Basic Information | |
---|---|
Family ID | F023736 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 209 |
Average Sequence Length | 42 residues |
Representative Sequence | MALIDGRTTRVLFTVLLFALGLGFLYAARRTLIAFLFA |
Number of Associated Samples | 187 |
Number of Associated Scaffolds | 209 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 82.30 % |
% of genes near scaffold ends (potentially truncated) | 98.09 % |
% of genes from short scaffolds (< 2000 bps) | 90.43 % |
Associated GOLD sequencing projects | 175 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.58 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (96.651 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (9.569 % of family members) |
Environment Ontology (ENVO) | Unclassified (16.746 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.067 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 48.48% β-sheet: 0.00% Coil/Unstructured: 51.52% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.58 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 209 Family Scaffolds |
---|---|---|
PF01202 | SKI | 16.27 |
PF13349 | DUF4097 | 2.39 |
PF13345 | Obsolete Pfam Family | 0.96 |
PF01594 | AI-2E_transport | 0.48 |
PF07690 | MFS_1 | 0.48 |
PF10086 | YhfC | 0.48 |
PF08281 | Sigma70_r4_2 | 0.48 |
PF07168 | Ureide_permease | 0.48 |
PF13435 | Cytochrome_C554 | 0.48 |
COG ID | Name | Functional Category | % Frequency in 209 Family Scaffolds |
---|---|---|---|
COG0628 | Predicted PurR-regulated permease PerM | General function prediction only [R] | 0.48 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 96.65 % |
Unclassified | root | N/A | 3.35 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000789|JGI1027J11758_12669532 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1489 | Open in IMG/M |
3300001648|JGI20242J16303_104734 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 664 | Open in IMG/M |
3300001867|JGI12627J18819_10206072 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 793 | Open in IMG/M |
3300002245|JGIcombinedJ26739_101479554 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 574 | Open in IMG/M |
3300002915|JGI25387J43893_1047530 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 601 | Open in IMG/M |
3300004092|Ga0062389_102646169 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 668 | Open in IMG/M |
3300004152|Ga0062386_101359596 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 591 | Open in IMG/M |
3300004479|Ga0062595_101521900 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 618 | Open in IMG/M |
3300004800|Ga0058861_10535823 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 769 | Open in IMG/M |
3300004803|Ga0058862_11371414 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 587 | Open in IMG/M |
3300005093|Ga0062594_101436072 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 703 | Open in IMG/M |
3300005164|Ga0066815_10077194 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 594 | Open in IMG/M |
3300005171|Ga0066677_10677953 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 578 | Open in IMG/M |
3300005177|Ga0066690_10545163 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 777 | Open in IMG/M |
3300005178|Ga0066688_10017583 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 3710 | Open in IMG/M |
3300005290|Ga0065712_10110335 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1838 | Open in IMG/M |
3300005330|Ga0070690_100348870 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1074 | Open in IMG/M |
3300005331|Ga0070670_100023660 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 5287 | Open in IMG/M |
3300005364|Ga0070673_101022042 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 770 | Open in IMG/M |
3300005406|Ga0070703_10243531 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 726 | Open in IMG/M |
3300005436|Ga0070713_100581397 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1063 | Open in IMG/M |
3300005451|Ga0066681_10323880 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 945 | Open in IMG/M |
3300005454|Ga0066687_10030899 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2361 | Open in IMG/M |
3300005458|Ga0070681_11982102 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 510 | Open in IMG/M |
3300005471|Ga0070698_100045370 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 4499 | Open in IMG/M |
3300005526|Ga0073909_10188960 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 883 | Open in IMG/M |
3300005538|Ga0070731_10597144 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 735 | Open in IMG/M |
3300005538|Ga0070731_10863220 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 600 | Open in IMG/M |
3300005541|Ga0070733_10233080 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1208 | Open in IMG/M |
3300005542|Ga0070732_11014810 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 507 | Open in IMG/M |
3300005552|Ga0066701_10836388 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 547 | Open in IMG/M |
3300005554|Ga0066661_10891249 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 520 | Open in IMG/M |
3300005555|Ga0066692_10490164 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 783 | Open in IMG/M |
3300005556|Ga0066707_10884305 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 548 | Open in IMG/M |
3300005561|Ga0066699_10812706 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 658 | Open in IMG/M |
3300005568|Ga0066703_10602323 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 640 | Open in IMG/M |
3300005569|Ga0066705_10037254 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2662 | Open in IMG/M |
3300005569|Ga0066705_10357291 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 920 | Open in IMG/M |
3300005586|Ga0066691_10126173 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1457 | Open in IMG/M |
3300005610|Ga0070763_10203773 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1056 | Open in IMG/M |
3300005610|Ga0070763_10521984 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 681 | Open in IMG/M |
3300005610|Ga0070763_10877311 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 533 | Open in IMG/M |
3300005712|Ga0070764_10751740 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 603 | Open in IMG/M |
