSILLGVVHTVSERRQQRRIQRQWEERERSLNRKP |
Ga0307473_100453401 | 3300031820 | Hardwood Forest Soil | DHRGRTLPPMTLALFGVAAVVFSILLGVVHTVSERRQQRRIQQQWEERERSLNRKP |
Ga0307473_106441443 | 3300031820 | Hardwood Forest Soil | VTLALFGIAAVVFSVLLGVVHTVSERRQQRRIQRQWEERERSLNRKP |
Ga0214473_100927314 | 3300031949 | Soil | MTAILLGAGVVVFGILYGVVHTVSERRQQRRVREQWEERERSLNRKP |
Ga0307479_100799695 | 3300031962 | Hardwood Forest Soil | MTLAIFGIAAVVFSVLLGVVHTVSERRQQRRIQRQWEERERSLNRKP |
Ga0307470_101749492 | 3300032174 | Hardwood Forest Soil | MTLALFGVAAVVFSILLGVVHTVSERRQQRRIQRQWEERERSLNRKP |
Ga0307470_104922462 | 3300032174 | Hardwood Forest Soil | MTLALVGLAAVVFTALVGVVHTVTERRRLRRTQQQWEERERLLNRKP |
Ga0307470_110918493 | 3300032174 | Hardwood Forest Soil | ASPLMTLALLVVAGVTFSLLFARVHKVSERRTKRRLQQQWEERERALNRRA |
Ga0307471_1009155302 | 3300032180 | Hardwood Forest Soil | MTLALVGIAAVVFTVLAGTVHTVWNRRQQRRIREQWEERERLLNRKP |
Ga0307471_1022659633 | 3300032180 | Hardwood Forest Soil | PVTLALFGIAAVVFSVLLGVVHIVSERRQQRRIQQQWQERERSLNRKP |
Ga0335085_1000066677 | 3300032770 | Soil | MTLALLGVAAVVFSLLCAVIHTISERRAHRQLQEQWEERERSLNRKP |
Ga0335069_108244633 | 3300032893 | Soil | PTTFPPMTLALLGVAAVVFSLLCAVIHTISERRTHRQLQEQWEERERSLNRKP |
Ga0335083_100028474 | 3300032954 | Soil | MTLALLGVAAVVFSLLCAVIHTISERRTHRQLQEQWEERERSLNRKP |
Ga0334722_104755762 | 3300033233 | Sediment | MTLALVALAVVVFTVLVGVVHTVTERRRLRRAQQQWAERERLLNRPRS |
Ga0326729_10008612 | 3300033432 | Peat Soil | MTLALFGVAAVVFTVLAAVVKTVSERRQQRRIQQQWEERERSLNRKP |
Ga0326726_1000115221 | 3300033433 | Peat Soil | VTLALFGVAAVVFTILAAVVHTISERRQQRRAQQQWEERERSLNRKP |
Ga0326726_104711294 | 3300033433 | Peat Soil | GVAAVVFTVLAAVVKTVSERRQQRRIQQQWEERERSLNRKP |
Ga0316628_1019549061 | 3300033513 | Soil | MTLALCGVAAVVFTVLAAVVHTVSERRQQRRIQQQWEERERSLNRKP |
Ga0373948_0015373_1104_1247 | 3300034817 | Rhizosphere Soil | MTFALVGIAAVVFSILFGVVHTVSERSQQRRMQAQWEQRERSLNRKP |
Ga0373948_0134542_385_540 | 3300034817 | Rhizosphere Soil | MTLALFLALFGLAAVVFTILLGVVHTVSERRQQRRIQQQWEKRERSLNRKP |
Ga0373950_0151175_1_135 | 3300034818 | Rhizosphere Soil | MTFALVGIAAVVFSILFGVVHTVSERRQQRRMQAQWEERERALNR |
⦗Top⦘ |