3300005712|Ga0070764_10988072 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 530 | Open in IMG/M |
3300005764|Ga0066903_101666079 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1213 | Open in IMG/M |
3300005764|Ga0066903_104179520 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 773 | Open in IMG/M |
3300005842|Ga0068858_100074722 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3147 | Open in IMG/M |
3300005904|Ga0075280_10140486 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 516 | Open in IMG/M |
3300005995|Ga0066790_10200880 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 852 | Open in IMG/M |
3300006050|Ga0075028_100713132 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 605 | Open in IMG/M |
3300006059|Ga0075017_100642147 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 814 | Open in IMG/M |
3300006163|Ga0070715_10183476 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1051 | Open in IMG/M |
3300006172|Ga0075018_10448781 | Not Available | 664 | Open in IMG/M |
3300006173|Ga0070716_101379095 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 572 | Open in IMG/M |
3300006354|Ga0075021_10605419 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 700 | Open in IMG/M |
3300006642|Ga0075521_10298797 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 775 | Open in IMG/M |
3300006800|Ga0066660_11617934 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
3300006854|Ga0075425_101216597 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 856 | Open in IMG/M |
3300006914|Ga0075436_100379916 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1021 | Open in IMG/M |
3300006914|Ga0075436_100503677 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 886 | Open in IMG/M |
3300007982|Ga0102924_1269278 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 693 | Open in IMG/M |
3300009088|Ga0099830_10009292 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5923 | Open in IMG/M |
3300009089|Ga0099828_11140318 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 692 | Open in IMG/M |
3300009090|Ga0099827_10207705 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1631 | Open in IMG/M |
3300009090|Ga0099827_11346290 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 621 | Open in IMG/M |
3300009177|Ga0105248_10454691 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1443 | Open in IMG/M |
3300009520|Ga0116214_1038116 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1738 | Open in IMG/M |
3300009523|Ga0116221_1097092 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1305 | Open in IMG/M |
3300009545|Ga0105237_10798102 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 951 | Open in IMG/M |
3300009551|Ga0105238_12973775 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 509 | Open in IMG/M |
3300009683|Ga0116224_10421460 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 635 | Open in IMG/M |
3300009700|Ga0116217_10078463 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2298 | Open in IMG/M |
3300010358|Ga0126370_12575115 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 508 | Open in IMG/M |
3300010359|Ga0126376_12500399 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 564 | Open in IMG/M |
3300010364|Ga0134066_10053933 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1042 | Open in IMG/M |
3300010376|Ga0126381_104817580 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 519 | Open in IMG/M |
3300010379|Ga0136449_100404228 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2422 | Open in IMG/M |
3300010379|Ga0136449_100411718 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2393 | Open in IMG/M |
3300010397|Ga0134124_10629507 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1054 | Open in IMG/M |
3300010401|Ga0134121_10840966 | Not Available | 886 | Open in IMG/M |
3300011120|Ga0150983_13575079 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 583 | Open in IMG/M |
3300012201|Ga0137365_10407990 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1002 | Open in IMG/M |
3300012361|Ga0137360_11351381 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 614 | Open in IMG/M |
3300012362|Ga0137361_10075828 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2862 | Open in IMG/M |
3300012930|Ga0137407_10219105 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1714 | Open in IMG/M |
3300012955|Ga0164298_11286663 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 559 | Open in IMG/M |
3300012957|Ga0164303_10409565 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 840 | Open in IMG/M |
3300012958|Ga0164299_10340232 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 940 | Open in IMG/M |
3300012958|Ga0164299_11608168 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 512 | Open in IMG/M |
3300012972|Ga0134077_10593619 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
3300012986|Ga0164304_11490572 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 559 | Open in IMG/M |
3300012988|Ga0164306_11901423 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 517 | Open in IMG/M |
3300013104|Ga0157370_11081775 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 725 | Open in IMG/M |
3300013104|Ga0157370_11636019 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 578 | Open in IMG/M |
3300013104|Ga0157370_11925768 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 530 | Open in IMG/M |
3300013296|Ga0157374_10560685 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1150 | Open in IMG/M |
3300014151|Ga0181539_1372577 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 513 | Open in IMG/M |
3300014489|Ga0182018_10126964 | All Organisms → cellular organisms → Bacteria | 1473 | Open in IMG/M |
3300014745|Ga0157377_10987741 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 636 | Open in IMG/M |
3300015245|Ga0137409_11298909 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 570 | Open in IMG/M |
3300015373|Ga0132257_101309798 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 920 | Open in IMG/M |
3300016294|Ga0182041_11098830 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 722 | Open in IMG/M |
3300017823|Ga0187818_10109605 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1195 | Open in IMG/M |
3300017924|Ga0187820_1034105 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1330 | Open in IMG/M |
3300017970|Ga0187783_10234778 | All Organisms → cellular organisms → Bacteria | 1343 | Open in IMG/M |
3300017972|Ga0187781_10982045 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 617 | Open in IMG/M |
3300018006|Ga0187804_10205456 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 842 | Open in IMG/M |
3300018042|Ga0187871_10048159 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2577 | Open in IMG/M |
3300018047|Ga0187859_10005136 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 7874 | Open in IMG/M |
3300018047|Ga0187859_10412615 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 742 | Open in IMG/M |
3300018085|Ga0187772_10733882 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 710 | Open in IMG/M |
3300018088|Ga0187771_10427786 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1118 | Open in IMG/M |
3300018090|Ga0187770_11600181 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 531 | Open in IMG/M |
3300018431|Ga0066655_10321110 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1011 | Open in IMG/M |
3300018431|Ga0066655_11440714 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 502 | Open in IMG/M |
3300018433|Ga0066667_10103450 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1902 | Open in IMG/M |
3300019268|Ga0181514_1334010 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 679 | Open in IMG/M |
3300019787|Ga0182031_1344473 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5242 | Open in IMG/M |
3300019787|Ga0182031_1376342 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2267 | Open in IMG/M |
3300019789|Ga0137408_1347476 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 826 | Open in IMG/M |
3300019890|Ga0193728_1207735 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 817 | Open in IMG/M |
3300020004|Ga0193755_1209712 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 549 | Open in IMG/M |
3300020062|Ga0193724_1036567 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1044 | Open in IMG/M |
3300020583|Ga0210401_11171358 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 627 | Open in IMG/M |
3300021170|Ga0210400_10443706 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1071 | Open in IMG/M |
3300021171|Ga0210405_11043917 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 614 | Open in IMG/M |
3300021388|Ga0213875_10548369 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 557 | Open in IMG/M |
3300021406|Ga0210386_10149222 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1954 | Open in IMG/M |
3300021407|Ga0210383_11081242 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 678 | Open in IMG/M |
3300021407|Ga0210383_11472344 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 564 | Open in IMG/M |
3300021433|Ga0210391_10137917 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1921 | Open in IMG/M |
3300021474|Ga0210390_11612243 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 510 | Open in IMG/M |
3300021559|Ga0210409_10029824 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5254 | Open in IMG/M |
3300022521|Ga0224541_1007583 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1165 | Open in IMG/M |
3300022525|Ga0242656_1065329 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 657 | Open in IMG/M |
3300022557|Ga0212123_10868910 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 534 | Open in IMG/M |
3300022716|Ga0242673_1133496 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
3300022718|Ga0242675_1138780 | Not Available | 501 | Open in IMG/M |
3300022722|Ga0242657_1042656 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 966 | Open in IMG/M |
3300022726|Ga0242654_10168944 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 742 | Open in IMG/M |
3300022726|Ga0242654_10182750 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 720 | Open in IMG/M |
3300022756|Ga0222622_10583405 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 806 | Open in IMG/M |
3300025321|Ga0207656_10642450 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 542 | Open in IMG/M |
3300025475|Ga0208478_1094244 | Not Available | 527 | Open in IMG/M |
3300025913|Ga0207695_10903402 | Not Available | 763 | Open in IMG/M |
3300025914|Ga0207671_10069007 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2635 | Open in IMG/M |
3300025915|Ga0207693_10342109 | All Organisms → cellular organisms → Bacteria | 1171 | Open in IMG/M |
3300025915|Ga0207693_11170890 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 581 | Open in IMG/M |
3300025916|Ga0207663_10771874 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 764 | Open in IMG/M |
3300025917|Ga0207660_10821130 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 759 | Open in IMG/M |
3300025928|Ga0207700_11010297 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 744 | Open in IMG/M |
3300025937|Ga0207669_10513317 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 961 | Open in IMG/M |
3300025939|Ga0207665_10597344 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 861 | Open in IMG/M |
3300025939|Ga0207665_10968714 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 676 | Open in IMG/M |
3300025944|Ga0207661_11829759 | Not Available | 553 | Open in IMG/M |
3300025945|Ga0207679_10182126 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1739 | Open in IMG/M |
3300025989|Ga0207998_1026194 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 572 | Open in IMG/M |
3300026215|Ga0209849_1012665 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1386 | Open in IMG/M |
3300026294|Ga0209839_10102903 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 974 | Open in IMG/M |
3300026331|Ga0209267_1120305 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1106 | Open in IMG/M |
3300026334|Ga0209377_1098620 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1215 | Open in IMG/M |
3300026538|Ga0209056_10403455 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 837 | Open in IMG/M |
3300026540|Ga0209376_1259009 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 737 | Open in IMG/M |
3300026552|Ga0209577_10841350 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 514 | Open in IMG/M |
3300027024|Ga0207819_1035749 | Not Available | 614 | Open in IMG/M |
3300027047|Ga0208730_1039113 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 555 | Open in IMG/M |
3300027576|Ga0209003_1084772 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 591 | Open in IMG/M |
3300027591|Ga0209733_1139671 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 593 | Open in IMG/M |
3300027727|Ga0209328_10225756 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 562 | Open in IMG/M |
3300027738|Ga0208989_10247167 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 582 | Open in IMG/M |
3300027879|Ga0209169_10191266 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1069 | Open in IMG/M |
3300027894|Ga0209068_10827204 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 546 | Open in IMG/M |
3300027898|Ga0209067_10097015 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1531 | Open in IMG/M |
3300027902|Ga0209048_10582871 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 747 | Open in IMG/M |
3300027908|Ga0209006_11432311 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 527 | Open in IMG/M |
3300028047|Ga0209526_10756665 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 606 | Open in IMG/M |
3300028748|Ga0302156_10330096 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 678 | Open in IMG/M |
3300028780|Ga0302225_10458491 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 597 | Open in IMG/M |
3300028819|Ga0307296_10776578 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 523 | Open in IMG/M |
3300028906|Ga0308309_11236533 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 643 | Open in IMG/M |
3300029954|Ga0311331_10282829 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1785 | Open in IMG/M |
3300030041|Ga0302274_10260854 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 822 | Open in IMG/M |
3300030058|Ga0302179_10350136 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 650 | Open in IMG/M |
3300030494|Ga0310037_10260966 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 748 | Open in IMG/M |
3300030687|Ga0302309_10421873 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 645 | Open in IMG/M |
3300030815|Ga0265746_1037462 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 643 | Open in IMG/M |
3300031057|Ga0170834_108756503 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1426 | Open in IMG/M |
3300031344|Ga0265316_10036256 | All Organisms → cellular organisms → Bacteria | 3988 | Open in IMG/M |
3300031344|Ga0265316_10513073 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 856 | Open in IMG/M |
3300031446|Ga0170820_11546950 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 603 | Open in IMG/M |
3300031525|Ga0302326_10182502 | All Organisms → cellular organisms → Bacteria | 3542 | Open in IMG/M |
3300031718|Ga0307474_11332592 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 566 | Open in IMG/M |
3300031753|Ga0307477_11043868 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 535 | Open in IMG/M |
3300031754|Ga0307475_10888192 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 704 | Open in IMG/M |
3300031912|Ga0306921_11726976 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 676 | Open in IMG/M |
3300031942|Ga0310916_10608285 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 929 | Open in IMG/M |
3300031945|Ga0310913_10730156 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 700 | Open in IMG/M |
3300031962|Ga0307479_11441868 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 646 | Open in IMG/M |
3300031996|Ga0308176_10280635 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1613 | Open in IMG/M |
3300032001|Ga0306922_10853554 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 949 | Open in IMG/M |
3300032001|Ga0306922_11561861 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 658 | Open in IMG/M |
3300032035|Ga0310911_10543104 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 674 | Open in IMG/M |
3300032180|Ga0307471_100470266 | All Organisms → cellular organisms → Bacteria | 1400 | Open in IMG/M |
3300032180|Ga0307471_101222669 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 915 | Open in IMG/M |
3300032805|Ga0335078_12072279 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 606 | Open in IMG/M |
3300032892|Ga0335081_11759399 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 672 | Open in IMG/M |
3300032893|Ga0335069_11388825 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 760 | Open in IMG/M |
3300032898|Ga0335072_10212792 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2273 | Open in IMG/M |
3300033547|Ga0316212_1040820 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 656 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 9.57% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.61% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.26% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.26% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.26% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.78% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.35% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.35% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.87% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.87% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.39% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.39% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.91% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.91% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.91% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.91% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.91% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.91% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.44% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.44% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.44% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.44% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.44% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.44% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.44% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.44% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.96% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.96% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.96% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.96% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.96% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.96% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.96% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.96% |
Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.96% |
Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 0.96% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.96% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.96% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.96% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.48% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.48% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.48% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.48% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.48% |
Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.48% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.48% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.48% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.48% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.48% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.48% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.48% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.48% |
Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Roots | 0.48% |
Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.48% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.48% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.48% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.48% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300001648 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF008 | Environmental | Open in IMG/M |
3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300002915 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005164 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAC | Environmental | Open in IMG/M |
3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
3300005904 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_404 | Environmental | Open in IMG/M |
3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
3300006642 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300007982 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300014151 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_60_metaG | Environmental | Open in IMG/M |
3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300019268 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019787 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction) | Environmental | Open in IMG/M |
3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
3300020062 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a1 | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Host-Associated | Open in IMG/M |
3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300022521 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 E3 20-24 | Environmental | Open in IMG/M |
3300022525 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
3300022716 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022718 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022722 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025475 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025989 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_303 (SPAdes) | Environmental | Open in IMG/M |
3300026215 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 (SPAdes) | Environmental | Open in IMG/M |
3300026294 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes) | Environmental | Open in IMG/M |
3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
3300027024 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 42 (SPAdes) | Environmental | Open in IMG/M |
3300027047 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF042 (SPAdes) | Environmental | Open in IMG/M |
3300027576 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027727 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
3300027902 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes) | Environmental | Open in IMG/M |
3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300028748 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_2 | Environmental | Open in IMG/M |
3300028780 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2 | Environmental | Open in IMG/M |
3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300029954 | I_Bog_N3 coassembly | Environmental | Open in IMG/M |
3300030041 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_1 | Environmental | Open in IMG/M |
3300030058 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1 | Environmental | Open in IMG/M |
3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
3300030687 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_1 | Environmental | Open in IMG/M |
3300030815 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSU2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Host-Associated | Open in IMG/M |
3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI1027J11758_126695321 | 3300000789 | Soil | MSLIDARTVKVLVTALLFALALAFLYIAHRTLIAF |
JGI20242J16303_1047342 | 3300001648 | Forest Soil | LALIDSRTVRVLATTLFFALGLGFLYIARRTLIAFL |
JGI12627J18819_102060722 | 3300001867 | Forest Soil | LLLADARTARVLVTVLLFALGLGFLYVARATLIAFLFAI |
JGIcombinedJ26739_1014795542 | 3300002245 | Forest Soil | MSLIDARTARVLLTLILFALALGFLYVARRTLIAFLFAVFFAYLVDPAASRVEKWV |
JGI25387J43893_10475301 | 3300002915 | Grasslands Soil | MMSLIDGRTTRVLFTVLLFALGLGFLYAAHRSLIVFLFAV |
Ga0062389_1026461691 | 3300004092 | Bog Forest Soil | LLLADSRTAKALVTVLLFALGLGFLWVARATLMAFLFAIFFAY |
Ga0062386_1013595961 | 3300004152 | Bog Forest Soil | MSLIDARTSRVLFTVLLFALALGFLYIARRTLIAFLFAVFFAYL |
Ga0062595_1015219002 | 3300004479 | Soil | MAILDTRTARILFTASLFALGLWVLYAARQSLFAFLFAIFFAYLM |
Ga0058861_105358232 | 3300004800 | Host-Associated | MTALIDSRATRIIFTVLVFGMGLAFLYFARRTLIAFLFAVFFAY |
Ga0058862_113714141 | 3300004803 | Host-Associated | MTAFIDSRATRIIFTVLVFVMGLAFLYFARRTLIAFLFAV |
Ga0062594_1014360722 | 3300005093 | Soil | MSLIDARTSRVLFTVLLFALGFGFLYIARHTLIAFLFAVFFAYL |
Ga0066815_100771941 | 3300005164 | Soil | MVLIDTRTSRVLFTALLFALGLGFLYVIRGTLIVFLFAVFFA |
Ga0066677_106779532 | 3300005171 | Soil | MPLIDGRTTRILFTVSLFAIVVGFLYVARRTLIAFMFAVFF |
Ga0066690_105451631 | 3300005177 | Soil | MPLIDGRTTRILFTVSLFAVGVGFLYIARRTLIAFMFAVFFAYLVDPAVSR |
Ga0066688_100175836 | 3300005178 | Soil | MALIDTRTSRVLFTALLFGLGLGFLYVARKTLIVFLFAVFFAYL |
Ga0065712_101103351 | 3300005290 | Miscanthus Rhizosphere | MTAFIDSRATRIIFTVLVFVMGLAFLYFARRTLIAFLFAVFFAY |
Ga0070690_1003488702 | 3300005330 | Switchgrass Rhizosphere | MSLIDARTSRVLFTVLLFALGFGFLYIARHTLIAFLFAVFFAYLVDPAV |
Ga0070670_1000236607 | 3300005331 | Switchgrass Rhizosphere | VSLIDTRTSRILFTALLFALGLGLIYAARRTLIWFLFAIFFAYLMAP |
Ga0070673_1010220421 | 3300005364 | Switchgrass Rhizosphere | MSLIDARTSRVLFTVLLFALGFGFLYIARHTLIAFLFAVFFAYLVDPAVSRTEKLVR |
Ga0070703_102435311 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | MSLIDARTSRVLFTVLLFALGFGFLYIARHTLIAFLFAVFFAYLVDP |
Ga0070713_1005813972 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MALIDTRTSRVLFTALLFVLGLGFLYVARKTLIVFLFAVFFAYLMEPAVSRLEKVLHGRG |
Ga0066681_103238801 | 3300005451 | Soil | LPVTDGRTARVLITVLLFALGLGFLYAARQTLVAFLFAVF |
Ga0066687_100308991 | 3300005454 | Soil | MPLSLIDTRTTRVIITVLCFTLVLAFLYVARHTLIVFLFA |
Ga0070681_119821022 | 3300005458 | Corn Rhizosphere | MTALIDSRATRIIFTVLLFAMGLAFLYFARRTLIAFLFAVFFAYL |
Ga0070698_1000453701 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | LALIDTRASRILITVLLFALALAFLYAARHTLVAFLFAIFFA |
Ga0073909_101889602 | 3300005526 | Surface Soil | MSLIDSRTTRILFTVLLFALGIGFLYVARRTLMAF |
Ga0070731_105971442 | 3300005538 | Surface Soil | MSLIDVRTTRVLFTVSLFALGLGFLYIAHRTLIAFLFAVF |
Ga0070731_108632201 | 3300005538 | Surface Soil | LPLADGRTARVIITVLLFALGLGFLYAARQTLIAFLF |
Ga0070733_102330801 | 3300005541 | Surface Soil | MPLLDARTLRILFTTLLFGLAIGFLYLAHITLMAFLFAVFFAYLVDPAVS |
Ga0070732_110148102 | 3300005542 | Surface Soil | MSLIDSRTTRILFTVLLFALGIGFLYVARRTLIAFLF |
Ga0066701_108363881 | 3300005552 | Soil | MPLIDGRTTRILFTVSLFAVGVGFLYIARRTLIAFMFAVFFAYLVDPAVSRVEKW |
Ga0066661_108912492 | 3300005554 | Soil | LSLLDSRTARVLITVLLFAIVLGFLYVARATLIAF |
Ga0066692_104901641 | 3300005555 | Soil | MALIDTRTSRVLFTALLFALGLGFLYVARKTLIVFLFAVFFAYLMEPAVSR |
Ga0066707_108843051 | 3300005556 | Soil | MMALIDSRATRIIFTFLVFAVGVAFLYAARRTLIAFMFAVF |
Ga0066699_108127061 | 3300005561 | Soil | MPLIDGRTTRILFTVSLFAVGVGFLYIARRTLIAFMFAVFFAYLVDP |
Ga0066703_106023232 | 3300005568 | Soil | LVLIDTRTARGLFTALLFAVGIGFLYAARHTLVAF |
Ga0066705_100372541 | 3300005569 | Soil | MLLDEKTTRVLITLLLFAAVLGFAWAARAVLIAFLFAIFFA |
Ga0066705_103572912 | 3300005569 | Soil | MSLIDARTTRVLFTVLLFALTLGFLYIARRTLIAFLFAVFF |
Ga0066691_101261733 | 3300005586 | Soil | MPLIDGRTTRILFTVSLFAVGVGFFYIARRTLIAFMFAVFFAYLVDPAVS |
Ga0070763_102037733 | 3300005610 | Soil | LLLTDSRTARVLLTVLLFALGLGFLYVTRQTLIAFLFAIF |
Ga0070763_105219841 | 3300005610 | Soil | LPLADGRTARVIITVLLFALGLGFLYAARQTLVAFLFAIFF |
Ga0070763_108773112 | 3300005610 | Soil | MPVADARTARVLITVLLFALGLGFLYVARQTLIAFLFA |
Ga0070764_107517401 | 3300005712 | Soil | VALTDARAARVLTTMLLFALALGFLYITRRTLIAFLFAVFFAYLVDPAVSRVEKWT |
Ga0070764_109880721 | 3300005712 | Soil | LLLTDSRTARSIVTGLLFALGLGFLYVARATLIAFLFAI |
Ga0066903_1016660791 | 3300005764 | Tropical Forest Soil | VQSLIDAKTTRVLFTVLMFALALSFLYVARHTLVGFLFAVFFAYLVDPAVSRVEKLVKSRGLA |
Ga0066903_1041795201 | 3300005764 | Tropical Forest Soil | LLLTDSRTARVLVTVLLFALGLGFLYVTRDTLIAFLFA |
Ga0068858_1000747221 | 3300005842 | Switchgrass Rhizosphere | MSLIDARTSRVLFTVLLFALGFGFLYIARHTLIAFLFAVFFAYLVDPAVSR |
Ga0075280_101404862 | 3300005904 | Rice Paddy Soil | VQSLIDSRTARVLFTVLLFALALGFLYVARRTLLVFLFAIFFAYLVDPAIAKLEK |
Ga0066790_102008802 | 3300005995 | Soil | MSLIDLRTTRVLFTALLFVLALGFLYVAHYTLMAFLFAVFFAYLVDPAVSRLDRWT |
Ga0075028_1007131321 | 3300006050 | Watersheds | LTPVDSRTSRILFTVLLFALGLYVLYAVRHTLTAFLFAIFFAYL |
Ga0075017_1006421472 | 3300006059 | Watersheds | LTILDSRTSRVLITALLFAVVFGFVYAARRTLILFL |
Ga0070715_101834761 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MPLIDGRATRILFTVSLFAVGLGFLYVARRTLVAFLFAVFFAIS* |
Ga0075018_104487812 | 3300006172 | Watersheds | LTILDSRTSRILLTALLFALGLGFLYTARRTLILFLF |
Ga0070716_1013790951 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MSLIDARTARVLFTLLMFALALGFLYIARRTLIAFLFAVFFA |
Ga0075021_106054191 | 3300006354 | Watersheds | LLLTDSRTARVIITVLLFALGLGFLYVARATLIAFL |
Ga0075521_102987971 | 3300006642 | Arctic Peat Soil | LTLLDSRTSRVLLTAFLFAVGLGFLYAARRTLILF |
Ga0066660_116179342 | 3300006800 | Soil | MIDTRTARALITILQFALALGFLYVARLTLIAFLVAVFFAYL |
Ga0075425_1012165971 | 3300006854 | Populus Rhizosphere | MSLIDARTSRVLFTVLLFALGFGFLYIARHTLIAFLFAVFFAYLVDPAVSRTE |
Ga0075436_1003799161 | 3300006914 | Populus Rhizosphere | MSLIDARTSRVLFTVLLFALGFGFLYIARHTLIAFLFAVFFAYLVDPAVSRTERLVR |
Ga0075436_1005036772 | 3300006914 | Populus Rhizosphere | MTALIDSRATRIIFTVLLFAMGLAFLYFARRTLIAFLFAVFFAYLVDPGVSRIERWTK |
Ga0102924_12692781 | 3300007982 | Iron-Sulfur Acid Spring | LALVDSRTVRVLITVLLFALVLGFLFIARRTLIAFLFANFFAYLVDH |
Ga0099830_100092928 | 3300009088 | Vadose Zone Soil | MSLIDARATRVLFTVLLFALALGFLYIARRTLIAFLFAVFFAYLMDRAVSRVEKWVKGRG |
Ga0099828_111403181 | 3300009089 | Vadose Zone Soil | MSLIDVRTSRVLFTVLLFALGLGFLYIARRTLIAFLFAVFFSYL |
Ga0099827_102077053 | 3300009090 | Vadose Zone Soil | MSLIDGRTTRILLTISLFAVGVGFLYVAHRSLIVFLFAVFFAYLVDPAVSRV |
Ga0099827_113462901 | 3300009090 | Vadose Zone Soil | LLLIDTRTARALITILLFALALGFLYVARQTLIAF |
Ga0105248_104546911 | 3300009177 | Switchgrass Rhizosphere | MSLIDIKTARVLVTILLFALVLGFFYIAHHTLIAFLFA |
Ga0116214_10381161 | 3300009520 | Peatlands Soil | LALIDSRTVRVLVTTLFFALGLGFLYIARRTLIAFL |
Ga0116221_10970921 | 3300009523 | Peatlands Soil | LLLADSRTARALVTVLLFALALGFLYVARATLIAFLF |
Ga0105237_107981021 | 3300009545 | Corn Rhizosphere | MSLIDVRTSRVLFTVLLFALGLGFLYIARRTLIAFLFAV |
Ga0105238_129737751 | 3300009551 | Corn Rhizosphere | MTAFIDSRATRIIFTVLVFVMGLAFLYFARRTLIAFLFA |
Ga0116224_104214601 | 3300009683 | Peatlands Soil | LLLTDSRTARAIVTVLLFALGLGFLYVARATLIAFLFAIF |
Ga0116217_100784634 | 3300009700 | Peatlands Soil | MSLIDLRTTRVLFTTLLFALALGFLYIAHYTLMAFLFAVFFAYLVDPAVSR* |
Ga0126370_125751152 | 3300010358 | Tropical Forest Soil | MSLLDGRTTRVLLTAAVFAIAVGFLYVAHRTLIAF |
Ga0126376_125003992 | 3300010359 | Tropical Forest Soil | MSLIDSRTTRILFTVLAFAIGFSFLYVARRTLIAFLFAVFF |
Ga0134066_100539331 | 3300010364 | Grasslands Soil | MPLIDSRTTRILFTIFVFAVGFAFLYVARRTLIAFLFAVFFAY |
Ga0126381_1048175802 | 3300010376 | Tropical Forest Soil | MSLLDGRTTRVLLTASVFAVAVGFLYVARRTLIAFLFAVFFAYLVDPAVSRVEKWT |
Ga0136449_1004042284 | 3300010379 | Peatlands Soil | LTFLDSRTSRVLLTAFLFAVGLGFLYAARRTLILFLFA |
Ga0136449_1004117181 | 3300010379 | Peatlands Soil | LLLADARTARVLITVLLFALGLGFLYVTRATLIAFLFAI |
Ga0134124_106295071 | 3300010397 | Terrestrial Soil | MAFFDNRTARVLITALVFALALGFLYAARRTLIAFLFAVFFAYLVDPA |
Ga0134121_108409661 | 3300010401 | Terrestrial Soil | MTALIDSRATRIIFTVLVFGMGLAFLYFARRTLIAFLFAVFFAYLVDPAASRI |
Ga0150983_135750791 | 3300011120 | Forest Soil | LALIDSRTVRVLITALLFALALGFLYVTRQTLIAFLFAVF |
Ga0137365_104079902 | 3300012201 | Vadose Zone Soil | MPLIDGRTTRILFTISLFAIGLGFLYVARRTLIAFMFAVFFAY |
Ga0137360_113513811 | 3300012361 | Vadose Zone Soil | LLLADARTARVIITVLLFALGLGFLYVTRDTLIAFLFAIFFA |
Ga0137361_100758285 | 3300012362 | Vadose Zone Soil | VPIADARTARVLITVLLFALGLGFLYVARQTLIAFLFA |
Ga0137407_102191051 | 3300012930 | Vadose Zone Soil | MSLIDARTTRVLFTVLLFALALGFLYIARRTLIAF |
Ga0164298_112866632 | 3300012955 | Soil | MALIDTRTTRVPFTVLLFVLGLGFLYVARKTLVVFLFAVFFAYLME |
Ga0164303_104095652 | 3300012957 | Soil | MSLIDARTSRVLFTVLLFALGFGFLYIARHTLIAFLFAVFFAYLVDPAVSRTEKLVRG |
Ga0164299_103402321 | 3300012958 | Soil | MVLIDTRTSRVLFTALLFALGLGFLYVIRGTLIVFL |
Ga0164299_116081681 | 3300012958 | Soil | MTALIDSRATRIIFTVLVFGMGLAFLYFARRTLIAFLFAVFFA |
Ga0134077_105936192 | 3300012972 | Grasslands Soil | MSLIDTRTTRVLFTVLLFALALGFLYIARRTLIAFLFA |
Ga0164304_114905722 | 3300012986 | Soil | MSLLDGRTTRVLFTAAVFVVAIGFLYVARRTLIAFLFAVFFAYLVDPAVSR |
Ga0164306_119014232 | 3300012988 | Soil | MSLIDARTSRVLFTVLLFALGFGFLYIARRTLIAFLFAVFFA |
Ga0157370_110817752 | 3300013104 | Corn Rhizosphere | MALIDSRATRILFTVFVFAIGAAFLYAARRTLIAFLFA |
Ga0157370_116360191 | 3300013104 | Corn Rhizosphere | MSLVDARTTRVLFTVLLFALAFGFFYVAHNTLIAFLFAIF |
Ga0157370_119257681 | 3300013104 | Corn Rhizosphere | MTSLIDSRATRIIFTVLVFAMGLAFLYFARRTLIAFLFAV |
Ga0157374_105606853 | 3300013296 | Miscanthus Rhizosphere | MSLLDGRTTRVLFTAAVFVVAIGFLYVARRTLIAFLFAVFF |
Ga0181539_13725771 | 3300014151 | Bog | LLLADSRTARVLVTVLLFALGLGFLYVTRATLIAFLFAI |
Ga0182018_101269643 | 3300014489 | Palsa | MPVTDGRTARVLITVLLFALGLGFLYVARQTLMAF |
Ga0157377_109877412 | 3300014745 | Miscanthus Rhizosphere | MTAFIDSRATRIIFTVLVFVMGLAFLYFARRTLIAFLFAVFFA |
Ga0137409_112989091 | 3300015245 | Vadose Zone Soil | LLLTDSRTARAIVTVLLFALGLGFLYVARATLIAFLF |
Ga0132257_1013097982 | 3300015373 | Arabidopsis Rhizosphere | MALIDTRTSRVIFTALLFALGFGFLYVARTTLISFLFAIFF |
Ga0182041_110988301 | 3300016294 | Soil | MALIDSRTARVLFTALVFALGLGFLYGTRHTLFVFLFA |
Ga0187818_101096051 | 3300017823 | Freshwater Sediment | MSLIDLRTTRVLFTTLLFALALGFLYIAHYTLMAFLFAVFFAYLVDP |
Ga0187820_10341051 | 3300017924 | Freshwater Sediment | MPLMDSRTTRILFTVLVFAVGLAFLYVARRTLIAF |
Ga0187783_102347781 | 3300017970 | Tropical Peatland | MTDARAARVIITGLLFALGLSFLYATRSTLIAFLFA |
Ga0187781_109820452 | 3300017972 | Tropical Peatland | VPLLDARTARVILTVLLVAAGLAFVWTAWRVLVAFLFAIFFAYL |
Ga0187804_102054561 | 3300018006 | Freshwater Sediment | LTILDSRTSRVLVTALLFAVGLGFLYAARRTLILFLFA |
Ga0187871_100481591 | 3300018042 | Peatland | LALIDSRTVRVLATTLFFALALGFLYIARRTLIAFL |
Ga0187859_1000513610 | 3300018047 | Peatland | LTILDSRTSRVLFTALLFAVGLGFLYAARRTLILFLF |
Ga0187859_104126152 | 3300018047 | Peatland | VALTDARAARVLTTTLLFALALGFLYITRRTLIAFLFAVFFA |
Ga0187772_107338821 | 3300018085 | Tropical Peatland | LTVLDSRTSRVLFTASLFALGLGFLYAARRTLVLFLFA |
Ga0187771_104277861 | 3300018088 | Tropical Peatland | LLLADSRTARVLVTALLFALGLGFLYVARATLIAF |
Ga0187770_116001812 | 3300018090 | Tropical Peatland | VENLLLLADSRTARVLVTVLLFALGLWFLYVTRTTLMAFLFAIFFAY |
Ga0066655_103211101 | 3300018431 | Grasslands Soil | MSLIDVRTTRVLFTVLVFTLALGFFYIARRTLIAFLFATFFAYLV |
Ga0066655_114407142 | 3300018431 | Grasslands Soil | MSLIDARTSRVLFTVLLFALALAFFYIARRTLIAFL |
Ga0066667_101034504 | 3300018433 | Grasslands Soil | MPLIDGRTTRILFTVSLFAVGVGFLYVARRTLIAFMFAVFF |
Ga0181514_13340102 | 3300019268 | Peatland | MPLIDLRTLRVLTTTLLFVLVLSFLYVAHHSLMAFLFAVFFAYLVDPAVSRIEKW |
Ga0182031_13444735 | 3300019787 | Bog | VTILDSRTSRVLFTAFLFAVGIGFLYAARRTLILFLFAIFLPI |
Ga0182031_13763422 | 3300019787 | Bog | VTILDSRTSRVLFTAFLFAVGIGFLYAARRTLILFLFAIFLCLSD |
Ga0137408_13474761 | 3300019789 | Vadose Zone Soil | MSLIDARTTRVLFTVLLFALALGFLYIARRTLIAFLFAVFFAYLV |
Ga0193728_12077352 | 3300019890 | Soil | VIDTRTARVLVTVLLFALGFGFLYAARQTLIAFLFAIFF |
Ga0193755_12097121 | 3300020004 | Soil | MLSLIDTRTTRVLFTVLLFALVLGFLYAARRTLVAFL |
Ga0193724_10365673 | 3300020062 | Soil | LAPVDSRTSRILFTVLLFALGLYFVYSVRHTLVAFLFAIF |
Ga0210401_111713582 | 3300020583 | Soil | MALIDTRTSRIIFTVLLFAVGLGFLYVARKTLVSFL |
Ga0210400_104437061 | 3300021170 | Soil | LALIDSRTVRVLVTALFFALGLGFLYIARRTLIAFL |
Ga0210405_110439171 | 3300021171 | Soil | LPLIDTKTTRVLFTVLLFALALGFFYVAHRTLEAFL |
Ga0213875_105483692 | 3300021388 | Plant Roots | MSLLDSRTTRVLITASVFVLVGGFLYAAWRTLIAFLFA |
Ga0210386_101492221 | 3300021406 | Soil | MALIDSRTSRVLFTALLFALGLGFLYVARKTLIVF |
Ga0210383_110812421 | 3300021407 | Soil | LPVADARTARVLITVLLFALGLGFLYVARQTLMAFLFAIFF |
Ga0210383_114723442 | 3300021407 | Soil | MPITDGRTARVLITVLLFALGLGFLYVARQTLIAFLFAIF |
Ga0210391_101379174 | 3300021433 | Soil | LLLTDSRTARVLLTVLLFALGLGFLYVTRQTLIAFLLAIF |
Ga0210390_116122431 | 3300021474 | Soil | MPVADARTARVLITVLLFALGLGFLYVARQTLMAFL |
Ga0210409_100298247 | 3300021559 | Soil | MSLIDVRTARVTFTLLLFALGLGFLYVARRTLIAFLFAVFFAYLVDPAVTR |
Ga0224541_10075831 | 3300022521 | Soil | LTIIDSRTSRVLFTAFLFAVGFGFLYAARRTLILFLFAILF |
Ga0242656_10653291 | 3300022525 | Soil | MALIDTRTSRVLFTALLFALGLGLLYVARKTLIVFLFAVFFAYLMEPA |
Ga0212123_108689101 | 3300022557 | Iron-Sulfur Acid Spring | MALIDLRTVRVLFTALLFALALGFLYVAHQTLMAFLFAVFFAYLV |
Ga0242673_11334961 | 3300022716 | Soil | LLLTDSRTARVLVTVLLFALALGFLYVARATLIAFLF |
Ga0242675_11387801 | 3300022718 | Soil | MSLIDVRTARVTFTLLLFALGLGFLYVARRTLIAFLFA |
Ga0242657_10426561 | 3300022722 | Soil | MPIADGRTARVLITVLLFALGLGFLYAARQTLIAFLFAIFF |
Ga0242654_101689442 | 3300022726 | Soil | VALTDARAARVLTTALLFALGLGFLYITRRTLIAFLFAVFFAYLVDPAVSRVE |
Ga0242654_101827501 | 3300022726 | Soil | LPLADARTARVLITVLLFALGLGFLYVARQTLMAFLFAI |
Ga0222622_105834051 | 3300022756 | Groundwater Sediment | MVVFDTRTSRVLFTALLFALGVGFLYVARHTLIVFLFAIFFAYLMEPAVSRLEKWLHGRG |
Ga0207656_106424501 | 3300025321 | Corn Rhizosphere | MTALIDSRATRIIFTVLVFGMGLAFLYFARRTLIAF |
Ga0208478_10942442 | 3300025475 | Arctic Peat Soil | LTILDSRTSRVLFTAFLFAVGLGFLYAARRTLILFLFAI |
Ga0207695_109034022 | 3300025913 | Corn Rhizosphere | MTSLIDSRATRIIFTVLVFAMGLAFLYFARRTLIAFLF |
Ga0207671_100690071 | 3300025914 | Corn Rhizosphere | MALIDSRTTRILFTVLVFAVGFAFLYVARRTLIAF |
Ga0207693_103421093 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | VALIDTRTARVLFTALLFLAGLALVYLTRRTLVLVL |
Ga0207693_111708901 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | LTIIDSRTTRVLFTALLFALGIGFVYAARRTLILFL |
Ga0207663_107718742 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MMALIDSRATRIIFTFLVFAIAVAFLYAARRTLIAFMFAVFFAYL |
Ga0207660_108211302 | 3300025917 | Corn Rhizosphere | MSLIDARTSRVLFTVLLFALGFGFLYIARHTLIAFLFAVF |
Ga0207700_110102971 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MALIDTRTSRVLFTALLFALGLGLLYVARKTLIVFLFAVF |
Ga0207669_105133171 | 3300025937 | Miscanthus Rhizosphere | MSLIDARTSRVLFTVLLFALGFGFLYIARHTLIAFLFAVFFAYLVDPAVSRTEKL |
Ga0207665_105973441 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MAFFDNRTARVLITAFAFALALGFLYAARRTLIAFLFAVFFAYLVDPA |
Ga0207665_109687142 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MSLIDARTARVLFTLLMFALALGFLYIARRTLIAFLFAVFFAYLV |
Ga0207661_118297591 | 3300025944 | Corn Rhizosphere | MSLIDTKTARVLFTVLLFTLVLGFLYVARETLIAFLFAI |
Ga0207679_101821261 | 3300025945 | Corn Rhizosphere | MTALIDSRATRIIFTVLVFGMGLAFLYFARRTLIAFLFAVFFAYLVDPAAS |
Ga0207998_10261941 | 3300025989 | Rice Paddy Soil | VQSLIDSRTARVLFTVLLFALALGFLYVARRTLLVFLFAIFFAYLVDPAIAKLEKLVHSRGRAIGVV |
Ga0209849_10126651 | 3300026215 | Soil | MSFIDSRTTRVLITVLLFALALGFLYVAHYTLIAFL |
Ga0209839_101029032 | 3300026294 | Soil | MSLIDLRTTRVLFTALLFVLALGFLYVAHYTLMAFLFAVFFAYLVDPAVSRLDRWTRGRG |
Ga0209267_11203053 | 3300026331 | Soil | MALIDTRTSRVLFTALLFGLGLGFLYVARKTLIVFLFAVFFAYLMEPAV |
Ga0209377_10986202 | 3300026334 | Soil | LALIDTRASRILITVLLFALALAFLYAARHTLVAF |
Ga0209056_104034552 | 3300026538 | Soil | MSLIDTKTARVLFTVLLFALALGFLYVARETLIAFLFAVFFAYLLDPAVS |
Ga0209376_12590092 | 3300026540 | Soil | LALIDTRASRILITVLLFALALAFLYAARHTLVAFLFAIFF |
Ga0209577_108413502 | 3300026552 | Soil | MPLIDGRTTRILFTVSLFAVGVGFLYIARRTLIAFMFAVFF |
Ga0207819_10357492 | 3300027024 | Tropical Forest Soil | MALFDTRTARILFTALVFTLALGFLYVARRTLIAFLFA |
Ga0208730_10391131 | 3300027047 | Forest Soil | MALIDTRTSRVLFTALLFALGLGLLYVARKTLIVFLFAVFFAYLME |
Ga0209003_10847722 | 3300027576 | Forest Soil | MTIIDSRTTRVLFTTILFALGLSFLYIARRTLVAFL |
Ga0209733_11396712 | 3300027591 | Forest Soil | LALIDTRTVRVLMTTLLFALALGFLYIARRTLIAF |
Ga0209328_102257561 | 3300027727 | Forest Soil | MSLIDARTARVLLTLILFALALGFLYVARRTLIAFLFAVFFAYLVDPAA |
Ga0208989_102471671 | 3300027738 | Forest Soil | LVLIDTHTARALVTILLFALALGFLYVARATLIAFL |
Ga0209169_101912663 | 3300027879 | Soil | LLLTDSRTARVLLTVLLFALGLGFLYVTRQTLIAFL |
Ga0209068_108272042 | 3300027894 | Watersheds | LTVLDSRTSRVLITALLFAVGFGFVYAARRTLILF |
Ga0209067_100970151 | 3300027898 | Watersheds | VQLIDGRAARVLITALLFALVIGFLYEARQTLFAFLFAVFFAY |
Ga0209048_105828711 | 3300027902 | Freshwater Lake Sediment | LSILDSRTSRVLFTAFLFAVGLGFLYAARRTLILFL |
Ga0209006_114323112 | 3300027908 | Forest Soil | LLLIDSRTARVLVTALLFALGLGFLYVTRQTLIAFLF |
Ga0209526_107566651 | 3300028047 | Forest Soil | MSLIDARTARVLLTLILFALALGFLYVARRTLIAF |
Ga0302156_103300961 | 3300028748 | Bog | MPLIDLRTLRVLTTTLLFVLVLSFLYVAHHSLMAFLFAVFFAYLVDPAVSRIEKWTHSRG |
Ga0302225_104584912 | 3300028780 | Palsa | LPLADARTARVVITLLLFGLGLGFLYVARQTLIAFL |
Ga0307296_107765781 | 3300028819 | Soil | LALIDLRTVRVLFTALLFAAGVAFLYLAWRTLIIFLFAVFF |
Ga0308309_112365332 | 3300028906 | Soil | LLLADSRTARALITVLLFVLGLGFLYVARATLIAFLFAMFFAY |
Ga0311331_102828293 | 3300029954 | Bog | LPVTDGRTARVLITVLLFALGLGFLYVARQTLVAFLFA |
Ga0302274_102608542 | 3300030041 | Bog | MPLIDLRTLRVLTTTLLFVLVLSFLYVAHHSLMAFLFAVFFAYLVDPAVSRIEKWTHSRGLAIGAI |
Ga0302179_103501361 | 3300030058 | Palsa | MPVTDGRTARVLITVLLFALGLGFLYVARQTLMAFLFAIF |
Ga0310037_102609662 | 3300030494 | Peatlands Soil | LLLTDSRTARALVTVMLFALGLGFLYVARATLIAFLF |
Ga0302309_104218731 | 3300030687 | Palsa | LLVADSRTARVIVTVLLFALGLGFLYVARSTLIAFLF |
Ga0265746_10374622 | 3300030815 | Soil | LLLTDSRTARVLLTVLLFALGLGFLYVTRQTLIAFLFA |
Ga0170834_1087565033 | 3300031057 | Forest Soil | LLLTDSRTARSLVTVLLFALGLGFLYVARATLIAFLFAIFFA |
Ga0265316_100362566 | 3300031344 | Rhizosphere | LLLTDSRTARALVTVLLFALGLGFLYVARATLIAF |
Ga0265316_105130732 | 3300031344 | Rhizosphere | LLLADSRTARVLVTVMLFALGLGFLYVARATLIAFL |
Ga0170820_115469501 | 3300031446 | Forest Soil | LPLIDTKTTRVLFTALLFALALGFLYVAHRTLEAFLFAVLFAY |
Ga0302326_101825026 | 3300031525 | Palsa | MPVTDGRTARVLITVLLFALGLGFLYVARQTLMAFLF |
Ga0307474_113325922 | 3300031718 | Hardwood Forest Soil | MALIDTRTSRVIFTVLLFAVGLGFLYVARRTLFAFLFA |
Ga0307477_110438682 | 3300031753 | Hardwood Forest Soil | LPVADARTARVLITVLLFALGLGFLYVARQTLMAF |
Ga0307475_108881921 | 3300031754 | Hardwood Forest Soil | LLLTDSRTARSIVTVLLFALGMGFLYVARATLIAFLFAIF |
Ga0306921_117269761 | 3300031912 | Soil | MALIDSRTARVLFTALVFALGLGFLYGTRHTLFVFLFAIFFAYLMDPAVSRLEKW |
Ga0310916_106082851 | 3300031942 | Soil | MAIFDARTARVLFTALVFLLGLSFLYVARRTFIAFL |
Ga0310913_107301562 | 3300031945 | Soil | MALIDSRTARVLFTALVFALGLGFLYGTRHTLFVFLFAIFFAYLMDPAVSRLE |
Ga0307479_114418682 | 3300031962 | Hardwood Forest Soil | MALIDTRTSRVLFTALLFALGLGLLYVARKTLIVFLFAVFFAYL |
Ga0308176_102806354 | 3300031996 | Soil | MSLIDTRTVRVLVTALLFALALAFLYIARRTLIAFLFAVFF |
Ga0306922_108535542 | 3300032001 | Soil | MSLIDSRTTRVLVTVSVFAIALGFLYVARRTLIAFLFAVFFAYLVDP |
Ga0306922_115618611 | 3300032001 | Soil | MAIFDARTARVLFTALVFLLGLSFLYVARRTFIAFLFA |
Ga0310911_105431041 | 3300032035 | Soil | MSLIDSRTTRVLVTVSVFAIALGFLYVARRTLIAFLFAVFFAYLVDPAISRVERWTK |
Ga0307471_1004702661 | 3300032180 | Hardwood Forest Soil | MPMALIDTRTSRVIFTALLFALGFGFLYVARTTLFSFLFAIFFAYLMDPAVSRL |
Ga0307471_1012226692 | 3300032180 | Hardwood Forest Soil | LGCALALIDLRTVRVLFTALLFAAGVAFLYLAWRTLIIFLFAVFFAYLL |
Ga0335078_120722791 | 3300032805 | Soil | LLLTDSRTARALVTVLLFALGLGFLYVARATLIAFLFAIFFA |
Ga0335081_117593992 | 3300032892 | Soil | MALIDGRTTRVLFTVLLFALGLGFLYAARRTLIAFLFA |
Ga0335069_113888252 | 3300032893 | Soil | LLAFIDSRTARVVFTLLLFALGLGFLYVARETLMAFLSAT |
Ga0335072_102127924 | 3300032898 | Soil | LLLTDSRTARVLITVLLFALALGFLYVARATLIAFLFAI |
Ga0316212_10408202 | 3300033547 | Roots | MPVTDARTAKVLITVLLFALGLGFLYAARETLIAFLF |
⦗Top⦘ |